current user: public

If you have questions about the server, please let us know.

Query: PF08626.11; C0NZX0_AJECG/5-1447; Transport protein Trs120 or TRAPPC9, TRAPP II complex subunit, from PfamA32U

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650    .  660    .  670    .  680    .  690    .  700    .  710    .  720    .  730    .  740    .  750    .  760    .  770    .  780    .  790    .  800    .  810    .  820    .  830    .  840    .  850    .  860    .  870    .  880    .  890    .  900    .  910    .  920    .  930    .  940    .  950    .  960    .  970    .  980    .  990    . 1000    . 1010    . 1020    . 1030    . 1040    . 1050    . 1060    . 1070    . 1080    . 1090    . 1100    . 1110    . 1120    . 1130    . 1140    . 1150    . 1160    . 1170    . 1180    . 1190    . 1200    . 1210    . 1220    . 1230    . 1240    . 1250    . 1260    . 1270    . 1280    . 1290    . 1300    . 1310    . 1320    . 1330    . 1340    . 1350    . 1360    . 1370    . 1380    . 1390    . 1400    . 1410    . 1420    . 1430    . 1440
# E-value Template Links and tools%idFirst PLSPVAPARLRALLLPVGNIKRSRFLNLVKRLQDQNVVRLGDVSPDCRPNRNAFSPMAFPTGMIVYDLSISVPPISHLDLYPFEIFREPLVIIAIADGTELPGPPEGTGTYSQTQSNGTKPCNYPTVEGLQLLQQELNTLKDSHPKSLVQQLLVFDYAAVSKLVTGPDTVIWVPRPEAARSTTVKTVMCDITSRLLGELSGLAERIQEWPTVESPKASSWGPRRKPEVRPPVSEKLQHRMTMPAQLPGANGTFVDASDTNFQPAEHDSPTTFDEITRSIQVSNRVTSSIKASSKPGSKEHSRERMSAQGLGFVAASERSKSRVKGRLNIVMGTLFLQAGRWPDSLKELAEGATIARANSDYIWHAKALESILQCLLMLGWAGMDFRIPQICYPTADKFSKSVSQTPSLSHTELYSIGQSNPENRRVSLQNLANLLPDLANNILNLYTRAANITDEPVPQLVFSETVIRLARILATVYIRDGSLDDSALGNIVMNDSLKFVRSQERPRGTVSLRKSDIASFLFRALPASLGTDVPITDSTPILVGMASVLSSLGLDRKNAFVLQLLFSILIPGLVQARKIGAAEVGIHPAAGLSALNYSAFEMNALDAGPGNMEESIRILLALVGKIYGVPGIMICTDNRRDLSRHNSTAKSETVPEYDSVDSIVDRAFRHSVMNGFGDHTLKVEILKACINLCEALPDFQGVLQFTVDLLQTVKGTLMLLPDSYLGLPVIPLQEQVRLFNNVKRTVAAAKKLGDSNLEAEYWDDFMVRGVELVNSSDFKSPVRRSRTDFGFANVEERLEKKNPFIYSTFSKATTKRSEDLLIAEEPATFKVTLQNPFEFDVEIESLRIDGTGIPFEAAATHGLWLAPFTTQEYYISGVAATEGTLEIRGCTVKVKFCRERIFPIFKNFWKPQKEQKIKRTGLAAKEPFSERPLSWSSNASRSRLGASRKGPEPDIVLIKVIQKQPTVIIHSTSLSQSAIMLLEGETRSFDITLQNISTCPLDFISFSFEDSSTPQLQSALNNKENLPTDMYELELRLSTNPAMTWRRDKLHDYELSIAPGETATFTIDIYGKPGLDNAILKIDYANVCTSLADLPETFYCRQISLPLTVTVNAGVDVTRCDVLPFTSDFAWDNNKLQQSEDSRTSLGDKEAIKSMESSSTPRSITQFREAQFSQTFSRIGLSSFGFGHCLLLLDLRNAWPNPLTVSLFVNENISDGAKSPDDKLKHNPVGIHEIFDELQPGHISRFLLVVPRVYIENAQKPIPSLNVSNKRQFVVSANKLDYEAESSARECFWFREELLKHLRGSWKDVATGRGGVIDLRAIRLNARMVDALRIDDADVTFSLRPYTGDSSNDKTIENGIDSVSQTGHSKFTVKTNTFLTLSATIINRSSKPIHPLLRLQPSLRHTPHAIALDLSKRLAWSGMLQRALPILEPHQTTEVTLGVLast
1 0.000e+00UniRef50_A0A1D2NB25 Trafficking protein particle complex subunit 9 n=1 Tax=Orchesella cincta TaxID=48709 RepID=A0A1D2NB25_ORCCI  ali  14  27...PLDHQSLLVVVRHIGQLRTKQFNRAFERISRINQLKVFDSQNQARH---------------IWIRYLRGYPQENNDWGDFQTHRKALGLITVGQCNSQDE--------------------------FNELCRIHESLKVGYAFTLYSRCILFG-------------------LNQDGTLYEESHSSDISPCVDPSDDGFHKKNESNS----------GSPRDSALSS-------------TAMPDSLQSCSNSAGSSAPSSIGGTINMPKKSTSSDSLQNYLETPNEDTFDSVSEDSSSRSESVSGTIQYARMEQESGGGQVNADRQSGDKSLIAPTNFKARTLFYPTMEHSQT---------LETDIEEFIASLFWILESKRMDKLGLRKADRHLLLNSLCAPFEKKDFVGLDLESKNNKRRADGRLKKQLGDLLSEAISHYHSAADILKSVNDWLWLAGALEGMCSASVACLYPQLRRSPT-LQRNSSLQGSELTKYKVAAIGTTNSLPPGLDPEQIGGFKPMIKNCLTPAEILEKYREAVTHY---GKYRQAGIIETEASIKAALVLIEQRQT---------------LHAADFLQNAVFISLQLTEDEKMQRFNALSELYTKVGFHRKAAFFKRVAAMRCVSPHNPHPNWALCHSLSLNPNEISTYRFYGWPRLQMQVMQELVGTAKRKGNNALATRHMTFLVHAMLAHMSRDERREFAQQLEALSK-----DAEGLPVPLAIDNGLIVPPVHLQHIPSVKVFKLVPPTPHLKP---------EKVVDKKLEEVSPFVYTPFSAHRDTKADFSWVEGELCEVNVILENPLPIELKVSSMCLITEGVKFHVNSNVISIPAESSMFPATLTGKPLEPGTLRILGYSTYTLGVKSNIRLKNMKNMVFPHIDVEIVPALPSLDVSTSKPKSEFFSSFSDSV-----------------------------VTSASISLLMGETQECTVTLTNNGKVPIEHLEMKMDSRLDKQILDI-----------------------FKWSEDNIM-SQLPIQPGASASFTVYIYGVGDFIGQSSVSSLPVSNAPSVDGPSSLPSRLGAISDRLRPKRSASNRQEIIYTSIRSPKASMASNVKNYEAVLNLKYSGGPGFKTGHFRRCGVAFNVEVSPTLYITKWDLPGESPAQFYLVLDLWNATDNEMEVQYAKNK-----------------------QILVEKAESCRIPVPVDRCPMANVDK---------------------------GKEEQACCEHIVTNVDLKWVLP--ECSGKATLQGIRLTAPMVQLVTVSPIHWEITINGEAVKPE------------------EIRFDAGEMISVNVWLRNHLKEALDLSLSLDCFQDYQNGRCNYKLDSRFAVIGNDSVLIPEICPGSSFQHALSM 1263
2 0.000e+00UniRef50_C5DW54 ZYRO0D12012p n=7 Tax=Zygosaccharomyces TaxID=4953 RepID=C5DW54_ZYGRC  ali  21  9..SFVQPCRVRLLVVPVGKWKRSQFLEAVTKLRKYNEVRLVDITPI---DSPLFTPQGFPQGRLFFEVITSHNDALNLFLYDFEPFRKIFVVVGLVNDDSSSEDN-------------------------------LKVLKEKYPTVISHNLIYVGSNVDAGSSQDAQ----VFRSGDEFESNLETIICDIGRNFLQALSHYYSSYKHV-TLRSPGAIGGNAVLKTSLTR-------------------------------QLAHANLPTNSTSSSSSSRKMNSFESTTNSIKRSASLKLAK--------SLSTSENRSQLRSQGRQHKILGNFQLLAGRYISALHSFTEAVTQLYKVRDHLWLASALDGIAICLLLLSFLNISFQIPYIVNPSADPISPRNSSNGPIRSPRNSSSSLGLSQDVDVENVNLPILIRSISEKILYYYELSLNHHCDYAPQTVYSETLLKTLTFMVTCYSSTKLSPPILEKIIKGSLSSSLGPATMFDSDEILFSKIEIYSFANKIFELQLKE-MDLESQTIIYIVLSKVYHSLGFARK----------------------------------RLFVLRLLLVALLANQEKINWDENYLEILDGMIKLYGI--------------------------------EDRTPETSVQDSQASAWLTLQRKCLQLCLMVSRKLKNSECTSRYAVMLLSRYTH-------------LLTQSEQQNLFTSFIQPSMFDGYIQS------YWDPFLLRDVKLTRLESDELPVESEMSVLDKKAKTRSDEVFNPFRADKVVSEADPTSQNVFLVGDRAMFSCMVQNPFKFEISFTGIQFN----------SETTKFCELGKSDVNLK-RPYYVGPESI-----RIINLPLELKKATHHEWLNIDSVKISVMGLPAKDFPIAL-----SENRISKPDVENDRFNAGRVQIKILPEQPELQLRTNNMTDNSWMMLHGTKKRFTITLRNKSKCPIEHLQFLHSSNIEQSIKPDYW-KKMQLDDLYGLETQLEWMKN---KCIKFIDPPQRMEPHETCSFDMEVDAPFHFNGFDLVINYG----MNANDKSRVYLKTLHSSYHVTLKRSIEVSSIDIVSLNQDFTSEADHVDWVHYLLKK-------------------------------QETDDNFNINKYLLLLLDVRNSWIDSIKTQLHYEDFESHEY-------------------TIESLHTTRVVIPIRKLYQNYNFKKQLVPRVWQGRQYIQS--GLNEEQEIEMRERFWCRQHILSRLSCDWILTTDSIKGTVYFPQFRFDPKMVSSLYEAKSPYHIDLSIDKRSVTKGECVNAVVKVSPRSISDCTTSP--------------QSPPERLLLNFAIFDSHTAKLLSKS-NRRVLFNGTLSRHLIVIKPVET....... 1221
3 0.000e+00UniRef50_A0A226F4R1 Trafficking protein particle complex subunit 9 n=1 Tax=Folsomia candida TaxID=158441 RepID=A0A226F4R1_FOLCA  ali  12  27...PHDHSALLVVVRHIGQLRTKQFNRAFERISRVNQIKLNDSQGNPR---------------QIWVRYLRGYPGEQNDWSDFQTHRKALGLISVGQCNSQDE--------------------------FNELCRIHEQAKVGYAFTLYSRCILLGLNPDGTLYEGSHSSDVSPCVDGE---------DDRVHHSVSVFNNKSKIEGSDSNFNDPARNCSSGIASSSEGIGTGAESLPSEDNASMSSSLSLPSAVCGDDTRKSPSSDSLQNYLASGSVEESEATDSTSEETTSKESTNSIGTGIPYSSMRESENPILGLSTDPDSRSQSSEGRNSLIAPSNFKARTLFYPTMDQSQN---------LETDILEFISSLFWVLESKRLDKLAVRKADRTLLLSSLCAPFEKKDFVGLDLESRWNKRRADGRLKKQLGDLSLQAITHYQAAIEILKSVNDWLWLAGALEGLCSVSVCCMYPQLRKALPLQRNSSLQGADMVKYKNLSGSSSSSSLPPGLEPESLSGMRPPIKNCLSPQDLLDKYREAVTHY---GKYRQAGVIETEASIKASLVLIEQRQTLAA---------------AEFLQNAVFISLQLTEDEKMHRFNALAELYTRLGFHRKAAFFKRVAAMRCVSPHNPHPNWALCHSLLLQPSENSIFGFYGWPRLQMQVMQELVGTAKRKGNSALATKHMTLLVHTMLPHMTRDERRDFSQQLEILSKEAEGL-----PVPLAIENGVIIPPVNLTLIPYVKLFKLIAPTPHLKPQKIVER--------KPTDEISPFVYTPFNRKDITKADFNWVEGELCEVNVILENPLPVELKVSSMCLITEGVKFHVNSNVISVPAESSMFPATLTGKPLEPGILRIIGYSTYTLGVKSN-------------------IRLKSLQNMPFPYVDIEVDPALPAIEIQTSKAKSDCFS----------SLSDSIVTSASISMLMGENQECTVTIANVGKVPIELLELTLD-----------------------VQGDKRAFEIFKWSDENIV-SQLPIQPGANASFTIYVYGAGEFIGQPDCHSGDPMTSNASDGPSSLPSRLGAISDRLRSKRSSASNRSSVKSFMSSNISPISSQTKNYEAVLKLKYSGGPGHQTGHFRTCGIALNVEVSPAVFITKWDLPGDSPSQFYLVLDVCNVTQHEMEIHYAKTK-----------------------QILVEKGDTCRIPVPLDRCSLTNVEK---------------------------GKEEFACCEHIVTNVDLKWILPES--SGKATLHGITLTQAMVQLVTVSPIQWEITVNGESVKPE------------------EMRFEAGEMINVNVWLRNHLKESLDLNLSLDCFQDYQNGRINNRLDSRFAVIGNDSVLIPKIGPGSSFQHSLS. 1293
4 0.000e+00UniRef50_A0A1A0H7N4 Trs120-domain-containing protein n=1 Tax=Metschnikowia bicuspidata var. bicuspidata NRRL YB-4993 TaxID=869754 RepID=A0A1A0H7N4_9A  ali  20  4.FKFITPARVRVFLTPVGEISPQNFHHYAEIVKSVTDIRLLDVSPI--PECRHFNPQEFSQGRIFYNPSVEPDADDTTFLEDFEPFRKTFIVIGLGIHPASP----------------------------QHLTHTLASLKADHPAAISHNIIYQQSLTEKSELP---EIFHISKEAEKIRTSIETVLCGITRNFLVSLDEYAYSYESI-TLRSPISLMDSSVLTRTINLAQKRLSSGLSFKPLFANGQNVTSSV--------------------------------------------------KDLKVKSLQRQTGRQAKIMGNFFLLAGRTQDALQYFTDA-------AINSKKSDDYLWLASALEGIAVSATILLHLGLPFQIQNPMFASVLHLPKSRNSSIMKSNGKVSMEDHQLGTIIDVSQVQIIEFLILLTLRTSHYYKLSTYEVDDCVPDIVYVESLLRNTKLMVTIYLSRSRNTVPILEQLVGFESLNGQKV----SAEFNLLQKNIVAEMDRIFALQLNKL-DITKQCRIYCALASIYRDLGLYRKYGLVIRLLLDV-------------------------LLPQASFIEQNLTSGELGSAKYLKDIIETLLYIYHIDEKKDTSC--------------------------------LSPKHNSNWIVLQLLLIKVCLRIAEAFQDYATLMKLCVLTLNKFTHCLPVEDQIKLRDKL--------------SWLNLISAKEAVDLQAPHPDPFIIRDAKFIVLLRSTSLVPLASKN-------TSDLKSNSVFFDPYNKGKKGTADRIICQNEVHQLKVVLQNPFYYGLDIRAMHLETVASLFKVASISQFSIPPISTAEVIISFRALEPGSFHITEFEVDFGNKYSQSFSIIDQE---------KYSGLNKLTYYRVNIPNQSSQTLENMFHNLLVGNFGNRATKKIVSSQPTLSIVKNQKPNDWVMLLEGEVQSSSLKLKNCSNDLVNYLSISPWDSTVDSISSKLSQNNLNAAEVYELEWLLLERKALCVNKSEIASEYKVIPPGGEVDIHYDIIGKCGMSELKLILEYGKRLSDTHGDC---FLKKLIVPCLISIHRSLEITASNIIPLFSS------------------TWNVLSESNTSIIGCPAQESLTDLNEFILSISASSTEDVSDYCLLVLDVRNFWKDCLVAKIASKLG----------------TRHFQIEKCILPNKSAKLFIPVRRIR-GHSFDPFKAIPSMRKKQFVKDYT-LSREEERQVRRSFWVREELLKLLSARWNTASSHKEGEIDLRRIRLSAPMTNSLLYDDLLIFHEVFSEDKPDKAFGTEN-----------SRLHLERERFYILRTRVINHTTRSISGMLRHIPFPLNAPTKHDLLIDQKILYNGFLQSHVSKIGPGETYEREIG. 1290
5 0.000e+00UniRef50_V5EU98 Uncharacterized protein n=1 Tax=Kalmanozyma brasiliensis (strain GHG001) TaxID=1365824 RepID=V5EU98_KALBG  ali  19  44...............................................................................................................................................................................................................................................................................FGFDSGAKRPETVDLSSIKDATRSKILAANANKKSAKRIISGTSTGPT---GSGRYAKVKADLHLLSGNLWDALEGYTSALNALAGGQDAVWFASALEGFSVARVLASRMG---GIVLERAPCFDLPWTSASAXXXXXXXXXXXXGVPRPYAKQS-----WGEIAEAYTIAVIIYSKSSDSARDYTHPLIHASACTQYARFLLAVWASGGWNGECFDQLVYGGVPPPTNATYLGLTAISGVERHDIAAAASTALSHSIVALK-ATDQITLLSTLTAIFGCIGFSRREAHLLRNLQSTIVSLLIKAKRANARPPTTASLPILQHQQLGNIVAQTTYDSLGRGPEAVLVLAMQICETYGIHVEVDPLRNLRSAYASPNLGGAEEWKPSDRPAAPTATPLEIANEAPFGWKEQQVALLKETIGIAELLSDYVSMAFFGAILLRDFYP-------------LLEAQEQKELMIGTQRSVQAARWAGAQDLAVKYWGPPEPLCLEVLPLAPERMPYERDAKQVLANGKGGAAADNNPFFWNPSGGSAAGKGKAIAVQNEPIEVMATLQNPFSVDLHIDTIKLVGEGAGFHADEAERVSIPPCSFQTVRLSCTAKDVGKVTIKGLTLTLAGGEEQTFLLPIYDEANSKQRRKQAAETDDRKTRVSGLDSRSSVLKQKSVAPDTNTATTKWLEVSVVPAQPSLAAYCHDLPLHGLDLYEGEPRTIHLELHNLSSLDINHVNVTFSSDAEDLARRTLLESALLPSDVYEVEWDLLHQPVLSCAAREA----VRIERGASTILPIRVTGKIGCTCASIRVEYASVAE------GKFFVRTLDLSFRVSVHPVLVCRNLTVAPLRASEAATLTKECLLSADAVPAALQVFPGTDAD------ILLASEEEASAVAEELATEEDDAEYALLSVDVSNVHREDVLLRLALNTGGVL---------------PLQLFRVVRAGCTVRLVLPQPRLELDALFPPIPSRKDD-GRQFIVSKIQLGEEEEREMRRNFWYRQALLKRLSGGWRTTGSGLWGSIG------EAEGEEGVRGGKVPLRGMISGGGLVLDEAGLLHLQKDPVKVSLSFDDEVRAESFVTVTASITNRLNRTVHPIIRLVPTSPSGGTAQDTTLLDSVIVSGTFTASKQQLRRGEERSVQWGV 1244
6 0.000e+00UniRef50_UPI000BA8258F LOW QUALITY PROTEIN: trafficking protein particle complex subunit 9-like n=1 Tax=Limulus polyphemus TaxID=6850 RepID=UPI000BA8  ali  13  11....EDHRTLLILVKYKGHMSSKNFNKVYDRISRLQYVKVPDS-------------QAAGGQRVVWVRYKKHYSMESNEWGDFQTHRKVLGVLCLGKCGNQSD--------------------------LEELCKYHNLLREKYDTVLDSRCLVFGIPSGSLSPSSNHSASSEFSQDDQSPPTSVHLKPDQDGQLLSCMEESPEKLFGTGLEPIPKIGENADDKDSGVPCSLANSDSARISNKDPLSILSETHHSSEDEENTDHQMGSSTFTVDSCQRDISPSSEVSTPSSGESPFGGFSASVDFTSMSSSLGSRKLIVPPT-----LKSKGTHCILYNSIDDC---------------DHL-----EEDLTEFISSLFYVVESKRLDR----SFEKQDKLTLLMAPFERKDYVGLDTDGRNYKRRCLGRMKKQIGDLALEALTMYISAVEQLKSVNDWLWLAATYEGQCSASAVLLYP---NLTCALPPLQRNSSFPVGIPNTGVKSRSASNTRSLPNGLDPTYKTLGKSILTPEEIIEKFKEAIFQYSK---FRGAAFIEAECSIKAVRVLI--------------LQEVSIELYKQKQCVVFXNTLNNTRKQKVLRFSALSQLYNEIGFHRKAAFFKRVAAMRCVATQNPNSNWQQCYQLLMDPKEFLQDALQGWPVIQVHILQELVGTARSMGNQALAVRHMTFLLHTMLDHLPLSDRREFCAQLESLTSKCEGA-----PVPLALDNGYIIPPVNLLNLPKVKSFKLQNMAPHLRPVKKKSIRFKSVSKPSSPFIFSPILSNTRAQKNDSKVDFKWIEGNVCEVALQVFNPLPFELKVTHMGLLADGIAFESFPACLSLPAESGPYPVNLLGTPRGTGELQILGYTTHVLGVKSNC-------------------RLRDLPAIKKPFYSIEVLPALPQLELVTSLPKASTFS--------SLTDTSHVVVTAAVTMFAGESQESTITLTNSGCEPVEKVDIGLHSKLDKATQET----------------------FFTWSKENL-DTQLPILPGNSASFTLYIRALGDF-VLSPKEPLSDKSETGSPAHGSSKGLSSRTSSNSSLLDTPQRRKISSI------ASPEPYPPKTVEVVLQLQYSGGPGGKTDYCRQCAIAITVEVIPSVVITKWDLPAEVSSHCYLVFDVLNATCHEMELQYTSSK-----------------------QMLIEANDTCRIPIPVERCPISAASFQV--------------DEEKAGGDGRAAELEIVCKQHLANLVDLQWHLPALEVSGRASIADVMWTPVMLDNILVSPLHWDISLNDRPFKVEE-----------------ELSFLVGELVLLSITVHNLSDVCLQLYLSVCCYQDHQNGQCSYRMENLRAVVGTDKILIDKIEPQETYRHQC.. 1269
7 0.000e+00UniRef50_R8BBH5 Putative hypercellular protein a protein n=1 Tax=Togninia minima (strain UCR-PA7) TaxID=1286976 RepID=R8BBH5_TOGMI  ali  41  1.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................MLFRAFPASSSELLTTVDRIVILSGIASVLSVLGFQRKKAMVVRELISVLIGGFVEARTRGAAEVGIHPAAGLVALNGANGQVNALDLAESDVEYGVDAFLDLILKTYGVVNFDVGS----------HVLNDAKMLPDDSDAGCIARIQRQSVARLFGMQQIKINILRACINFSEALPDFAGVLKFSSDLLRTAGSGVAPGPRREDASPQLAVDEQVRLVTNISKTFSLTKRLGLGHLEAEYWDEFLLRGVKLEPLARTRTPVEHLKSELPGASAVRTSQDVNPFIHNPFQKQPDKEAANNLVAGEAAIFKLTLQNPFDIEVDIESVRLDTEGIQFESSVES-AIIGAYRTQTLRIGGTPKESGSLHVTGAIVRVRGCRERRFPIFPQPWAPDTEVKVKAIGLSSLDLHMSLPP--------------PSAPKTEHVGLNVISQQPVVVVKSTTLPQSSVMVLEGERQAFSVTLQNLSTTPADFLLFSFQDSTQEALQGRLNNREATPAELYEYELILAKKQALRLRKNAKT--KRYIAPGDTATFDFEILGKPGLTAGTIQVDYAHLGVPPEEVKDKFYTRQVSLQLTVTVNASVEVSRMDILPLHGSIPQPLWNRTN................................................................................................................................................................................................................................................................................................................. 597
8 0.000e+00UniRef50_A0A0M9VPR3 Uncharacterized protein n=1 Tax=Malassezia pachydermatis TaxID=77020 RepID=A0A0M9VPR3_9BASI  ali  19  15..SFCTPAKLKILLVPAAPLDDAEFERWASFVRQYEQVKLTEVP---RASKAPPSASLYHQGEVHISFVTSYQP-SHAYLAPFQLHRDVHGVLGLGTYPPHAGHDW---------------------------ERLPGLLRAQHPSALLHRVFAFDVHAKGAAAPPT--------------STAHGDMAD-AASILSQDDTEFE-------PSSSGFAGRRENGLVVFPAVRRDAKDVRFYLRTLLAEMIGGMLDQLDALVSQLDETMLETPRETLHQPPTLRTLSGQREAPPLPPRPAPASATSKMFGLK-RSKTPATPPPTSMRLEKIKADAALLSGYLYDAMEGYDRILSVLAGGQDAVWFASALEGWAVTRTLLARLGGEAAELAPGLLYPCTAGKDKELREPTPAPEAYTLALSIYAKCLAPPQVQVELLRSMTNE----------TPRDYTPPLVHATACLQYARFLLALYASGGWNAEAFDQLLYGGLPPSLFAEQAHLAAVSGIYRYEVGAACSAALTSSLHLLQPV-DQLAILSGVGRMLSVLGFPRRAAHVARVLGTAVSGLLSRTLQARQAPITSPPHAERMESDLFARANPALTLGMTACEAYGLDVL--TTPLMHVPSSHMLERARRRVCAYAYTDMLASTMGVEQAQAWLSDKVAQRPRPSFGWASLQRQLLQDLIVQCEAVDDALGQVFFAALLLRECT---------------LPAPEQVAVLQGLQQALPRARWHGAPDVALRYWGPPAMEMAPPPAPMVPVLRSRTSLRLAESNVETTASADAPPGLHNPFRSAWTSSKEVHYMADEDLYVDVSLQNTYAVPLVCSSLALLAQG-PSDAQPTSAHSIPSQSLHTVRLALTPREVGAWRILGCRVHLWGSEPCDIYVDTPLPLEKYEGPT-MHGLAARSTVSLMRMITTAKPADMAALERMLTPSYPTLSFRVLPAQPRVEMHLPTLGPTALMLLHGQTTTLPVQLTNTSSVPVDVVHIELEDSVQGPLRDAIAQGGLRPGDVHELERQLLQTPVLSLSAPQAQN----IAPHTSITVPLTVHARYDCDWARVRVWYGHMASVGADEA-MVPVRSAQLTIPQSVEPSIDVAPMQVEPLTPAVAQRMAATLTDE----------------------------------------PLPPTPPCVLLSWDLYNASPSLLHVHVDME---------------AWPGSPWHMERHILPGMTARLCMPWAQCTQDKLQKPIPKLSPG---QFVVPKMVLTETQYAEHTAQFWARDLLLQNIRLRWVDPEAHTEGDVSLHPQWPTAAQVSQLCRPAMEIHMDVPAQA................................................................................................ 1265
9 0.000e+00UniRef50_A0A1G4MG17 LAFE_0F15522g1_1 n=1 Tax=Lachancea fermentati TaxID=4955 RepID=A0A1G4MG17_LACFM  ali  22  5.YSLVGPAKIRTLVVPIGKWTRKSFLEKVKLFQERFDIRLVDITPF---DDATFNPQGFPQGRLMFDFRTSHVEEEHLFLHDFEPYRKTFVIIGLV--------------------------------NQKLDGNVLETLRQTYPDAISHNLIYIDADSTPSKYTFNYS-----------SASIETIICDIGRNFLEALSHYYSSYKHV-TLRSPGAIGGNSVLKTTLTRQPAS-----------------------------------------------VTTTTATRKISGLDPTVSSGVVRSPSLKSLGRTTIPPEQQRSKARQIKILGNFQLLAGRYMDALQSFAEAASILHKHHDYIWLGNALEGLSISIVLLAYLQVPFQIPAIAYSASPSKRDSISTTPMQSPRNSMSSIASKVRILDVQDVIISNVVKSISERILYYYELSLTHNSEYTPQLVYCEHILRMLQFMISCYKGQSF-DQQVLRNIVLNTPFEEIKSPNNFVETESFSKLEIYRFANKLFELQLKE-MDIVSQIKVYTALASVYDSLGFQRKRCFILRILFVSLMPHL------------------------------DNVDINAKWKENYGEMIHALLEVYGI---------------------------------RRTPENSVQDASNCSWVTLQKSVLMLCVTMASKDRDKERTAEFSLLLLKRYSHVLTQTEEHRLLNDYI-------------------LPSISSLPDLQYWDPFLVRNLEILQLDVNRE-MPRKKQIAPININGFNENSSDSAVFNPFRQNSVNHRNVTFLLGETAELIVTLQNPFKFNIEI----------------TELSFVPEDELYVKFLKDLSFNELPLLIPGNSMRSIHLPVAFINETAEEGQSIDKLRIGVFGLPPQLMRIVVSENLLHSREESNNDDGNERCNYGCFRYQVIPEGPELEFVSSTLNDNACMLLDGTKKMFSFIVRNKSDQSANYLVFSHLTSVEKSLKPDYW-KKMPQDDLYEIETQLKWLQHSCVRFLNAPHA---IEANSTAEINVELRVPFQFSGFDILIEY---GMQNSTNSNVIYTKVLHVPIEITLKRSVEIPNMNVIPLTESFNE--------------------------------VENVMDCVPYLMNKVKKNGEQISDYALMLLDMRNSWLHDVSLNVQYDDFIGNSIS-------------------IESMHTVRVVIPIRRFSATLNLKAKEIPHLVTGRQFVSS--GLTEEQTSDMREKFWCRERILEGISCEWKLQDTGTTGTVDFRQFKIDTRLLDILSPHRGS---SYAVDLSSHKNMIEVGEILQIKATVKFNTLHAKNDETVSLSFLLFNR-----------------RTGKTIPKASNAVLYNGKLTRQIRPMH-NSEVTLDL.. 1198
10 0.000e+00UniRef50_A8NF28 Uncharacterized protein n=1 Tax=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) TaxID=240176 RepID=A8NF28_CO  ali  24  2..........................................................................................................................................................................................................................................................................................................................................................SYTKSVQILQSSSDPVWQASALEGLATIVVIDSWSTGQG-----------------------------------LQQSTAAARELWVPVADKLTQATALYHKPVSFENESLLTYLFCSCVLRHTSLLYAIWSAKGWGPLAFTAMLHPGPKPYLPPTLTHDRNNSGVSRASIASVLAQAHGPWLM-HLGPRERIAILEAMASMYSSIGYKRKEAFILREVLGCLLDLIVCGRQPTALPSGLGIHNMTPAPTSNFATVGIRLSESPRGNESILAVLKQACRVMGLDLDAVQLLD-PDESRPPVTDAILFKQYDEEETAIFQEP--------CGWAELQVGIVREAVAVAEALPD----------------------------------------------ALKVALRRGD-RRSVEYWSGRPVIDIALTPLPSIRVPIEKSKGVLQSQGSAVPQGGTDPFLYNPRRAQAGK-GPALVVQHEPLEFFVTLQNPYVFEIELEELSLSTSGVAFTTQPIRY-IIPPQSTCEIVLSGTPEETGTLVVRGCIVRAPGGVSKEYILPLHTDQEEDRLMKKRQSLACKEQRRQSRQITDRSSSSSGSSSTTAISTFKFLECKVVPEQPLLRIRRTTITHGALMLYDGERSSIRLTIENISTHPVDFLRLAFDDSTVAPAQQLLQEGNLSVFETYETEHSLINSPVFSWDSSEA----KTIAPNQNLTLNVDCFGKVGCVQGTIHLSYSYIEREESKSSDVFYVRQLSYPLSVTVYHMLECHEMDVLPFPSYVDNEDFQKRLKAGKKKE-------------------------------------------------VRNAYGLPFDVTFSRMEDGKAVASTTT---------------TIPPGSMSRIVLPIKKMILPESVTSQPIPTL-SDRQFVVTKSGLTDVEQKLQRELFWYREELFKCVRGQWQETGGIRKGELSLRSQRMTLHMLETLRLEAARVQLSLVSATGDEP------------ITKSGGKYEPTANEFISLCVKVQNISDSPTVYVMDLEIV-----------PSESIIHEGILNIPVDRLDVGETREFTIGV 952
11 0.000e+00UniRef50_A8PT61 Uncharacterized protein n=1 Tax=Malassezia globosa (strain ATCC MYA-4612 / CBS 7966) TaxID=425265 RepID=A8PT61_MALGO  ali  18  15..SFCAPAKLKILLVPAAPLEQAEFERWSSYVRVWEHVKLTDVPRTSRP---VPSKPLYEQGEVHLSFVTS-NDPAHVYLAPFQLHHNVQGVLGLTTYP---------------------------AKSASDLERVPGLLRSQYPHALLHRVLAFDHARGQTSKPERDGDMADVSAARSGHSEAETEDDDVGDMGAGADSGAGVGAAATAAGEAEFVPTAGSRGQRESPAVRRDAKDVRFYVRTYIAEFVGTLLDHLDTLVAQLDESSLETPRETLTGAPMFKLVTERRLAPPLERRMSAASAASKMFGLK-RSKSPAQPPPASLRLVKVKADVAMLNGYLWDALELYDSILTLLAGGHDAVWFAGALEGWAVTRLLVARLGADAAELAPCLLYPLT------------------PGKDKEVHEPTPPALAWRDIAEAYSLAMAIYSKTNETSRDYTPPYVYACACLNYARFLLALFASGGWNSEAFDQLVYGGVPPTLFAEQAHLAAVSGIYRHEVAAA-ANAALTPSLPLLLPSDQLRVLSSLHRILSLLGYTRQVAHVSRTLGTVVCSMLVRTMRVRASQXXXXXXXXXXXXXXELSWDSRIDSGVFACANPALVLGLVACDAYGIDLLTSPLLHRRRVCSHAYMDILASALGEKEAKAWLCAATAWRSRTCFGWHALQVQLLKDLIVQCEALDDHLSQVFFAALLLRDF---------------ELDEADQVGGGEGLKHALPRAQWHGAPGLTLRYWGPSLLRAIQLEPMPASLMPVTRARRDFEPRPQTDASDDGPPGLNNPFRQAASASKESQFVMNEVLTVHVTLVNPWAIPLPLYDVYVRTEGVPVKASPSSHVLVPPRAVHTLRLPLVPLDTGTLQILGLHVRLWGAEPCDLFVPPSIAAIKDNLPRQVGLAARPAAVLVQHVVHTRPANEAELVKTLEPHRAEPLTCRILPQLPRIRASFPELGPSALVLQHGQETRVRVRLCNTSAVPVNFVRFEFEDSWQPSARDAILQRGLLPADVHELEWQLLHAPVISIDNDEHPESSLAIPPHASKDARFLIRARCDCQWARIRVWYGNTDGNMPSKA-TLRLRSVTLTLPLSVEPSIDLSSLDVQPIERDVAERLAALMLRRSDSNERQPSSAPEAYGM---------------------------TSSCALVAMDLYNHSAWPLSVCLDVQ---------------AAEHVSLRTHHTLTPGTTSRITFPFSQRHLEALSAPIPQLSP---RQFVVSQTPHSETQVVQNKAQFWVREALLRSLDATWTNMETGVQGQVSLRALWPMPVHVPLLVEPSVNVDVTVEECAPADSTLQ......................................................................................... 1361
12 0.000e+00UniRef50_UPI000D77EEF7 hypothetical protein n=1 Tax=Ceraceosorus guamensis TaxID=1522189 RepID=UPI000D77EEF7  ali  17  71..SFCSPAMINILLVPAHPVPKEEFERWSKAVKYFENVRLSDLPPSKNGARRVGSNTPLGKGEVHISFITWYDS-SHDFLSPFSVHRQVLGVLGLGTSTSDGRHRHALERAPTRLKRDHPYALSHRVWAFDIGAVRPQTMDLSSLMAAVNDSRSKRASSGGFTGRDVQDLVVFPADLKDVKFYLRTLLPEFIAQVVDNLQLAVDALQGTPLETPREPTGDMGTVSSPLSIPLPHQHAPTSPGPLTSPTSATSRXXXXXXXXXXXXKSTGTVDSSAASQSSSPGSSSVAGGALATAALXXXXXXXXXXXXISNKVRKSIKRQSGLGRFSKVKADAALLCGDLWSALSGYDTALRALAGGADAVWYAGALEGWAVARVLVRRMGGSVEEKAPASSLPGGSSTSTVKEKDKKGSEKERDGTNEKPFAGTP----WADIAEAYALAIQIYSKTADSPRDYTHPLIHASACLAYSRFLLAIWASGGYNGEAFDQMIYGGIPPPTTATYIQHSTACNIQRYEIAAPASQALTHSFAALK-PADQIFILSSSASVFGCIGFARRETYLLRQMQVVLLGMFARTITDRAAQQDRSFADRPFVSSYSDDVVRTLEIARKVCDEAYLALAQGVLDVHGISTDVPTTKHISREHFLRHAAGVRASWGAQASLEGLGSSRAESIEAPFGWAEQQMALLRDTIGICEMLGDETSAVFFASLLLRDFHWLLAPSEQAHLIAA-IHKATQDARLERGSRTLKVKYW-GPPEPVVDIEAIPIDPERKTFTRPAHEIRNGSGENAPDLLQLNAPAGLDNPFFWNHGSSGMSGNPANTAVCDEPCGFVVTLQNTFSVGLEIDCIKLETSGADFVPDELRGIVMPPLSTHQILLTGTPTKVGTTRARGCSIALSGCAPRSFRIAQSNELDDRRLKIKATGLDARPLVLAQARMAAALQRNETNKKIVSTPSSKIVSCQVVDPQPLLVLQSASTPHGSLVLLDGEITTIRLQVLNAGTLPVDWIRLSFMDNLSEKMKKELNEGELNSSQAFLAEDKLLRSPVLSYSLSPRH-AKHQVSPGETRELQVDVRARVGCTHLSIFADYAYVDGPQTDEARDWYHRRLSVPLAITVLPVVELGKLEVKTLRPYEAVRTLA-------------------DGLKALERAGGGLPDGLADAKLFERLLQGRPDKECLVSFPIVNAHRNNVEVVVSLKDE--------------AYHSKLRVRRSLPQNARAQIVFPFPRISTEELDRPIPSLSS---RQFVVPKSKSSPSEQAVARARFWLAQDIVAKLSGRWIDRSTGRKGYIDLSSLMVADDHLQCLRQDPLSLSLHISAFAGGDAVQENVRSASKVRTELSERTLRTTAETYIDIVGTMRNESARKLRLTYRLIP.......................................... 1699
13 0.000e+00UniRef50_UPI000D77A7FC hypothetical protein n=1 Tax=Jaminaea rosea TaxID=1569628 RepID=UPI000D77A7FC  ali  18  18..AFISPAKIRVLLTPSGPVSPADFERWAAVVRSFESIRLADLPVSTNGRPGPAVGSALHRGEVHLSFVTSYDP-SHSFLAPFAMHRQVLGVLALGSLEEGKGKDHRAFLFDTKAGKEGDKGHSRQSSVKDPIESARNSSADHERTASGSGSGEGSGDSAGFADTANSGLVIFPAVRKDVRFYLRTLLRDFLGTLLDGLWDVVAALEGK-SLETPRETLDGSLVTSSSSSAGTSSASSTSSQSTSLATSPXXXXXXXXXXXXXFFSSFGSSSTSSSSPVGGGTLPDSHGSANGNSKSAVSQSSAARSSKVKRSSSLVGAGPTGAGRYAKVRADYALLSGDLWGALGGYDTCMSWLAGGQDAVWYASALEGWAVACLVFRMSGLEEKGPNLSLPTGGAKERDKSAKAAVPESPFAKLE--------------WADVAEAYSLALDIYSKTLATPRDYTHPLIHASACIAYSRLLLAVWASSGWNAECFDQLIYGGVPPSLPAMYAALSKASVVQRHEIAAPASLALSHSVSALKPP-DQIAILCSLANVFGCIGFLRREAYLLRQLQAAVVSLLREPRTLSMALSQIVGSEHRALGGAGTMISQTLTSGLGEGADAVLILALQICETYGVNVDVEPLKGVPPNHILSTTARGEPLLPRRAKDTATASARQYASEADFGWLDLQVALLKDTICVAEMLQDHVGMAFFAAILLRDYH-------------EVLSGDEQRSLMRGLARCVTTARWGDARDLEVLYWGPPEPLYIPVERPGKELREADEAEKAGTSASTSTIAGLNNPFFWNPTSRKNKSKDSLLLMQGEEAVFHITLQNPFKTTLELTNVKLSTRGAPFEAHALPQVLLPAQSYTTVRLTGVCSVQGPLTVQGCFLTLSGCTEREFRVHTYDEADDRRSRLKVSGLDARPQRRALEGHAERTGSTKKAGATPQLPQGGFLTCRVVPSQPLLQVDASSLTHGRLTVLEGQTIRLRLRLTNLSDLPVDYLRFTLQDDATTSILAALREGDVLPSDAYHLERQLSERPVLSL-PQGFKPRGITIPPGRSVVVSLQLRGTLDCTRGSVSVDYAYVNAPVTEERRDFWTRSARLDFGVDVRPVLECGGWRVERMDRRNAESVLRGVKDGEEQGE------------------------VNRYMVDEKKGSDEENDLISLVSLDVRNVHHREVRVSLDVTEDVEEASLATTSSGSADSPRKLTISHLIPSDRTVPIFFTLPQLPLSASNKEIPSSSLASQRQFVLSRFKLDPAEVEGSRLRFWIGEELRRRLAGRWSEVDD------YSGRRRIASSSSGSIAKQQGDWSNALAEACQDLDEGREVELSLDVLDPTGSALQLVEPEQFVSLRLRVRNATARSLRLTYRLVP.......................................... 1524
14 0.000e+00UniRef50_UPI000D778B42 hypothetical protein n=1 Tax=Meira miltonrushii TaxID=1280837 RepID=UPI000D778B42  ali  19  46..AFCSPAMIRILLTPAADVTPDEFERMTSAIRRIESIRISDLPPSQRKERIPSSSPLARSGEVHISFVTSYDP-SHSFLSPFNVHKQVLGVLGVSTCSSSN--------------------------AVEELERAPAALRQLHPTAVVHRVFGFDKSNSSTSGLNAEREITDGGDMGAESLTKTSLDSSMTRRTGQAKSSMTDSEKDSTSSGFAGRSNTGLVIFPAVRRDLKDVRFYLKTLIPQFVADLLDGLDDFVSDPLETPRETLEGPSANATGASTSTALTAANKGIGAAATSAASRASALFSSFSAAEDPSSSSPTGAGRYAKVKADYYLLIGDLWSAAKEYDNCMSLMAGGQDAVWYASALEGWAVTRVLTTRMGGQVAEKAPCTTMPLGGVKEKEKEKVVSDFQFAGKD--------------WSDIAEAYSLALTIYSKCLATPRDYTHPLIHTSACLAYARLLLAIWASGGWNGETFDQLLLGGVPPALAETTRQHTTSSGISRGDIAAPASLSLTNSSTNALKMLDQIHLYSSLAAIYGCLGFARKEAYAIQRLQSLVVVLIAQGVHMQKQQGSSTSEALRAGNAAYGTMSTQISIGGGLGSDSILVLALQICQTYGINLSSPMLNRNRAAWSMSSSSPANGSELNDEAQARQAAISELLEEPHFGWIEQQIAILKDTISICEMLQDKQSLLFFGAILLRDFWPYLGFEEQFRLKDGFAKLMGETISGDVGNTSS-------NKNLQLQYWGPKDLLAGMQLESGTTNQPQKVLFKNLPRAGEKPSVPEWAK---GKETKNAQSTTENGLMQDEVASFIVTLHNPLQIPLELESITLGSLGPTFEPNVRKNIILPPNSFHVVRLSGIASGEGRLCVKGIYLKLPFCAERLFTFEAQSEVDDKWTRTKRIGLDARGSGSTGIGLQTNLQPKSRSRT-----QESLWILPVIAKIPMVEIRSAALKSGSVVLCDGEEKAITLTLQNKSEMAVDHIQFVFDDDVQRDTVELLAEGQLEAVDVYELEQDLIERPFLSLLGQNATGSNLKLEVNEAKTFTFRIRGKLDVRRASIRVQFGNKANSKELGREYFWTRQAQFSFDVRVLPTV---FLDGLEVMRARNIDLPHLKSMLENG----------------------------------NDLDKYTDTSEVTIVSLAAHNTNAGSEIEICMNIDDSVGSQKIARRLPAHSSIRIHF----------FLPNALPKNIKEELLQPIPKLV---ERQFIVSQVKRTESQERTLRALFWARQKILSKLSNSWKDNKTRKAGSIGLSGLRLNPQSVVSLYADPIDVK----------TTASKGVQVKPTSEQSAGLLLELQAHDFVELYFEVKNTSDATVRLQYRLAANIDD------KQLSQHILCIGHMNGYISQLLPNETRQVTIGV 1519
15 0.000e+00UniRef50_H8X4H4 Trs120 protein n=2 Tax=Candida TaxID=1535326 RepID=H8X4H4_CANO9  ali  20  5.YKFIIPATVRILLVPINNCSLRDYNRYINLISSVTDLRLLDL--KANAGLHFFNPATFPEGRIIPEFTTTDDD--SIYLHEFEPFRKTFIVLGIGRYCTDSD--------------------------------HLAQLRKIYSGAIVHSTIQFDTPESELSKSTANS--YFHNGATTHFSAMEGIFSEIFDSFLIALDEYASAY-----------------SNISLRSPVSITDSHVL-----------------------------------TKTINQAQKRLSSGSTSFKASFNGLPTDTPNTPKTS--TDKSKTHSKYGGRYHKLMGNLYLLTGKYNDALQSFTESVTSLRRFDDFLWLGSALEGLALSIFLLSFVQANFQLNSKRLSSESNGSKTNVISPRPSLTASNAFSIPLTSSVDLNTLSVPDILKVLLAKAIYFYGQSTDDPENMVPDVVYIECILRKLSLMIGYHLS------APMEEIVQG------RVKSNIIDNTYFSTQDILADVDKIFLLQLIDLN-IMDQCYIYSYIAQVYHKLKFFRKQAFILR----------------------------------FHLIALVSQSKTSHDSRSIKELLDELFDLYGIGSEPD-------------ISCLQSSPPRKSVQ-----------------LSLQLQVLKLALNSAEHINDTELALNICCLSLARYSQCIPADGQIKLRNMIDKITSQSKLT-------------------VPYFDPFMVRKIKFVSTRQKDHLIPFVDSEVDSP--------KQSFFDPYHLKNDAVNLDRILINDEVHQLKITMYNPFAFEIEINDLEVISEGTDVETLKTSIGTISPTSSSTIVVSFKALSVGEMKITGLMISISGFEKQYFPIVDKLSNHNSKTLEAIGEREEKTNSSVYDTLYKYLKGELK----DPRVSYRSLPLSVIRPQPVLKLVDLTIPNGCIMLLEGEQVKFEVKLINDSTEVINYLSFSFWDSAIDFLDRKLSQPHLNAFETYELEWNLLEFKSFRILNKNIIGE--TITPGEEVTIQYLLTSRKLMRQSKIILDYANRSGDQS------FIKHLDVPIAVSVVPSLEIVGCDIISSFSTATLENTD--------------------------------FPVVVSSVTTYLKGVDDVSQYCLLVLDLRNSWTSALHCQLEYDN--------------------FKLSGLIESNKTARYFIPLRKVR-KVPQNPIPSL---RKKQFIKDY-DLTVEDEAQMIKMFWLKQIILEKLTGSWTV--DNRHGLLDVRSLRLTPKMANILVINEVEVVTEI---------------ALNGQEFKCGHLHDLQTDQFYTLRTTITNHTGHEISGFIRQLPTSPSNNLAKSLSIDKKILINGVLQQKFPTIKPSGSLSIDTS. 1227
16 0.000e+00UniRef50_UPI000D7FCD97 hypothetical protein n=1 Tax=Acaromyces ingoldii TaxID=215250 RepID=UPI000D7FCD97  ali  18  21..SFASPAMVRILLAPAGPVTPAEFDKWSAAVRNWESVKLTELPKSQTGRPGPATGSAARTGEVHLSFITSYDP-SHSFLAPFSMHRQVLGVLGLGTSHSQTD-REALERAPTALRQLHPSAVVHRVFAFDTGAARPQTISSSRPXXXXXXXXXXXXXXAGFGDSGKSGLVVFPADMKDVRFYLKTLIPDFVSSLLDGVHQIVEGLEGTP-LETPRETLDGVVSSTAPSAPSASSSTSSALSAGXXXXXXXXXXXXXXXXPNETSTLSSAXXXXXXXXXXXXTGGDSPLRKSTLPSTSATNSSKRSKTGQSIVS----AGPRGQGRIAKVKADYHLLAGDLWSALTTYDACMAHLAGGQDSVWYASALEGWAVTRVLVRRMGGLVEEKAPSLTLPLGGTKEKTAKEREKERAAGLVDEFAFSKQS------WSDVAEACSLALQIYTKTNETPRDYTHPLIHTNACLSYSRLLLAIWASGGWNGETFDQLLYGGVPPALAETTRQHSTASSVQRSDIASPASLALTHSARALKAP-DQVHLLCSLASIFGCIGFARREAYLLRQLQTLVVSLLAKAIIQQRRQTAVASTSLRKTALAAAEVSQVAWEGAGEGTDSVLVLALQTCETYGVPLSNIPSDHSRSSWGASASLDSIMSPTASSLSRDTAEPTSLQDEAPFGWAEQQIGLLKETVCVAELLSDNIAMSFFATLLLRDFHW-------------FLSKDEQARIVRGLQLVTRTAKMQEARELEVSYWGPSPVCGLILEPMRDDQIPRKRPAGELGATAKGEESTIYNSSSLAQKAPAQKKGEGNVIVAEEKVGFLVTLQNPFEIALELTQISLDTFGADFEADVLHNVSVPPSSFHTIRLSGKAKETGTLVVRGVDLTLAGCAPKTFFIARQSEIEDRKTRLKSSGLDARPSIVAAKRHWQTHSSTKPDDKPAPPARDKFLECQVLPAQPRLTIQSVGVAVSSITVLEGQATELKVRVRNSADLPVDFLRFTLDDDLSANARDVLADGDLLAQDAHDVEEDLLQRPVLSYDVEPRSGA-HRILPGKSKVLTLKLRAKVDCTRLSIGVEYGFVEGEETEEARDFFVKSCKVEVGICVLPIVRLGELEILPLLQ----------------------------------------------------KEKEEDDNWCLVSFGVQNVHSHPVKVAFHVN--DNDDSDDSPSASTSTPPQRREVVQEVSPSSTIRLSIPIRRLGLTKTDLAQAIPNLSSHRQFIVSRIKFTNAQEREARRRFWILRALWKRLGFFWTDVRTGAKGDLGWDGL--------------AAFGEEDEDSRTRTTVLERLTREPMSVQLEVRSQGEVKVEQPTRLVVRVKDRSSTK................................................... 1488
17 0.000e+00UniRef50_A0A2V1AJ90 Uncharacterized protein n=1 Tax=[Candida] duobushaemulonis TaxID=1231522 RepID=A0A2V1AJ90_9ASCO  ali  20  5.LNFAAPARTRVLVVPLNRGNPD-FHQYYDKIRSANDIRLLDVAPLPEARN--FNPQAFPQGRILYDFCASPPDEDVSFLHDFEPFRKTFIVLGVGSYEDFEE-------------------------------NAVEKLSEVQPTAIVHNCIYFNS----------------PADKIESEKHASSAPQDV-------FFVPSLEDQNITTLET--------------------------TMCYVTEQYLKALASYVSSYEKITLRSPVS-----LRDGTALHKTITYAQKKVTSGSSFKVSFSKNQTLSSTPDSKVKASQRQTGRQAKLMGNFLLLAGQANDALQYFTDAAINLKKSDDNLWLGSALEGLAVSSLMLSYLGIPHQASNPMLASVSSPRNSTSKXXXXXXXXXXXXLTSTSGQVELSGSSITEFLRILCNKTAMFYSLSDSDFENGVPDLVYIEFLLRSIKLFINIYQAGAGSESQVLEATVKASPLDSVSHRDP------VLRSEILALIDQIFSMQLIDLEFFK-QCRVYYTLAIIYSDLGLRRKRAFILRILLVALLPKLNHNAHFITAERLTEIFEFLFEMYSIGRQTEAKEIEAAEHYSDWITLQLSLLKICRITESLKDYEMLAKICVLILSRYTHCLPNEDQIKLKRKMD----------WLALLSKESHNSISIA----------------------HPDPFMVRNAKFVLQSQADELVPFQTPPSTTPTSGNDPLIFNPFSKVPKDLPSKDKLVCVNDIHQVVILLQNPFAFDLNVSDICIVA---DDPSAVETIRPSMRVVGVSGFNKQDLSKLNGMQF-----HPSKLYDSEQRASETTNNVVVPPSSLCHVVVAFKITQPGVFKISEFDVTFGTSEPQRFSIIDSEKSNAN------LRLSAINPTKEDSSNVLDKCDNLQHKNVAGRATSKSLTLTVIPSQASLSLVANSISNGWLMLLEGEKKEFSIKLKNTSNIAINYLSFSFWDSTNDSINSRLNHNQLSAEEVHELEWQLLENKPFTVNKQEISSKYKIIQPSSIVEFQYQINGKRGMAESRLILEYCNR---SSDEKRKNYIKTISVPLNITVQPSLEIIGCDVIPFFSTSLQGFQLGNHPEKESFIEKNISDLLKFISKA------------------KESDDDDISQYCLLVLDVRNLWKEKLALMIT---------------NKVQSDMAFVVNEKIESTKTSRLLLPIRRICLEDVSRPIPSL---RKKQYVKNYS-ITAEEDEQNRKNFWIRSFLLECLEGSWHTVTSSRSGTIDLRNIRLDSRMANALVYDNISIQHSIWSVEGTPG-----------VIDKKENEYSLEKERFYTLKTKIVNHTKTALSGVLRHVPFPTSESNRPDISIDQRILFNGVLQKTVGQIAPSGHVELELG. 1299
18 0.000e+00UniRef50_G8YQM4 Piso0_000995 protein n=1 Tax=Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695) TaxID=559  ali  20  5.YSYIAPSRVKTLVVPINNCSESEFNRFIKLMRSAQEVRLLDV--RADSNLHYFNPQTFPNGRVFYDFTPYAPESESIFLHDFEPSRKAFIVLGLGPYREGCEDESSRR-------------------------EATNRLKKSHPSSIVHNLIYFDTPSEK------------------------------------------------VSELSPAHDHNTKSSFFHDGSMTHNITALETIMCEITSNFLSSLDSYASSYQNITLRSPVSISDRRNLSNTMTKTKKRISSSSLKLSLSGISNPSGLNGGSDAKSAS---QYRHTGRSSKILGNFFLLAGKQTDALYYFTDAVANLKKCDDYLWLASALEGIGCCVLLLHYSGINFQLSNALLSSSSNRNSFHSPRNSTSSNPNTHIGGYISSGTDVNSLPVPELIKLLSSKALNYYLMSTSDFENTVPDIVFVESLLRYAKFMVTIYSTSNSLNTFSLDQIVKSIPIPKTEMENHTKQEENFSKNEIMHELNKVYHVQLV-DMSLLNQCKIYCALASMYSDLGLYRKKGFVLRILLVSLLPKFEQRLNNNDSRQVFDYLSDVYGLNEQPELSNAMFHAQGGWTLLQLSLAKLFLRITEAMGDYFYLRKLCTLLLTRYLHCLPNEDQMRLKEKIELLPENESLAMPYCDPFLVRNVKLVTSKQSEELPFTEHDKSGNTESLVGMKNPDVPSNATSSTGVIFDPFDKNRVVNREKLIIKDDVYQLKISLQNPYVFDVDILSLNIVTDGGVEVETLTQLVKVVSTNSISGPGSNGITLNKNLNGLNGSKSKSQLNGGGKRIVSSQT----AVDLPSSGNSFQISSYT----PSNSLTLAGKSIVQMVIPFKPLNTGELNIVGFDISIPSCTPQYFKIVTA-ENSSQFQKIKCIGL---PRNFEEGNHFDTFTKNLKEGNIDDRVSTKFLSLSVIPPQPSLVLTKLSITNGWIMLLDGEKYQFSATFNNYSEETINYLSFSFWNSLLDALNKRLTLTESSSSEIYEIEWLFMKSKLFRINKGEISEANKIIKPNEEIQIDFEMTARKGMNESSIILEYSNKFSQDL---SKSFVKSITVPLSITVIPSIDIIGFDVMPFSKSFVEVFDESKEGTQLDDLKKHT----------------NIANALLYLQQNFESLNQNTHKYCLLVIDLRNQWTNKLVTRVAYQFDE---------------GHRFESENTLEPNSSIRLFIPTKRIDSQELRKPIPSL---RNKQYIKNYS-ITEEEEMKLREIFWTRLHILDRLSGSWEATSSMREGSIDLRGIRLNTKLTETLCYPKIDIVHEVFSEE-----------SPDVPLSKSGTSFVLHTEEFYRLKTVITNHSNEPVTGILRNLPYPSNVNLFKNLSIDKKIFIDGLLQYYISEITPGSSYEYEIG. 1404
19 0.000e+00UniRef50_A0A1E3HEY2 Uncharacterized protein n=5 Tax=Cryptococcaceae TaxID=1884633 RepID=A0A1E3HEY2_9TREE  ali  18  6PLSPFSLARLQILVIPVHPISTSLFDAYLSIIQKHQTLRGDELAGDSNPRMRFFPQLSGGSHQVHLGYTRSPPAKHTYPLSLLRMAGFPLIVLGVSEGYSLGDGDIGHSTPTAPTFQERTIPSFPPVTPEQAFEDTLASLLPSSPFPIVKRLLVV--PDQIPKTPSSPRKQASPSPLEGVENWMTRLLGEVVGDLLGELGVIATALETPAGLKTLSSTDYPSRSSTSTPTLVPPKSSMDGAPGGLGISLTRAVTPGGRPTSIQAPSLPPIQTNLAPAAPQPVSASSNPFRRSSAVPSPFSRTSSAASSGSLPSSTSADLTGIAGGRLLKLLGDFYLLSGMYGDAIQCYDDGAERCRAVGDVLWEGFTREGRAVAGIGEAWEGRDGSNLTQPFPTSPIPVEIQSHFMSALACIARAPIPYPPTIASPSPQAVSGSFSIPSS---IPTDPSDVGTGEGLLSLLYAGLALKISHXXXXXXXXXXXXXXXXXXXXXHTLPRSFPPPLTQQPTITSTSRRKHARDLAETALGPYHKAMTMLERLAVNEEAVWLARWLGLERKEAGVTREVVNLLAGVVVENRQETNSRTLAPSPRTSMVSGAQESASLGLGLGMPVKSQAVAVRRKESTENAGIVALFERAAG--IMGINLLPSFPSSALPHRSILGIQDTDDEEHIKRRFGWPELQVEMIKEGIAVMESLPSHPAIVKLCLTALNDLSESL-------------NSQSQAILAKMYPAALAVVRRRGLETGVVPWWVPKIVMSLEIAGLSHDKTPMQHSRDE-----IQVESGKKDPFFYNPRTR-ASNGGKVTLIANEAVDVFVTLRNPFAFNLDINEISIITSGVPFNTSSIPISI-PALSVHTIRLSGIAPSAGLLRIQGVFVRLTDGSSTQVFLPVIDDKDKERRQKRHSRLKRESQKVKRTGMGARLSNRASLKEKEGEGQEKYLECTVVEELPLAWVKSTSLIHGMMMLYDGERSEIQIVLENSSSVPIDFVKLSMDDSTAREAQEIIAEGELTPEQAYELDWDQQKRPVFVWSDTQAPGE-VFIPARGRATLTVKCLGKVGCSDGLINIDYGYVDADSAPVSNSFYTRRISFPVMFTIYHAIDCHSLDLTYLGGSQISS------------------------------------QASKDASLYEVVSAENDSDHCLLGLSFSNVYGVPFEVTLARKGDKPEA----------------KCTRLIPPGAIERLILPLPRKLLEALSQPIPSL---SNRQYIVEKEKKTSGRVATERERFWYREALLGMLEATWIEPGSLRHGSLSLRHHSLSPSLLQILR---------------------SDTVDVRVRVRGRDTTDKLLAMDFVELEVEVVNGTGSPFHPYVHLEPLPSSPPPGQLSHPHKNVLFDGLSSSTLPKLENGANGTFVVG. 1488
20 0.000e+00UniRef50_A0A2N1JEG7 Uncharacterized protein n=1 Tax=Malassezia vespertilionis TaxID=2020962 RepID=A0A2N1JEG7_9BASI  ali  20  13..AFSAPAKLKILLVPALPLEHAEFEKWAAFVRNIECLRLRDVPRKKSSVYP--SSPLYQQGEVHISFVTSYDPA-HAYLAPMQLHTQVLGVLGLSTHT-------------------------HTDPYTNELVRVPGILRDEHPDALVHRVFAFDVDARHSTGERV-------PNEDDGDMATVGVEHDTSADFNPAFSGFGGRRDG-GLIVFPAVRSDAKDVRFYVRTLLAEMVGTILDQLDTLLHSLEGAALETPRETLRNAIAASAAHPIDPNAPPLPPRVPPNGAASKVFGVLAKRRAAPALL------PTVHSGPHGKMRHTKLRADAMLLGGDLWSALSLYDQAREALAGGQDAVWFASALEGWSVARMLVARLGSAVQDDAPGLAFTDPREQTLEQYAWKDISEAYSLALNVYTKCLAPPHVHLESLRSVTNETL----------RDYTPPFVHANACLAYARFLLALWSSGGWNGEAFDQMLFGGTPPALTHDHTQLSAVSGVYRHEIASAAVGALSPALRML-PPGDQIAILSGVAKILALLHFARRFAHVVRQLDAVVAAVLTRSPRMLSIEALLHALRLRVPTNDTALDAELTPAGIHASVNPSLVLGLLVCDTYGIPPHHMLSRARRRVCVEQYAALLAATLGDLPAARTLLPALAHSTETDFGWTALQTQLLKDLVVQSEALGDPVATAFFAALLLRDFCPAL-------------SAADQRMLFDGVRRILPRARADGAPQLSLRYHGPRLLRAMEVVSLPAARAPITRRKASFAPPLADSGDARPNPFFWNVL---KTSRGALDLVAMEPVLVDLTLENPLHIPLEIQRMVLCAEGVQLDT-PSVAITIPPRSLRIVRLQGTPACAGTLRVLGCVVTLWGSEPHALYLPTA-----RPPVVKATGLDARPSVQLVRNLAQKLQSLDTPQRADVAGPRLEAVCRVHDPMPQLHASLPSRVHTALSLLQGEQYTMPVRLANPSAYPINFVRLALSDSLQGPMRDAITQRGLLPGDVHELEWQLLYAPVLSVEAHDA----LEIAPHSARTVHLHVYGKAGCEWASMRIYYGNTSLEARDVQ----LRTVQLTIPLSVQPSVQSGPLHVTGMREKDAAQLAAQLMHR---------------------------------------DEPVPLGPSFLLSVDMHNVAQVPLSVTLDVDMAAGVHCALTRS---------------IAPNHTARFAVPMSKRNLAALRAPIPKLSPG---QFVVSRTKLNDATRAMCETQFWLRDAWLQALRASWLDERSKDRGDISLRTYWPTLEQIRVMSEPKVRATLALPDK--------------------------VAAESFVAVQVTIANHTEETLNMRLHLTPSLD-----GAQSMDKRVQYDGSWTTAVKPVAPGASTVV.... 1336
21 0.000e+00UniRef50_A0A1Z5T305 Uncharacterized protein n=1 Tax=Hortaea werneckii EXF-2000 TaxID=1157616 RepID=A0A1Z5T305_HORWE  ali  25  4.FSPVAPATIRVQVLPVGKIERSRFLDVLRSLQHHAAVKLADVPQIE--EQQLLSPKSLPESSMLLNYVTFPASQQEQHLAPYELYREPLLVLGIADGLDEDE-----------------------ERRKSELKEAAAFLRERHPRVVHRHIMMLQGPGDNTETVTAL-------PDGEGGTSYHTAMCQVAGRLLVELSTYTKAMQASPTIQTPGQPVKSLQRTSSHRGDDRGSASGYSTP----------------TQSAEVSSPTGEEVRNASNRASALARSDSNTSNRSKNGQRGSSQDRVSVHGFGPSTSQEKTRSRGKARVGIVTGHIYMIAGQWNEALRMLTEHTNAARKLSDSLWHAKGLDGILVCMLLLAWAGQGFSIPSVCFPSEQRSSFAHSAKLSV---TLPTDFRPTEVAYQAAVGKLSMSLPELLKHILSLYRLGEGALE--LPPLVQHEARLRFCDLLATLYCENGELNGNARNYIVERASPRRPATSDGASAGSPISRGSICSMLAEAQPT-EEDHLAATDHIQLLGGISGAYSALGMERKSGLMLRGMIDKLTTALIQARKLGAAEAGIHPAASLSV-----DAGADIVVGAAAESPGLQELMDKIGRIYGVSLLTTSVGD-------------------------QGEAPLSSVPFDFGNAHIKSIVLRALLAFCEASPDPHGVLRIASSLLRAAGAYASLDAGASMSDEIAAKDDQIRVATSLSRTVGVSRHLGLTDIQAEYWDPFLVRGVCFVEPHASRNLLPLG---SNKESTASQGIPGNPLLYDRNSKRTQAKGRLSIVRNEPLSCLVTLQNPLETPVEIEDLALVTDGVHLDLVNFTPVTMKPLCFQQIPCAVSPTHVGDFSITGCRIKVAGCREKTFGIFDQPWAPSGETLVKFQGQNVQSKYHPGP-----------------AAPTASVPMTAIEGMPLLEIEHTSQGEGHMMLFDGETQTINVVLRNKS----------------QDVAAAISSVNDSAG-VLRLRKEDPHVGEASSQQASTDPAVKVVQPGSILSLDFDVLGRVAVSSTNLNIIYGRPEANHGS-----HKRVASLPLNMTVDTALQARNPDIIDDDADGFDFS-FDVHNAMPKPLSFFVESIDGHQNPPIKLSSPPSQNIPKREILLSPGETQRVSHHFSRT-PYSPHSSEQDETTIQANLLNRIQVIWRTWKGEPRWGFDLSSHLTFSPQNLQILRGPQSRLHL............................................................................................................................................................................................ 1135
22 0.000e+00UniRef50_A0A1L0B7Z6 CIC11C00000005170 n=2 Tax=[Candida] intermedia TaxID=45354 RepID=A0A1L0B7Z6_9ASCO  ali  22  4.FSFVAPARAKVLVVPVAGLSGEKFDRYFQQIKSANDIRLLDVTPI--PECRYFNPQAFPQGRVFYDFATSFHDEESVFLHDFEPFRKTMIVLGVGEYDKSKEDAS------------------------------LSDLRSRLPTAIVHNCIFFNSSVEVADVATP-NVYYLTSPSHLSITAMETTICSVTRSYLKALDECAASYESM-SLRSPVSLVDSNVLTRTINLAQKRISSGSSFKVSFSNGQDVS---------------------------------------------------KSTDVKLKALQKQTGRHSKLMGNFFLLAGKCNDALQYFTDA-------AINAKKCDDYLWLASALEGLATSAFILAYLDLPFHVQNPMLASTKSSVSVVSPRNSTSSSLGFSAATLTGTMTDFSAMPLPEFLRVLCLKASQYYQLSATEIEDCVPDLVYVAAIIRHVKLMVTIYLGASTPLRSILESVIKSIPIILKGSKEG----SLVLKSDIIQEVDKVFSLQLVEL-DFNEQCHVYCSLASIYSDLKLYRKQAFILRILLVALLPKVARM----AKRDTVADLNSLASIT---------------------SIFLLLFQVYHIDSEPERKESMAKDHISD-------------------------------WSTLQILIIKICLRIAESLQDYKTLAKLCVLTSTRYSHCLLP-------------EDQIKLKEKLNWLNLLLANNESDD-SLPHSDPFMVRNIKFVVTPSASDLVPFADVE------QSNGSANGAVLFNPFNKKTGTNKERLICVNEVHQLKVTLQNPFPYDVDLDEITIRSLIKKVSSTPISQRVLERNSVSQVIVSFKALNPGKLTIKGLTLKAGNSRNQLFLI-LELEKACELQKIKTYGILAPIHDEATLDK---LIHNLSQASITERVITKELSLGVIARQPSLSVIKNLITNGWVMLLEGEKQHFSLELKNTSADPVNYLSFSFWDSTSDSINNKLSQGAYAAEDVYELEWQLIKNRPFQLNKQELATRHKVIKPNGDFRIDYEINGKRGMTDLKLILEYSNKKA---DTPGENYMKTVSVPLSVSIQPSLDIVGCDVIPFFSSSLHGYVAGSHEGGIIQRNMDS--------------------LLDFIATTKTSTEEDISSYALLVLDVKNSWKHKLCANI---------------SNSFATREKYVVNEVLDTSETCRFLLPVKRIGHDDTSKPIPSL---RNKQFIKNY-NISKEDEIQERKDFWIKSILLEGLSGKWNTVDTERSGVLDTRCIRLNRDMTNVLVYDSILIQHSI-----------FLDDGLNKEIQEENNEYRLEREQFYVLKTKIINHTHDSLTGTLRHVPFPVNAATKQELSIELKILYNGELQKHIGKIPRGQSLELSLG. 1292
23 0.000e+00UniRef50_B9WN28 Subunit of the transport protein particle (TRAPP) complex, putative n=5 Tax=Candida TaxID=1535326 RepID=B9WN28_CANDC  ali  21  5.YNFITPAKVRVLLVPINDCTSSNFQRYLHLIQTVGEVRLLDI--KENNKLHYFNPVTFPQGRIFPEFITSSIDNELIFLHDFEPFRKTFIVLGVGPYGEDPST-------------------------------ALSELKKKYNSAIVHNVILFDTPEDKLKQQ--ANEVFFHNGTTSHLTALETIFCGISGNFLEKLDAYASAYTNITL----------------------------------------------------RSPVSITDSHVLTKTINQAQKRLSSGSTSFKVSFXXXXXXXXXXXXXXXXXEKSKTHLKHLGRQRKLMGNLYLLAGKYHDAFQNFIESLTSLKKSDDFLWLASTLEGVAVSIVLMQFIGTTYQLPNQTMNPTSVDSNITSPRNSINSSNGFSFNALTSTMPDFNNLPVQELLKIITSRVVYYFSMSTNDIENMVPDIVYVESILRRIKLLIGLHFSSSMED--------------IVKGTVKPTSKVSFSKIEIIDEMDRIFQLQITDLN-IVDQCRIYSALATMYADLGLKRKNAFILRLLLAAISPHLSSGELPAQSRDVLENMFVLYDICDESFSEAARFHGQSNWTSLQIQLLRLSLKIAENLRDQELLLKLCTLLLTRYTHCLPPDDQIKLKNKVDSAMKSNGGLSTPYWPFLIRKVKFVNSKPRGNLIPMQEASK----------------SDDSSQPFFDPYSKKELNKTFLPTLVKDDISQLKVTLQNPFAFEVEIHEITIISEGAQIETIKSLIRPLESTTKPPSIIPNGNILYNKHHGKKSSSATSVVHQGVSHTTS--------------------------THSASTFVLAPRSMESVMLSFKAVSTGQVNITGFEVSIGNCQTQFFHIID---KEKFDHTIKLQKVDHKPKQTTSVLDKVVSNL--QSQFISGRVTTSSLSLSIIPPQPSLTLLEISASNGCLMLLEGEKHNVTVTLANHSAQSINYLTFSFWDSNIEFLNKKLTNPNLTAAEVHELEWKLLVFKPFRILNKDVIGE--TINPGGVVELECELTSRKLMNDSKIILEYAY-----KSDTDQSFMKTLSIPLNVSVMPSVDVVGCEMLPAISISDNIPHNIGQALKCV---------------------------------------KNADDYCLLVLDLRNSWGERLECNLKYNEFELSEP--------------------IQAGKTQRFIVPIQRIEID-ITKSIPSL---RNKQFIKNY-NISDEEEKQMKKLFWLRHSILENLLGSWEL--GRRHGIIDLRPIRLTTKMANILSYENIQVHNTVLTDDG-------------SQVDSIGKSYSLSTDQFYVLKTTIFNKSKKPINGIVRQLPFPIHNNSRPQLSIDKKMLVNGILQRKFPEIAAGDQLALETS. 1243
24 0.000e+00UniRef50_G3AWW4 Trs120-domain-containing protein n=1 Tax=Candida tenuis (strain ATCC 10573 / BCRC 21748 / CBS 615 / JCM 9827 / NBRC 10315 / NRRL Y-14  ali  19  6.YNYVAPARVKVLVVPINHPTPAEFDGFVATLRAGSEIRLLDITPMSQ--LKYFNPQSFPSGKLLYEISTSVPDNESIFLHDFEPSRKTFIVLGVGKYS--PDVDTDGEKFNSQ-------------------------LKKLYPSTIVQNTIMFDTPDDIIKVLNP-----------------------------------------------------SNNHSMKSCFYFNSTKQNLTLMETIMCEVSRNFLFHLDEYATSYQNITLRSPVSITNSQLLAKTINKAQKRLSSGGTGSLKVSNNNGTVTGQMDAKNKTQVRNNGRQSKLMASFYLLAGKYVDALNNFTDALLYLRKSDDSVWLASALEGVGVVIILLNHISVPYQLPNAVLATVLSLSKGKIRDMSPSNSNSPNGHAITSPRPDLGLVAVPELIKRITIKVDSFFQNSTDDFENTVPDIVYIESLLRQINFMVAVFNRGIDVNHEFYTGLVNGT-----IKPNGHRTNPWFTAADILHEVDKIFSLQLVDLN-LVDQCRIYCSIASTYNELGMYRKKAFMLRTLLVEITESAPGNGATGSEQVKEIIELLFFDYGIDLNDQESKTNSGSQWRSIQLQLLKIAIHIFESLGDHRYLVKLYNLALTKYLHCLPPDDQLRLKQKLEDLKVSNPDLPLPYWDPFLVRSVKFISNKNELVPFPKDSLPKSSHAPFIFNPFEKSTAQTFSNEKLLIKDELYQLKVTLQNPFSFELE--VSDISVSSADDFPLETVRMALGPANEGLFNGRPKNGLNSPVPSRSLTQSKFSVNNPKSRNEKALA------DSKSASAPGLNTF--------DTNGTTSYNSTTSHVVSLIVPANSFEVFTFPFKALKSGEVCLDGLHISIGKCDSSKFYIVKDVKYDISNKIKPIKDKKPKDSEDSSSSKATSEQITR-----------SVLNLNVIEPQPTLSLVDLSVTNGWLMLLEGEKYKFSIRLENSSKEIINYLSFSFWDSTIQMWTSRLSNNQLSALEIYELEWLLIKLKSFKINKREISEKYNTIKPNQEIRINYEVTGKKNMTESKIILEYANKKA---DNPKNSFLKSIEVPLNLTVIPSIELINCDILPLFSSTLNGFKSSSANEKEALKN----------------------LGDLKLFMKNIDGNKDISDYCLIILDLRNSWSEELSISINFMSGADQV---------------FKINDTLRPRKAARYLIPTRRVGFKDLNKRIPSL---RNKQYVKDYS-ISEAEDLEMRQSFWLRENFLSRISGKWS--NSVRHGTISFRSIRLTNKMVNSLMYSRIKITHHILNEEDLS------------CVARSGVHLALQTEQFYIMRTVITNYSDQPISGILRHLPYPSQIPHKDQLNIDKKILFNGLLQLKLPEVEPNQSLTVDLS. 1314
25 0.000e+00UniRef50_A0A1B9G135 Uncharacterized protein n=7 Tax=Kwoniella TaxID=490731 RepID=A0A1B9G135_9TREE  ali  21  6PLSPASLSKIPILLVPVHPIPSNIYTSYQTLIKRYQTLRGDELSRPPNPRLRFFPPRGSTTNHVHLSYSGNPPARHTYPLSLLRLAGFPLIVLGVAVEPDSEVETSGYNVEEQQGESGTAPTFNHSPHPQISLNQKINPERSTSPFPLVKRLLVVSSHSSDTRGNGKDKGYMRFAPEDGAESWIGRVLGEVVGELLGELGEITLSSTLLPSLTSTLPHPELGNILSSQRSTTPSDYPSRASTSTPTGIPHSQSLDHLNTSIQPPSLPPIQSSISPSQQPQPVAASSNPFRRSTAISSPFTRXXXXXXXXXXXXNVPQITSMKYTGRLMKLLGDMYLLAGLYGDAIKCYDDGSERCRSVGDVLWEGMAREGRAVAGIGEAWEGRDGSNLAQPFPTSPIPVEILSHYLSALACLSRSPLPYPPTILSPSPQAVSGSISFPAPSSSSNP--ANVGTGEGLLAYLHTSLSLKXXXXXXXXXXXXXXXXXXXXXXXXHTLPRNFIPPLIQANTDPNLRRKRIFAHAENALQPY-HRAMTKTEQVILHNEAIWLSRWLDLPRKESSITRELIKRLAILVVEGREESKRSSGISPTSTISAENKSDEASSALGLGFSVPNQTVAVRRKESTENTGIIGLFERAALIMGIDLLSFGTSSSTSTSPHFPSNGMDDDPDGIAKPKFGWPELQVEFIKEGIAISESLPDHQSIIRLCLTALNNLNGYLNP-------------QSQHMLNRMYPQSLATVRRRGIEVGMVPWWGERVVLSLEIASLPSNKLPIEHSINE----ITPSKQGKKDPFLYNPRLKAAE-AGKTVIVANEQIDIFVTVRNPFTFDLEIQDLSILTSGVPFITFPL-PLTLPANSVQTVRVTGQSPISGSMSIKGISIRLNDGSSKELFIPIKVKLDKRRSKIKADSSKSKKTGLDARYSTSEMSIHKDRRDGAGDEEKTWLECKVVPELPLAWIKKTSLTHGTVMLYNGETSIIRIILENSSSVPIDFIKLTFDDSTAREAQAIIQEGELTPEQAYEIEYDQLNKPVFTWNQVDGKDR-LEIQPGGRVTLEVKCLGKVGCTDGTIRIDYGYLNRSSTSSTNTFYTRQITFPILFTVYHTIEAHSLDLIRLGSSGNTVNGAGENDVLVNGDKPQLERLPSTSQF-------------NEDRLKIALREENDDGYCMLALSVRNVYGVPFEVTLERND-----------HDDVSASDHVHCTRLVPPGATERMILPLPRRTIAQLSRPIPSL---SERQYIVDKEKKSVSKIKKERELFWYREELLKMVKATWVEPGSTRTGTLNIRDQLFSSSLLDIFRSDEIDIQLSLDGVNE-----------------------MVDVMEFNNLSVTITNNFERPFRPFIHISPTDPHPPSHQQPSMSKNVVFDGLTSTVLPLLQPSEQITWSTGV 1541
26 0.000e+00UniRef50_A0A1Y1UQ83 Transport protein Trs120 or TRAPPC9 TRAPP II complex subunit-domain-containing protein n=1 Tax=Kockovaella imperatae TaxID=4999 R  ali  18  17..DPTSLAKIQILLVPISPLSSQQFDYWSHLFRSRTSLRSDDLSTSHAASLNGSGPSGPSHGHVHLSYAAHPPARHLSSLSLLRISMFPLIVIGVALKPTSGDLGESIEGYSAQANGQSTDGHAGNTGSMRVFDEAVHALPPSSPFPLVKRLVLVPPKHPSHLSRGSEERDVLEAPWDNEETWIIKFLGGVVGDVLGELGDLVTAMETPQGLKTLSATLLPSLTSNPSSPSFPNGDRPRRPSTTTPYPVSHSPIEGLGIGISLKRSLTPGGRPTSIAAPSRTSGIPSAFTRSSSAASLAPPANPNPFPASTSKYTTASLVGLAGGRLLKLLGDMYLLAGMYTDAVKCFDDGAERCRSVGDVLWEALAREGRAVAGMGEAWEGRDGSEMTQPFPNSPIPIEILTHLLSSLACLSRAPLPYPSTILSPSPQAISGSLSF---ATPSSPNPSIVGTGEGLLAYLHTSLSLRISHXXXXXXXXXXXXXXXXXXXXSHTIPRSFPPSLSSLHQKSQLDRQAMFAHAEGALQPH-HRALTKAEQVALHTEVVWLARWLDLPRKEAFFSRELVKRIGELIVESREESRRRGQAGFSRTKSAIP--------LNDTNGSTPASQSVAPRQRESTEGNQSVIMLFERAMNSMGLDVLSL---STSDGKRTTLRQTGTEQVKPPRFGWPELQVEMIKEGISVADSLPDQVGVIRLCMTALRELHMYLNPGS-------------QGVLAKMLPNALAVVRRRGMPLENLRWWLPGLTLSIELTNLPPNRLPLEHSREEI------ATDKGRDPFLYNPRLRAAE-AGKTVLIAKEQTDVYVTLRNPFAFNLEIQDMSLITAGIEFVVTPLSVS-LAPQSIQSVRIVGIASTAGSLQIKGVRLRLGDGSACDILLPVDDAERKRIVKHKSRAMMDFAKTKVQGLDARYTGTTEPEPPITDPSSERWLECRVVDEQPLVWIKKSSLTHGTIMLYDGEASFIRLTLENTSTIPVDFVKLSFDDSSSRAARALISEGELTPQHAHELEWDILHRPVLTWD----DDGESNIPPGGRTTISVKCLGKVGCTDGTIRIDYGYLKRSTSSVPNSFQTRQMTFPVIFTVYHTLEPHSLDIVRFVPPNSPVESKDTEVVGLFAEQNDYLSPLPTPRTPGTPRIR----EMEKESLKEVMKSEMDASHCLFGLYVSNVYGVPFEVSLSRKGSGAQEA-------------PLTTTRLVPPGATERLLIPLPRLSLPSSTTSQPIPSL-SDRQYVVDKSTRTPAQIQEERQLFWYREELLKTVSATWIEPGSKRQGFMSLRDQVFTASLLEVYRSDDLEIEIEISSRDAE----------------------RLITGEFIDITVRLTNRLEIPYQPFVRLEPARRPPSGAPPVHNLKNVILDGCLGQVLPLIQPGESSTHSLS. 1528
27 0.000e+00UniRef50_A0A0L0NRH2 Uncharacterized protein n=4 Tax=Clavispora/Candida clade TaxID=1540022 RepID=A0A0L0NRH2_CANAR  ali  21  5.YNFATPARTRVMVVPLNAADTH-FHSYFDKIRNANDIRLLDVAAL--PDCRQFNPQSFPQGRVLYDFCTFQPDEDNLFLHDFEPFRKTFVVLGLGSYEDFDE-------------------------------NAAEILAQEQPTAIVHNCIYFNA-----------------------------------------------------SSEDIEAQKHSTNSSQSTFFVPSIEDQNITTLETTMCNVTKNYIKALSSYVSSYENITLRSPVSLRDGTALHKTITYAQKKVNSGTSFKVSFAKGQLLPSSTPDTKVKASQRQTGRQAKLIGNFLLLAGQASEASQYFTDAAINLKKADDNLWLGSALEGLAVSSLMLSYLGIPHQLQNPMLASVLHVPKSKLSSINTYQRRISTDSVSSKQSNGVTSMSLTEVLRLLCNKAALFFSLSAADFENCVPDLVFIEFLLRSTKLFISIYLAGGDSEVAVLENVINFMPIAASSAKDP------VLRADIIALINQIFTMQL-IDLDLAKQSKVYCTLAAIYSDLGLRRKRAFILRILLVALLPKL--------SQRALDPELATSDSLQST--------------------FEYLFGMYNIGRETEKNGNEAMGHYSD-------------------------------WITLQLLLLKICLRISEATKDYEVLAKLCVLILSRYTHCL-------------PSDDQIKLKRKMDWLALLSKESHNS-IMIPHPDPFIVRNAKFVLQELQDELVPFQSS-----TTSTIAHAGDPLIFNPFNKKDVPSKDKLISIDEPHQVVILLQNPFAFDLNISNISLMLGNDSQLHETPKNLTIPPNSLCHVVLAFTVTDPGLYRISSIDITFGSSQPQRFAIVDLEKIKAFQRLDCFSTRLDINQSSSILDSCAKNLVTKDIE---DRATKRSFSLTAIPPQPTLSLVENLIANGWIMLLEGERREFSIKLSNTSELPINYLSFSFWDSTNDSISAKLNNNQLLAEDMYELEWQLLKNKPFSVNKQEISSRYKIIQPQADVEFNYQINGKRGMSELRLILEYSNKSTSSD---QRSYIKTLSVPLNVTVQPSLEVIGCDVIPFFSTSLQGFKLPDSSGGKSSFEKNIGDLLKFISKA------------------RETDDDEIARYCLLVLDVRNLWKEKLKISF---------------SNEVHPGTTFDVNEIIDSAKTNRILMPIRRISFEDLDVSEPIPSL-RKRQFIKNYA-ITAEEDEQNRKNFWIRKTLLESISGNWHTATSNRSGSIDLRTIRLNIRMTNALVFDNILIQHSIMSAEGPPQR-----------IDKKQNEYILKKEHFYKLKTKITNQSKKKIFGVLRHVPFPSTESSRPDISIDQRIFFNGVLQKSVGPIASGESIEHDLG. 1296
28 0.000e+00UniRef50_A0A0J9XH59 Similar to Saccharomyces cerevisiae YDR407C TRS120 One of 10 subunits of the transport protein particle (TRAPP) complex of the ci  ali  24  4PYSYVAPARVKAFLCPLGQIKKPTFANYVTRLHSVNEVRLGDITPDRRPEKSMFSPQGFPNGKVVYDFSTSWTDTDFMLLHDLEPWRQTLCVFALTTFSYNNDNDYYM--------------------------HSLVKLRRVYSGPVLHKILVFGTPPDHEA--CNPDVIFIPSSRISTITSLGTIMCDLTSDFLAELSILASARQVAP----------------------------------------------FKSPGLKELDVPVKTQTGFKTFKVSLSRRDS--GASLHSPTKSSSSGLSRKPTALSLSLSDKTKARQRGRMLKYVAGMYLIAGHWQDALREFTDAAISLKTAHDFLWLASALEGISVCLVLLSFLEIPVPIPTIALDLLPYSQAV------------------EVTETLAATMSLLEFITDNTGSVLKYYSRSQGSPEESVPQTIYCETVLRYINFLTVIRLGGGW-NPASINALVRDVDLPNNVTTASPSIST------IVGWCNKVYATELHNL-PMLSQFRIYGGLSSIYARNDLVRKRTFILREMLANLVKPLRRN--------------------------NAINPGISHEYQNLRSLLDSLEPVFGI------------------------------------------ETVGFGWEKLRVSFLKTALELSEALDDYPGTIKYAGQLLSTSAD-------------VLNQAEQFSILRSIDMAAEKARRDGQGNLLSEYWDQNLLREITFLPSNTSIQPVK----------VTKKSTHANVFLHNPFEKKPA-AKELALVENERSELVISLQNPFAFEVHIKKLEILTNDDEIVVLNLNDIYIAPMSVFDLKFPVIPVGSGTLVIKGCKIQVANCEMKEFYLKKPTLC--QNDKVKSVGLVKLLKNLSTAAAATTIQDEKDVKTDNDSLNLTPQKYVVIPQQPILAYKETSLDQDWAMLLEGERQRFTLTVSNLSPVAAENVVLKLTDSITENLKHALQRKGLSAREIYDLEHALFEQQQPLKWIRNDVSETVSVPGYGQATFEIEITGRHDLEQAFVGIEYTAAADET-------WIRTLTVPINLTVTPSVELVNFELLPLQPNGNAANPELFRKLDPIKHCLLVLDVLNHLPTTAVDLRFKHAKGRTQQRIK---------PTCIARILVPIITTH----TPSANDEGSSATEDNA-----------------------------------ALDAPIPSI--VKTRQFVVDATLSSPEAALLARNVFWIREAILKQLQLDWTTVETPRAGMLDLRALTIDKKSVSLFRPSLVALTMTVEPATSTANGSAKANLTL--------------SNHTYTIKVDLHNKLPHDVSGFVRVIPVHELATNTNNTSKGGEYIYNGCLQRPVVRVPAGASRTV.... 1225
29 0.000e+00UniRef50_H9JHJ1 Uncharacterized protein n=12 Tax=Ditrysia TaxID=37567 RepID=H9JHJ1_BOMMO  ali  16  13......HACLLVLVKGIGGM-LKNFNKLWERIQRINTIKVTDSAGQVRD---------------IWVRYVRDYPVENNDWGDFQTHRRLLGLITLSKFTN--------------------------QVELNEVCRVHESLKVKYSNTLYSRAFMFGPISNMKKPEQEPETYSIFEGEKTI-----KQECNIS---------------EKASIPSEHMDSLSSSESFP-RSTSSTTSYTQEENFTTPSNFKTHAMFYGENDPVPDLEQNVADLINSLFWVVESKRLERSREKLEKVSLLLAPFEKKDFVGLDMESRNNKK--RCMGRVTTNLADLTLQAGLVADSLNLYHSAAEILKSVNDWLWLAAAKEGLCASSAILLYPNLRNSTPLQRNASLQESSPSKSKPLSLFQPTDPLNSSPLRNSKTSSPINPPSELTPTSSESIDTSSRQSETDN--------------------------GDTESLASSSDIEYQSPKSYLSTELPSIPRQPPSQITNQYLLNG--------EEIAEKYRKAIIHYSKYQNAGIIETEACF------------------KAARIAVEQNNSLHA---SSFLQNVIFINLTLSEQEKIQRFDTLAELYKDIGFLRKAAFCQRLAATRQVSPNNPNPDWQRCYYLMLHSPNYVVQHQVGWPALQIQLLQELVVPARRMGHPALATRHMTFLLQTMWPHLTKQEHRDLAIQLQALSAQCE-----GGPVPLVLETGEVIPPANLSHVPNCSWFTPRPLPPARAPH-----------LVKSKAHHGPFIFTPNAKKQEGKMEYLWVEGDICEVQMKLTNPLPFELKVSNMRLLTSGVVFESIP-ETIILPPDSPTTVNLHGTPKEIGELQILGYSTHTLGVKSNCRL-------KNMPMPNKFPASFTVEVIPSLPTIAIET--------------------TVTPSGNGGLSTETVGSTTNVTLYNGESTDCTIKITNTNSVPIEYLDLAIQSNIDTALQSKI----------------------FQFSNEDI-QSQLPIAPDQTATITIKLYGEADFLDGENLFPNSLTSNYPSRVGSPVPNAQTSLPTQSSTSGSFRSTNSYATSWSAPISVMPPSRGRQIESQLILRYSGGEGKDVHCRQSTLQINLELLPSVSITHWDVLPAEIASQLYLVLDVTNLTSEEMDFHYAPNK-----------------------HILIESKESCRVPVPLDRCPFSNTN---------VKSDDDTTDSKSISTGTSTNSLELMCSEHITNNTDLRWNLVHSDISGRASVKGITLSQTMMDIVRMSPLNWEVSINSQCIKPQE-----------------EFNCTAGECLSLGVAVWNHLSRPLHLCLSVQFYQDYNNGVFSYKLDNRVATAGNNKVVLTTLRESAKAYHECTV 1256
30 0.000e+00UniRef50_A0A2W1BWZ6 Uncharacterized protein n=6 Tax=Noctuidae TaxID=7100 RepID=A0A2W1BWZ6_HELAM  ali  14  30......HACLLVLVKGIGGM-LKNFNKLWERIQRVNNIKVTDSTGQVRD---------------IWVRYVRDYPVENNDWGDFQTHRRLLGLITLSKFTN--------------------------QVELNEVCRVHESLKVKYSNTLFSRAFMFGPVSNMKKPEQEPETYSYYEEERP----LKDGMSDRAS------------------IPSEQADSLSSLESFPQSTSSNSSYPLQEENFTIPSNFKTHAMFHGENDPVPDLEQNVADLINSLFWVVESKRLERSKEKLEKVSLLLAPFEKKDFVGLDMESRNNKK--RCMGRVTKNLADLTLQAGLVAESLCLYNSSAELLKT--DWLWLAAAKEGLCTASAILLYPNLRNPTPLHRNASLQENSPNKAKQLSLFQPTSDTFRKLKLTSSPLRTSKTSSPVNPPSELTPTSSDSVETSSRQSETDNADSESL--------------------ASSSDIEYQSHKSFLGPDLPSIPRQPPSQINNQYLLNG--------EEIAERYREAIMDYSKYKNAGVIETEACF------------------KAARIAVEQANSLHA---SSFLQNVIFINLTLSEQEKIQRFETLAELYKEIGFHRKAGFCQRLAATRQVSPNNPSPDWQKCYYLMLHSPNYVIQYQVGWPALQIQLLQELVVASRRMGHPALATRHMTFLLQTMWPHLSRQEHRELAIQLQALSAQCE-----GGPVPLVLETGEVIPPANLTHVPQCSWFSARPLPPARAPHMRQAKPTHGPFIFTPIHFGS---LERNAKKDEGKMEYLWVEDDICEVQMKLTNPLPFELKVSNMRLLTSGVVFESLP-ETIILPPDSPTTVNLHGTPKEVGELQILGYSTHTLGVKSNCRL--------------KNMPTPHKFPASYTIEVIPSLPTITIETIVTPSGNSSGLNIENVGST------------TNISLFNGESTDCSINITNTSNVPIEHLELAIQSNMDSQLQS----------------------KVFQYSNEDI-QSLLPIAPNATATIAIKLYGEADFLDGENLFPNSLNSNYPSRVGSPVPNAQTSLPTQSSTSGSFRSTNSHTTSWSAPISVMSPSRGRQIETQLIIRYSGGEGKDMHCRQSTLQINLELLPSVSITHWDVLPAEIPSQLYLVLDVTNLTSEEMDFHYAPSK-----------------------HILIESKESCRVPVPLDRCPFNT------TPSKTTDEDLVESKSTNTGTSTNS--LELMCSEHITNNTALRWHLMQSDTQGKASVKGITLSQAMMDIVRMSPLNWEVSVNSQCIKPQE-----------------EYNCTAGECLSLGVAVWNHLSRPLHLCLSVQFYQDYNNGVLSYKLDNRVATAGNNKVVLTTLPESAKAYHECTV 1273
31 0.000e+00UniRef50_A0A1V2L1W8 Trafficking protein particle complex subunit 9 n=2 Tax=Cyberlindnera fabianii TaxID=36022 RepID=A0A1V2L1W8_CYBFA  ali  26  5..AYTAPARVRALLVPLGSLTNDRFHELSQELSQAFEVRLVDVTP---TRTQQFNPQGFPSGRVFYEFSTSLDNQESMFLHDFEPFRKTFVVIGITD------------------------------QINSSIEDEIKQLKKIYKSSIVHCAVVFGEKQEQIGPTNSENVFHC-----TKQSTPETVMCDVTRQLLDELSSYI-----------------SSYQHITLRSPGTLGSNDRAKPMT----------------------------------------STKSKRISSGSSIGLSLSSDLSSSKITIKTPTERRYARVKGRQAKILGNLLLLAGKYSDALNELTEAIVQLKAGNDHLWLGSALEAAGVCIFMLTYLGMSYQIPHALASVINSSSAASSSPAPVHANGSPNGSSTSRQSVELEKIPVEDLLYKIMSKVFHLYESSQNDSEDYVPNLVYCESILRFLRFMTVLNIGGGLNDQT-RNHIVKGSAI------TLHNQNDAFEKSDILRLSQKIMTVQLK-NMDVLSQTRIYTSMASLYGALG-------YERKKSFMLRTLFVSLRTHLNGERGTDIVGPIYDLED---------------------VINTVLSTYGISLSTESDIKDAFSPK---------------------------------WMQLHKSIIKLCINVCQEIQDYKTVVALQSMLLTRYLDALTDNEQHRVFAEIQEVSHKHA-------------------VPTFYFDPFLLRGVYLVRPP--------NPPKKQTKTALINNKPANPVIYNPYTK-TEAVEKNYLVKDELSEFLVVVQNPFAFPITINDIKIPNMDIFR-----NHFTVAPKSVQKIHILTKPLKDGHFEIESVTIRINDFTSQPFRIAKS-QKVKHVKKLKEKQEQTTNILSAYMTNINSSNILDRVDTDT-------LTIDVIPAQPSLQVLNS---PDPLMLLEGGTHRLSLILKNNSPVSVNALDFTVWDSTLDPLKKMLEDKSQPATEVYEFEYYLYKKSL------KILSDFTEIEPFEEKTLELEVQGKRGVKQISLGIDYGH-----SEEGGDAFTRTLQVPITAIVHSSTDLADCDVVPLVQDISSDKYDIWEYVNKNS--------------------------------------GAISDWCLFLLDIRNLWNKAMSIEVEYE--------------------GFKSSGFIVPMETKRLVLPIKRIELDYENRPIPSL---SGKQYVVP--KISRAEDQYQREMFWYREEILKRIKGTWR--AGGISGELELRAIRLAQKKLNVLKVDRVSIDIEVENSEKT------------------GVHHLVKTGDFVTVDVKITNNSDRIIKGVIRNIPT---ANSFGPVE--RRLLFNGMLQQPLKKLPPKESYTLQIG. 1161
32 0.000e+00UniRef50_A0A0J0XFP9 Uncharacterized protein n=1 Tax=Cutaneotrichosporon oleaginosum TaxID=879819 RepID=A0A0J0XFP9_9TREE  ali  20  6PLSPMALARLQILLVPVHPLLESVYEHWSKLFRKHQTLRGDEIRGVPESPRSRFLPRAAGASTVQLAFPSHAPAKHLYALSLLRMSAFPLVVIGIGVGTETPKEDRASATQAWTQTFAQTLNDIMPATSAFPLVRRLVLVPSQVPTSD-RRIAASGTPTSVAGGASPSSSFIRYAPAEGGDSWASKLLGEVIGDVYGELGELAASLESPAGMKTLSGTLLPSLSNSLPLVPSISRQPVRTLTPGGRPTSVQGPSAPPIQSSVISPAAPSPTTSISSNPFKRTSMLSSPFNRASSAGSPAATKESKDALGIARYTSAPLTGIAG-GRLLKLLGDMYILTGKYSDAIKCYDEGAEKSRGVGDVLWEALAREGRAVAGIGEAWEGRDGSTHSTPFPSSPIPVEILSHYLSALACLSRAPLPFPPSSTILSPSPQRDSLSLPPTTSL---SPTIVGTGEGLLAYLYSSLCIRISHXXXXXXXXXXXXXXXXXXXXXHALPRSFPPPLAQLAAESQLARHTLLGHAEAGIASFRKAMAKP-EQLAVYVEVVRIARWLDMERKEAAATREVLKLVGAIVVEGREQHRRLLSQAAARA----HGTDFSRMEGAMGYGMGVPVSAVVARRKEASAGNPGITELIERICAVLGIDILAFGNAHRDDQ-----VSKQGDTADEPHFGWPDLQVEVIKEAITIAESLPDQLSVVRLCLSALRSLHPHL-------------SQANQAQLSKLYVQAISTLRRRAIEVGPLPWWVPRMVLSVEIAALTSNKVPIEHARAEME--QVEQKQGSKDPFLYNPRLKAVE-QGKTLLVANEQVDVFVTLRNPFAFDLEIQDLSLLTTGSPFMTNPL-PLILPSSSVQTVRITGIAPAPGALQIRGVNIRLADGASAEFLVPVAEASGKNSDSKRRSAALAKVKRQGLEARKSVVPGADVPPALPVLDDRRWLECNVVEDQPLLWIKNTSLNHGTVMLYDGETSVIRLTVENSSAHPVDFVKLSFEDSVSREAQFLLADGEQTPQQAYELDYSISKQPVFTWDST----SPLLIPPGGRATLSVRVLGKVGCTDGTIHIDYGFVNR--AETSNTFFTRRLSYPVLFTVYRTLECFALDLESMRNDSQAEARQRLANGTTPRSTAFATSSDEE---------------------LKRALARGDERSVLFCINVRNVFSVPFEVALASAEGE----------------GRSVVTRLVPPGATERLVLPIQRQALSAKQRAQAI--PSAGRQYVVDKQKKTSDELALERETFWYRERLLDMVNISWREPSSLRAGVLSLREQPFSISQLDALRLSEVAVTLAVSPRDAQGP----------------------KAMDFVDLQVTVTNHLERTLRPYVRLEALPTSSNDASPMPLPKTVAFDGVLAATLPALAPGDSASHIVG. 1469
33 0.000e+00UniRef50_K0KNG5 Transport protein particle n=1 Tax=Wickerhamomyces ciferrii (strain F-60-10 / ATCC 14091 / CBS 111 / JCM 3599 / NBRC 0793 / NRRL Y-10  ali  25  5..SYTAPSRVKALLVPLGNVSEVAFKNYVEKIKSSYEVRLVDVTP---TENSLFNPQGFPQGRVIYDFQLSLNDQESIFLNDFEPFRKTFVVIGITDSSNISH-------------------------------NDLELLSKHYKSSITHSIIVFG---DGDHNDMEHKQIFH----QSNKINIETILCDITGLFLNDLASYLSSFQHI-TLRSPGTIGSNDRIKAIEPSKRKRISSGSSLSISMSDSN------------------------------NPKLSLSSSAE---------------------------RRQSKVRGRQLKILGNLYLLAGKYNNALKELNDAVPLLRISNDYLWLGSTLESIGVCLVMLTFLGVPYQMPSSLNQILHTSMTIPTPSATPISTPRNSMNQSSVNSTDISRYTTPELINLISIKVIHYYEISQNDHEDYVPQLVFCESILRFVKFMCVVNIGGGF-NQTTIDHIVRGKNIRPK------YSNVIFDKMEIVKIANKILTFQLK-TMDILSQAKIYTSLASVFGDLNLLRKRSFIIRTLFISLIPEL--------------------------SNNDQYNNNNGKKTHNLSELLDTILSIYGIGRSPESLILDSYSSR---------------------------------WVQLHKSILQLCIIICSKIQDYKKIVQFKSLLITRYSDSLTDNEQSKILNEIQNI------------------CKEQDYIQFNYFDPLILRGLEVLKP-------INPPKKQSNTIVSDQTTKADPFLYNPYAK-PLVTDETYFVQDEFMEFQISVQNPFAFPLQINDVQIESFEILK-----NFFIIQPKSLSVLNVLVKPIKSGVLKISEIGLKIFDCQLQFFKISSNL-KPEFFNKLKKTSKDLNVSILENYDENILQNK------IEDKVITQELTLNVINSQPNIQLINE---PEHIMLLEGGSQTINLKIKNNSPILANHLEFSVWDSTIEPLKNVLNNKGLPSNEVYEIEYFLFKNPLTIKTEIK------ELQPFEEKTLEVELNGKRGMNQVNLILDYGHKLQNQA------FTRRMEIPIKIMVNPSTDLAGCDILPLVQNVDSKSGKVWSYINEKTSQTDKNGKNLI-----------------------------ISDFALFLIDLRNVWNKTLNLDIKYDD--------------------FEINESIVPMETKRILIPIKRIQLDDDNLDIVP--SLSKKQYILP--KITKAEDQYIKEAFWYRKEILKKLSGNWKI--GEITGSIEFRGVRLSQRMLTTLKTDKLNIKIDVKTESQDHP------------VQTKGLYKLIPIDEFFTINIKIHNNTSRSIKGVLRNIPMASNFG-----SIDRRLLFNGVLQQPLNSIKPDETLEFKIG. 1175
34 0.000e+00UniRef50_A0A212EV43 Uncharacterized protein n=1 Tax=Danaus plexippus plexippus TaxID=278856 RepID=A0A212EV43_DANPL  ali  14  30......HACLLVLVKGIGGV-LKNFNKLWERIQRVNNIKVTDSSGQVRD---------------IWVRYVRDYPVENNDWGDFQTHRRLLGLITLSKFAN--------------------------QVELNEVCRVHESLKVKYSNTLYSRAFMFGPGSNLKKPEQEPETYSFYEDDKTKE---KTSLSDKISL--------------------PSEAADSLSSCDSIAQSSSSTYSVQEENFTTPSNFKTHALFYGENDPVPDLEQHVAELINSLFWVVESKRLERSREKLEKVSLLLAPFEKRDFVGLDMESRNNKK--RCMGRVTKNLADLTLQAGLVPEALSLYNSAGEILKSVNDWLWLGAAKEGHCVTSAIIQYPHLRNSTPLQRNASLQESSPNKTKPLSLYQPPSEPYRKFKLNFSPLKTSKTSSPINAPNELTPSSSESLETSSRQSETDNADTESL--------------------ASSTDIEYQSQKSYLSPDLPSIPRQPT---------SIHTMYLLSGEEIAEKYRKATIHYSKYQNAGIIETEACF------------------KAARIAVEQNNTLRA---SSFLQNVIFINLTLSEQEKIQRFDTLAELYKEIGFLRKAAFCQRLAATRQVSANNPNPDWPRCYHLMLHSPNYAVQHQVGWPALQIQLLHELVVAARRMGHPALATRHMTFLLQTMWPHLSRQEHRDLAIQLQALSAQCE-----GGPVPLVLETGEVIPPANLTHVPTCLYFNPRPLPPARTPHLIKSKSNQGPFIFTPIHFGS---LERKTKKDEGKMEYLWVEDDICEVQMKLTNPLPFELKVSNMRLLTSGVVFESIP-ETIILPPDSPTTVNLHGTPKEVGELLILGYSTHTLGVKSNCRL-------KNMPMPHKFPSAFSIEVIPSLPRISIETTLTLSGNVNISNPE-------------------ISASVTNISLYNGESTECTIKITNTSNVAIEYLDLLIQSNMDNQLQ----------------------RKVFQWSNEHI-QSQLPIKPTDIASIPITLYGEADFLDGENIFPNSLTSNYPSRVGSPVPNAQTSLPTQLMVNRSFRSSNSQTTSWSAPISIMPPSRGRQIETQIVLRYSGGAGKELHCRQSTLQMNLELLPSVSITHWDVLPAEIPSQLYLVLDITNLTNEEMDFEYAPSK-----------------------HILIEGKESCRVPVPLDRCPFTSTAVKIEDADSME--------PKSISTGTSINSLEVMCSEHLTKNVDLKWHLLQSNINGRASVKGITLSQSMMDIVRMSPLNWEVSLNKQYIKPQE-----------------EYNCTAGECLFLGVAVSNHLKRPLHLCLSVQFYQDYNNGVRNYKLDNRVATAGNNKVVLTTLSESAKAYHECTV 1270
35 0.000e+00UniRef50_U5H6R3 Uncharacterized protein n=2 Tax=Microbotryomycetes TaxID=162481 RepID=U5H6R3_USTV1  ali  23  1..........................................................................................................................................................................................................................................................................................................................................MADMWLLAGRTEQAIACYEEAIALLKTWSDNVWYASALEGLTIALVLQAWRPPSPAAAVAAAATAKHASTNSISKSTNSISKSTSTPTSTLASNAADPSTFLSSIPDRLGQAVGLYEKMLPNLADRCHPLIYAEACLRIARFLLAVHEARGKIDRAIEKLVIPSSCSASEARWRSLSPSNPVPRSMIAQWASMAYSAHLGQLA-LPTRLRVTGEIASFFGRIGYRRKEGFVLREAALCGQGVAGKGVEVFSAVHGPSPTSPVSATMNDRTASIVRTTSDSAGNESIIRIAEKVCESFGIFVVPRIAKDTA--TTNPTSGHHLRQKSLLQGRPLELDYRLSSSSSPFGWSHLQMGVLKDAISVAEALPDYQAAIRFTVTALRSF-------------AETMPAWDQLELSRNIPRIFAAATRRGAAFELEYWGPTQLVMSLEMAPLTPNRVPIEHSIKDAEANGTFNNFAKKDPFIATYDPNDASPRIRPRLITNEVAEVFVTLQNPLGFDLEIQSMQLSTSGVDFICDALS-TIVPAGSFHTVRLSGTPQAPGRLTIRGCHILLAGCTSREFLLPVWNDQEEEKRQKVTLLETARERIKTTGLTAFVRQASQQSTTTTTEQEFRFLECTVVREMPLLCVRSTSLTHGALMLYDGETSTIRIALENVSTRPVDFVKLTFSDLHTTTTQAYVDENELPPAEAYEIEADNRDRPVFSWTVDQMP----RIGPGQTYLLDVQCLGKVGCGSGTIQIDYATLPPSEADPTTVFHTRQILCDVFMTVHRALLAHTLDILRLQALPEH--------------------VAFAHGRSASVAQLGRRGAALDQRLEQSLRDVDDGEHCLVSIDVMNAYGKPFEVKIERCEDESS---------------FFQVRQRLEPGATLRMLARIDRINIEEAERPIPVL---SERQFVLSKHQVSAAEQRSTRELFWFREELLRRIRATWNEVGSLRTGTISLRSLKLSSSLLDVLKGDEVEVELQL------VENEASSPEAFRFKGRGNRLVYAAQPNEFIDVCAYVSNHSPLAVQLALRLLKSPDATVASSLTHLARHIIIEGVSPVAVRTLLPGESETVKVSI 1134
36 0.000e+00UniRef50_A0A2I0RPN8 Uncharacterized protein n=2 Tax=Cercospora zeina TaxID=348901 RepID=A0A2I0RPN8_9PEZI  ali  28  4.FSPAAAAHIRALVLPVGSIERHRFLLFVHRLQREASLPLADVAPYAADDGHLLSPKCSTHASLLYRFSPSAPSEQLHQLSPYELFREPLLVIGVVDGLTGD-----------------------AEAREKELDAAAAYLKERHPRVVHRQLLVLQQGDS-AHPTSIAKAVAVANIDSPHDPSLRAAICDISARFLVEFTTYAKALQASPSIQTPGQTARSLQRSGSIRDNDNRS-SSGMSSPADEESPSRPPPRPASIPATSFDQIPSANALAHTRDRSDSKESGHSKAKGH---NRNSSNDRIALQGFGSGASAEKSRARGKARVGIVLASIYMMAGRWTDALPMFVEHTIKARALSDHLWHAKGLENSLLCLLLLAWAGIEFQVPSICDPTTERSGSSTIARASIDARV-------AAEGMQRQIVRLSVAIPDLCKLIVSLYRSHEGALE--LPTIVPAEAVVRISKLLATLGAAGGELSPSNLQPLIVGHTGHIGEQEKRRGKIAQPSRTATAELLAQALPTS-DDGLPAADHVRLLSGIAAAYDMLGLERKKAITIKDLIARLTQALLQARKLGAAEMGIHPAAALSVESGSESILSSSGEMRGVSD-----MIAELCAIYGANVLP----------------------------AIRQETPIFADIKNYGNDNLKRDLLKELAHFSEASPDPHGILSLTASLLRAAGPNSALDAGTSDIGNAFSREEQMHYATVINRTVAVSKHLGLTDVRAVYWDPFIVRMVQILQPTGQRAVIDRTKLNMAQKAANQPIAPGNPLLYDPTTSRPGTAAQFLLVANEASECVITLQNPFDIPVDIESLELVTDGAELASEH-QPTTLGPLRFQQVTLMVTPKAVGVTKITGCHIRLQGCYPQVFPIITTSWSAQAPFTVKDLQKDSRHVAHD---------ESTEARLKSLGIEPGYVSATVIDDLPVLQLENTSALESGLMLLEGESRSIELILRNTSNIAAT---VFEATDTADVLQRDDEHKLKL--------------RGIRHKRSKSFLPTTTVAPGECTTFKFRVEGKAGLSSTQANFYY-----QASNNFNSKHARVVSVPVIMTVNAALQVHNLEILQPDHIYNSPSALLV.................................................................................................................................................................................................................................................................................................................. 1046
37 0.000e+00UniRef50_A0A1E4RI61 Trs120-domain-containing protein n=1 Tax=Hyphopichia burtonii NRRL Y-1933 TaxID=984485 RepID=A0A1E4RI61_9ASCO  ali  21  5.YGYTAPARVKVLVVPVNGCSKVDFERYFDLIRSTDEIRLLDIPPI--PESQYFNPQSYPHGKIMYEYSSSYPEDESIFLHDFEPFRKTFIVISVGKYLKEFDS-----------------------------QQSLNSLKKLHQSSIVHNSIIFDTP----------------------------------SDLIKDLN--------------PPSNHDFKLVFYHDGSTDHNITAIETLVCEVSRNFLLALDNYASSYLNITLRSPVSITDSHILTRAITQAQKR-------LTSGSSSFKLSFNSSNTSPIASNDIKSKHNGRQAKLLGSFFLLAGKTSDALHYFIDAIINLKKSDDFLWLGSAIEGLGIASVMLHFLNIPFQLNNPALLSSPKRLSSESKSNRNSNPTLMSPRNSTISNGDLNSLPLPELIKRLNSKVLHLYHMSTNDYENTVPDIVYIECLLRSIKFMVYVHLSGPEIDSLVLERIVKSKTCGNK------SDNTWFTKSDILAQIDKVFSLQLV-DMDFFEQCRIYCALASMYTDLGLKRKRAFILRILIIALLPK-------------------------FETRLNESVLSDYTSIGSIRDIFDELFIAYGINVDPESTATAASQHPND-------------------------------WVSLQLQLLKICLRILEAIKDYSYLIKLCTMLLTRYTHCLPP-------------ADQIALKEKIDALIYLSDRNNL-NLEAPYWDPFLIRKVKYVSSKSKDSLIPFPEYERDNHNVSTPKPDESALIFNPYNKAKTLNKERLLIKNEIYQLKVALQNPFSFEIEVTDFSIMTEGNPATVVGLNDQQLPPNSKHTISVAFKPLEAGALSIVGFDVAMGSCNPQFFQIID------EEFFDHTQKIKVLEKPIDPLGPLESVITNLSGNNIEGRASTRTLQLSVVPPQPTLSLTNILINNGWLMLLEGEKYEFSICLTNHSDEPINYLSFSFWDSTIEPLSTKLNSNTLSANEVYEIEWLLLMFKPFRINKEEITSKYKIIQPHSDLKINYEITGKRGMKELRILLDYSNKLANDVSNS---FVKNVNVPLNLTVMPSIELIGCDILPLLSSSLQALDNVMPKNLTSNLKQILGFISKI----------------------MDSKTEDISEYCLLVIDMRNSWNEKLSCNFTYTMDLNSE---------------FKVEEIIDPMKTSRFLLPIRRISSNDIDLSKPVPSL-RNKQFIKNY-FITDEEELKLRETFWLRYSLLEKLKGDWETVNGNRRGIINLRGIRLSPKMANVLVYSKVQIHHTLIRNE--------------IPIKKSGLQFLLDIEEFYTLKTKITNNSEDEINAILRHIPFPLATSIASQVSIDRKILVNGLLQNHLGEIKPQESIEIDLP. 1339
38 0.000e+00UniRef50_A0A0F7SF83 Targeting complex (TRAPP) subunit n=1 Tax=Phaffia rhodozyma TaxID=264483 RepID=A0A0F7SF83_PHARH  ali  20  3PCSPIGLAQIPVLIVPLGKVRAETWTKYSELLGSFTQLSQADIPLDANHKKSRFYPSSNNNNTLHLTYSHSLPPLSTESLSLIRPSVKPLIFIGIVDLHHTCTPSLPLGASNKLAELFPSNDSHPLVVKCFGVGGEDDNSRDGGPGTVGIEIGLNEVVIDGGPGEVGGNGVTVLPRLGQPRELIEAMIGELVGTLLGEFSDLAASLETPSGYAHLHQSLLPSFSVPSGPTRASSPFSRPGTAHSASVPVSHSQPHPFRSSTLNGGSTPPIFPSPSPTPPVLSNTLSSQTSSARTTTASPTPMTPTSEFGVGTGGGPVKTSLGGVGRLNVVLASLYLLSGRLGDAIASINEALPIFKSMTDPIWLANGLEILGSAILLL-----------------ELKSKGPSSAGRAGPSLGASTSSSFSTSSGGVTTTEYAEILGNLNQAINTYHFSPTGARNPLPAM-YTWCALRQARVLELILLSGGELGPDTVPFLFSSSSYPPSYRTTCRTKAIVAARAEISAKASVAHGPWLLGLEQ-KERIHVLSVLVKLMRSLGLRRKEGLYARELLACLADGVVSARSSNGGGPSSVGGSTQKAKDRAGEGIGVRDVMDMEGNKGIVILMERTLEGYGVGLGSSAFWEGTEKSENDKLQSVERKFVGGKEY----LDEEATGKDRFGWSDLVLRVLRDGIALGEVLPDYHSVIRISTTMLRVFYPSIPPP-------------EQNYLSQVLSRSLATAHRRGILNPELRFWPGWIVLSLEAGSLPTSHQPIEHAMQDREIASSSSAKGLRDPFLFNPRSKSSGQGGTTPLVQNDNAEFFVTLRNPFGFELQIQNIRLSTFGVGFTSNPCS-ATIYPNSIQTFRVTGFAHSHGQLVVQGCVIRLQDGSEAEFMLPLHSIRKDTERTVKLSGLNARPTERKRRESTWLANAPEKVKARMSLGEDNYLTCEVVPEQPLLRIRGTSLTHGAIMLYAGEESFIRITLENTSNVPVDFVKLSFQDSTTGPAQAKIAEGELSPGELHEIEADLIKRPVFNWDRS---PESVKIPPRGRYTVDVGCLGKVGCTWGSIQIDYALINRSPENPSAIFHTRQITLSILMSVYNTLESTSLDILRIPSFTSSRARLT-----------------SSNLSLTERTVDLPLDRQEESSIKDGFEMKDPEDQCLVAIDIRNVYGQPFEVTLEATKVYEGRKRKS-------------STRLVTPGCTERVVISIPRVLLPFEQTAMPIPSLM-QRQYVVSSSNATGSEDDLVRNLFWYREELLSLIKASWCEPGTSKRGTLSLRSQRLTEPMLQVLRVDEVSVSLSVVPNGRS---------------ETGLVQSTVQSNEFFDIVVNVRNRLARSISPLISLNPILASQPHTSPSNLTSPYMIHSNSLMLVPPIPPNSSVDTVFTV 1501
39 0.000e+00UniRef50_A3GI78 TRS120 targeting complex (TRAPP) component involved in ER to Golgi membrane traffic n=2 Tax=Debaryomycetaceae TaxID=766764 RepID=A3GI  ali  23  5.YGYTTPANVKTLLVPINKCTSTQFNRHLQVLPDMHEVRLLDLSP--NTDLQYFNPQTFPNGRIFLDLHLAAPEANSIFLHDFEPFRKTFVVIGVASYTADINVEY-----------------------------HLENLAKHYPGAIVHNIIVFDTPTSEASDHSAKSVFYHDASSDHNLTALETIICGITQNFLVALDTYAASYTNITL----------------------------------------------------RSPVSITDSYILTKTINQAQKRLSSGSTSFKVSFSGPNP-----PSSNPIDSKSKSQQRHNGRQLKLMANFYLLAGKYVDSVQHFIDAAITLKKCDDYLWLGSALEGISNSVVLLHYIGSNHQLSSSLISSILSVSKMKLSSLSTTSPKRTSVDQSSNSGADINAIPLPELIKIFSARVLFYYDQSTNDFENMVPDLVYVESILRTIKFMIGIYLGGNDSSSLLLQSIVFCKSYS-----NTIVNSQFFSKSDILKEIDKVFQLQLV-DMGIIEQCRIYSTLASMYGDLDLVRKKAFILRFLIVGILPKLN---------------------------ASDGQIGKNDQNQSIRGIFEYLFTIYGINLETESSP------------------------------IDASIQSQGNWVSLQIQLLRLCLRTTETLKDYPFHLKLCTLLLTRYTHCL-------------PSDDQHKLKGKIERILFLSNRNNL-KLSVPYWDPFLVRKVKFINNRNRDEVMPFLDYQNNTINTDEEVNAPFFDPYNKPLASSTFNKDKILIRDDVYQLKVQLQNPFAFEVEINDLTIVTEGNV-TVQTLKNQIRPFNGTQVNSAIVVPPCSSEHFVVGFKICIGVCEEQFFRIVDKELTKVALKVKDMDGRSAKKENTLDKVCQNLRNNSIDGRIST-----KNLVLHVIPPQPALSLIGISMTNGWIMLLEGERFNFSIRLANNSSVLINYLSFSFWDSTIEPLNKKLNASSLPASDVYEIEWYLLQFKPFRINKETIMEKYRTIDPQSEIKIDYEINGRRGMKESKIILEYAHK---ESEDLSKNYIKYVNIPLNVSIMPSLEIVGCDILPLFSDLILENLDNVLSFITKVIKADTE---------------------------------EISDYCLFLVDIRNSWNEKLSCSLSYSFDETSS---------------FDVNEVIEPGKTTRFLLPVKRVSSKDLTKPIPSL---RNKQFVKNYT-ITEAEEMQMREIFWLRNSLLEKLSNHWKTITGKRAGSIDLRAIRLSTKMSNVLVYSKIRLLTTILDD------------GQQQPVAKEGTQYLLKIDEFYTLRTTIINNTESTINGILRHLPFPMSILSNTQMSIDRKILINGVLQSPVCKIEPGDKIDLDLG. 1317
40 0.000e+00UniRef50_M7U0U5 Putative hypercellular protein a protein n=2 Tax=Sordariomycetes TaxID=147550 RepID=M7U0U5_EUTLA  ali  37  1...............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................MVVRELVSVLIGGLVEARTRGAADVGIHPAAGLVALNAVNGHTNALELGEGDIEYGVDAFLGLLCKTYGVVSFNESAQKSKTADA---------ASALDTDSNVISRIQDQSAVRHFGIHNVKTNILRACIHFSEALPDFNGVLKFSSDLLRTSGSGVAPGPRREDAAPMITREEQVRLANNISKTSDLAQRLGLGHLSAEYWDEFLIREIIMDSLPPSKTPIEHSKNVLPGATTARSSQDVNPFIYNPFSRTSDKVAERTLVTGEAAKFRITLQNPYDIDVEIESIKLDTEGAKFESSVES-TILGPYRTQILKIFGTPLEAGAVKVTGAIVRVRGCRERRFPIFPQPWAPETDIKIKGIGLGAIEKNKILPPPGPVL-------------KPDNIELKAISAQPVVVIQSTSLPQSSVMVLEGERQVFSITLCNSSTTPADLLLFSFQDSTQGPLQTALSHRDATPIELYEYELILAKKQALRLR--KVSDAKRYIAPGGTATFEFEILGKPGLTNGTVQIDYAYLGVPQADVTGLFHTRQVCLDLTITVNASIELVRADILPIQ------------------------GAISSSLWXXXXXXXXXXXXPLEPPQPESDEVLANDAQCLLLMDLRNAWPSDMAVRFETSEGIVAE-------------------EHILPGNTNRVILPIPRVYLADPHGSIPALNPSRQRQFVVSSSRITPEVERANREAFWYRERILASLDASWRTLSPPRKGTLELRGLRLTPRMIDAVKIDEVTTTAAAVPNAVTTTTSDNINYSTNYSSNNTTTKNTIYVDDFARIRVRVTNRTDQPIYPTIRIMPSLGRRPAVSTLDLTRKLAWNGTLQRHLPLLAARSSADVVLGV 871
41 0.000e+00UniRef50_A0A177VET8 Uncharacterized protein n=4 Tax=Tilletia TaxID=13289 RepID=A0A177VET8_9BASI  ali  20  11...FASPSRIRILLVPVGDIAPEEFVRWCDHVSSFETMRLSDVPRSSAASVGAGAGGVHQKGEIHLSFVTAHDP-SHNFLAPFNLHRQVLGVLGLASYDTLTDQDRST------------------------LERMPAALRDMCPGALVHRVYAFDPETVDLSVMKDPAAAIAAAGARSGSGASWPGLPPMTPSASAGDVGRIGSTGLPSTPTSPRVPTSPSSGLVVFPAVRKDGRDVRFYLRTLLPNYVGALLDGLHTLVTGLEGMPLETPRETLDGLGVNSAAAAAGAAANGSGTVPVIGAGSGIGVGGAPVTASAAPQRGTGRITKVKADYALLSGDLWTALSMYDKCLSSLAGGQDAVWYAGGLEGWAVARLLVARMGGDV-ESKAPNTSLPTGTSKEKDKKEREKEAAESPYAKLPWAEMAEALALAVTIYSKCLAPPSYLSASNETPRDYTHPLIHASACISHARFLLAVWASEGWNGETFDQLMYGGTPPPTKAKYMHFCKSSGVQRHEIATAASQALTNSIPALKPPM-QIGILSALASLFGCVGFTRREAYLLRQVQAVVVSLIGQPRREKAVSSRLGHGGSASSNDSTQKSSASDDLSISDTAESVLVLALQVCETLGIDLDQAVLQNVPRVHINGALRGLWAASPGSPVQQAGENLYEVERYPDFGWPEQQLALLRDTVSVAELFSDHVSVAFFSALILRKYH-------------AYIAADEQERIIQVLRKTLDTAKWNGAQELQLAYWGPSKPLKLEFIPMPPSLIPYQRAHSELRADQEADSRSQGNPFFWNP-VRASTAVERARLVQDERAEFLVKLQNPLAVHLDFTSIKLSTTGVAFVADEIQASI-PPGITQTIKLSGTPQDTGKLVIRGCILTLAGCVPQEFVLPLALELHERHVKTKRQGLDMRPVLMAKAGMTASDARDARKRLTLGTMGRPMLTCVVLPAQPRLRIAATSLRNGVLFLLEGQETTLRIQLANCSVLPVDYVRLQFQDEQTTTTLAALSEGELLPTAAYDAEWDILHRPTFSVDPASLGPRGVRIPAGTTNTIRVQVRGKVGANLAQIHIDYGHVDGPGTEEARDFHTRRLTLPLRMEVRPVLDYGALAVLPAHAREADRLKTAVVTEKEGHEAEGSGGKKSA-----------------------VEELLGSDDQCLLSFRMRNVHSRSVMVSLEMKRDG--------------DLPPLRIRRQLAPATTSDFVFPQTRLPLSSEYEPVPSLNSA--RQYVVSRLKLTPAEENRARAKFWRTEEVYKRLSARWEIVMTSTAGEIRLRTKRVAPSSVDVLSGTGLDISLSVCDEDVDVSTGGTAKEGENGMITTSGSGTHVHVDDFVHVKATLKNRTSRALKLTCRFVPHPSAQDDLTAPRPST........................... 1488
42 0.000e+00UniRef50_A0A139HXE9 Uncharacterized protein n=2 Tax=Mycosphaerellaceae TaxID=93133 RepID=A0A139HXE9_9PEZI  ali  26  27.FSPVRPAHISVLVLGVGQITRHAFTQCLQRLQQEASVDLSQASIDPNPHAAFLLPRTDARGSLIYSYTPSVPSAQHAQLSPYELYREPFLVLGVVDG-----------------------RRNAIEHSAEELEGASAYLKERHPRVVHRQLVVLAENDEQ-DVSRISNAIVITHIDTPNHPSLRAAISLLSARFLVEFSTYALAVQASPTIQTPGQTARSLQRTTSLRDDERRARIGSGAGTPVSAAVSSPTDEPSSSPFVSKAPPHPATSFDHIPGAGPTSVTPRPDSRSSNQSKRAASQDRVSLQGFGSSTSQEKARVRGKARVGIVLGSIYMMAGHWSDALSILVEHTNKARSLGDHLWHAKGLEHLLVCMILLAWSGTEFQVPSICDPVAERTGSSTLAR-------STADARLAAEGMQRQIVRLSVVIPDLVRLILSLYRSGEGALE--LPFLVHSEAAVRVSRLLTLLIAAGGELTPAKLRPLILNSSNLQKSDDEETALTRQSSGVGRSKMLSRAVVPSNEDGLSTIDHIRTLAGIASSYAVLGFARKKAIVIKELVIRLTQALIQARKLGAAEVGIHPAASLSIESGAE-----TLLSIAEETGGINDLMSDISDIYGAALVP----------------------------ANRADPPSYIASKAFGNPALKRDLLRDLSGFCEASPDPYGVLSLTTSLLRIAGPSTAIGVPTDGITNLFTREDQMHLATVIHRTVAVSRHLGLTDVQAVYWDPFLVRKVELLQPAGQRAVIDKTKIHMADKLADQPLEPGNPFLYDPSASRPGTAAKFLLVQNEESECIITLQNPFDIPVDIESLELVTEGVELYSY-YMPTTLGPLRFQKVVLMVCPKSAGTTKISGCRVKMQGCYPQVFPIVASAWSATEPMTLKDLGLAARAPHNAVTKDLKEL-----------GIEPELISATVIDELPTLTLENTAQLQSGLMLLEGESRSLELVLRNTGKITAT--VFEATDTGDVLRRDDEHK---------------LKVRGLKHKRSKSFLPTTTVRPGDCISFRFRVEGRAGLSKTQANFYY-----SAADAAEAKHVRVVSAPVVMTVNAALQVHNLDITPGRDHDPNSLLVAFDIRNAWPKSVFYECFNKMAPRPQDTANAQEGQLSPGEIRRMHLDVHHNLDYEGDIDSVRRNFLDQLHVSWRVEE........................................................................................................................................................................................................................................ 1153
43 0.000e+00UniRef50_A0A081CMJ3 Hypercellular protein n=1 Tax=Pseudozyma antarctica TaxID=84753 RepID=A0A081CMJ3_PSEA2  ali  18 1886..SFIDHAKLRILLAPVGDIDEAEFAKWCDAVRSFETIRLADLPSSCAARQKAARHAALQTGEIHLSFVTSYDP-DHAFLAPFNMHRQVLGALGLATYSNNALNRHELEASPSALRELHPGALVHRVFGFDSGAKRPETVSPLNPAAVSTPKLPSSPDASGFSAHRDGGLIIFPAVRKDVRFYLKTLLAELVGNILDALDHIVTGLEGTPLIASRTASAPTSSANTASWLGKTGTAATGASLAAGMGAAASRASSLFGAFSSSSSSAAGSTTGDVGTGSSTPTSSSHPFDLASPGSKTASPTSESTRSKILAANANKKSAKRGSGRYAKVRADLHLLSGNLWDALEAYSSALRALAGGQDAVWFASALEGFSVARVLVSRMGGAVLEKAPCFDLPWSAANAXXXXXXXXXXXXGIPRPYAKQS--------WGEVAEAYTIALVIYAKTNDSPRDYTHPLIHASACTQYARFLLAVWASGGWNGECFDQLVYGGVPPPSNAMYLALTAVSGIARHDIAAAASSALTHSIIALK-PTDQITLLSTLTAIFGCIGFSRREAHLLRQLQSTIVALLVKAKRVNAQPPATASLPLQQHAHFDKDVAQTTFDSLGRGPEAVLVLAVQVCETYGIHVLSRASEGLRSAYASPALAGSESWKADPSVQAALLTPEELAQEAPYGWKEQQIALLKEAIATAELLTDYVGMAFFGAILLRDFH-------------ALLDADEQRDLIVGMQRAVQAARWAGAQDLSLKYWGPEPLCSLELLPLAADRLPHEHIWSDPAPKAEEGVAGLNNPMFMNLAAARTSAKARATAVQDEPIHVMATLQNEFATELHIDSVKLVADGAGFVAEESERISIPPLSFHTVRLTGTAKEVGTVAVRGVTLTLAGGEEHTFLLPVYDEDNVRERRKRAAEAEDRKTRLKECGLDARSAVIKQKDPNRKASANKWIEITVVGAQPLVAAYCGALPLGGLDMFEGESRLIQLELENVASLAVNYVRVAFRDDASEAAQQALADGELLPADVHEVEWDLVHQPALSRDSSDTRGDAVHIEAGASTTLPVRVTAKAGCTYAVISLEYAHLDRS-KGATTKVHVRMLEVAFRLTVHPVVVCRDLTIVPLRSGEADRLTREC-----------LASADAVPPHLRTFDVDAETPVPSTPVRLEGSEAETDEEYCLVSIEVSNVFREDVLVRFALNTGGLI---------------PLQLYRLLRAGTTTRIVLPHPRIELDATGQPIPSVWAGAGRQFIVSKLQLSAVEEAEMRATFWYRAALLQRLGGVWKTMRTERGGKVPLRGM--------------------VTGGLEMDAADREALQKPVVGITLAFGPKPVRAEAFVTVRATITNRVARTIQPIIRLVPTSPNDATHTDVQLASMVLADGTWTAPRGPIQPGEQVDVEWNV 3423
44 0.000e+00UniRef50_A0A0D1DTW6 Chromosome 12, whole genome shotgun sequence n=10 Tax=Ustilaginaceae TaxID=5268 RepID=A0A0D1DTW6_USTMA  ali  19  26..SFIDHAKLRILLAPVGGISEADFAKWCDYVRSFETIRLADLPSNCTARRRAAANSALQSGEIHLSFVTSYDP-DHSFLAPFNMHRQVLGALGLATYSNNAVQKQQLDASPSALRELHPGALVHRVFGFDSGAKRPETVRSASPLAKESEIEHLDPDASGFSAHRGGGLIIFPAVRKDVRFYLKTLLAELVASILDGLDQIVAGLQGTP-LETPRETLDGITPNKPSSSSSSALDSTATWLTKTSFAATGAASRASSLFTAFSSSTGGSRPSSAVGGGSHPFDLSSPTSVNSSPTSENTTRTKILAKSAKRVTSAAATGPIGTGRFAKVRADFHLLSGNLWDALEGYSTALNALAGGQDAVWFASALEGFSVTRVLVSRMGGTVLEKAPCFDLPWSXXXXXXXXXXXXXXXXXITRPYAKQS--------WGEIAEAYTIALVIYSKTNDSPRDYTHPLIHASACTQYARFLLAVWASAGWNGECFDQLVYGGVPPPSNAMYLGFTAASGIARHEIAAAASSALSHSIIALKS-TDQIALLSTLTSIFGCIGFSRREAHLLRHLQSTIVCMLEKAKRVNSRAPTTASLPILQHEHFGKQVAQTTYDSLGRGPEAVLVLAMQVCETYGIHVEVDPLRNIPSYHILWRSSGHRAPAAAANGDVVLMTPLEIANEAAFGWKEQQIALLKETIAIAELLADYVGMAFFGAILLRDFHT-------------LLDAHEQRDLMVGMQRAVQAARWAGAQDLALKYWGPEPLCSLELLPPTPERMPHERNAKQLFADRTEAAAGDNNPFFWNPNRSSASK-AKTIGVQKERIYVMATLQNPFAVELHIDSVKLVGEGAEFVAQEAESISIAPRCFQTVRLCGIAHTTGTVVLRGISLTLAGGEEQTFLLPQAAEQDDRATRLKVSGLDARASVIKQRAGAGTTEAKQTV--------GRWMQVTVVEAQPILAAYCNDLPLGGLDLFEGESRIIHVELHNLCTLDVNLVHVTFNDNVSDASKHALTEGELMPQDVYEIEWDLVHQPVLS-RTEAASTSWVHIEPGATSTIAIRVRGKIGCTRAVVAIEYGHVERDR--AQSTFWVRRLEIPVRMSVHPVLVCTRLTVAPLGADEATRLTTECVRSATVDKSARDGQTAVDELVDAVQTLVQTQENELECSLLSLHLSNVHREDVLLRLAVDTHQGEPLRIYRILRAGSSTRILVPQPRLDLDPGTGHAFGVCTHTEHASETVSGRDGMFL-----PIPSIWRESTRQFIVSKIQLDEQEDRQVRKNFWYRQALLGGLSATWIVLPCMYTGTACVGGDWADEAVHDAVRFGTVPLRGIVSGGGLVLDESSLANLAKDAVKVDVSLRDCIRAESFTLVSVTITNRLARRIDPIVRLIATAPTTTTDASL-LDNVIISDGTWTRTLPHRGSHSTYTWNV.. 1597
45 0.000e+00UniRef50_A0A2G5I406 Transport protein particle subunit n=2 Tax=Cercospora TaxID=29002 RepID=A0A2G5I406_CERBT  ali  26  4.FSPVAGAHIRALVLPVGSIERDRFLLFVHRLQREASIPLADVAPYAADDGHLLSPKSSKQGSLLYRFSPSAPSEQLLQLSPYELFREPLLVIGVVDGLTGDEDAQK-----------------------KELDGAAAYLKERHPRVVHRQLVVLQQEDSESTSSI-AKAVTVTDIDTFHHPSLRAAICDISARFLVEFTTYAKALQASPSIQTPGQTARSLQRSNSIREHDNRSNSG-MSSPADEGSPSRPPPKAPPLPATSFDQIPSANAMPTTRDRSDSRGSSQSGPAKAKGHNRNSSNDRIALQGFGSGASAEKSRARGKARVGIVLASIYMMAGRWSDALPMFVEHTSKARALSDHLWHAKGLENSMLCLLLLAWAGIEFQVPSICDPTTERAGSSTIARASIDARL-------AAEGMQRQIVRLSVALPDLCKLIVNLYRSHEGALE--LPTIVPAEATVRVSKLLATLGAARGELSPSRLQSIMVGHTGQIGGQDQKPIKIVQPSRMAIAELLAQA-QPSTDDPLPAADHVRLLSGIAAAYDMLGLERKKALTTKDLIARLTQALLQARKLGAAEMGIHPAAALSVESGSESILSSSGEMRGIND-----MIAELCAIYGAKILP----------------------------AIRQETPIFADIRSYGNDNLKRDLLKELAHFSEASPDPHGVLALTASLLRAAGPNSALDAGTSDIANAFSREEQMHYATVINRTVAVSKHLGLTDVHAVYWDPFLVRMVQILQPTGKRTVIDRTKLNMAQKAANQPIAPGNPLLYDPSASRPGTAAQFLLVANEPSECIITLQNPFDIPVDIESLELITEGAELASEH-QPTTLGPLRFQQVTLMVTPKSVGITKITGCYIKLQGCYPQVFPIVTTSWSAQAPLTVEDLQKQSHQGSDMESM---------EARLKSLGIEPGYVSATVIDDLPVLQLENTAALESGLMLLEGESRSIELILRNTSNITAT---VFEATDTADVLQRDDEHKLKL--------------RGIRHKRSKSFLPTTTVAPGECTTFKFRVEGKAGLSSTQANFYY-----QASNNLNGKHARVVSVPVIMTVNAALQVHNLEVLQPGQHDDPSALLVSFDIRNAWPKSVLYECFEKTARRLEWRRDDTEGPSQDIQDGQLAPGEIRRVYLTLQHDNSALENYEEDSELARTRFLEQLHVSWRVEEHS......................................................................................................................................................................................................................... 1138
46 0.000e+00UniRef50_A0A0F8D3L5 Trafficking protein particle complex II-specific subunit 120 n=1 Tax=Ceratocystis fimbriata f. sp. platani TaxID=88771 RepID=A0A0  ali  37  7...............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................NNEEMDAIVSRIRRQSAARLYGFPGVKLNMLRACINFCEALPDFQGVLKYSSDLLRTAGSGVAPGPRGDDASPMIPREEQTRLLTNISKTYELSRRLGVTDLAGEYWDEFLVRGVSLEPLPEAKAPVQHTKSIIPGVTVSRTSQDVNPFIYNPFLKADEKEAQQSLVAMEPATFKVTLQNPYDIEVNIENISLVGEGIKFESD-KEHVIIGSYRTHVARIVGIPQEGGTLRITGARIKVNGCRERVFPIIHDRWVPSPNVKIKAMGMQALQHAVE------------NESLGSPPLKPTPLELHVINEQPLVVLKSTTLPQSSIMILEGERKRFRVTLENTSKTAVNFILFSFDDSTQAPLRAALQNRDSTPSEMYEYELILMKKQVLRIHKQ--PDEKRHIAPRGKVTYEFEILGKPGLTSASIQIDYAYLGDNTDDIGPKFHTRRISLPITVTVNGSVEISRCDVMPLFGPIPAPLWEHVHYNSADGTP------------------PFLSSPSPPCDSVMAEGKTAPEDCCLLSLDLRNIWPSNMQVTIATRDGI-------------------CIDESVLPGNTTRVVLPIRRIHLENPHLAIPALNPNRNRQFVVSSSKVSPDFERNVREAFWYREHILDNIQATWRTSGPKHSGAVELRSIRLTARMIEAIKVEDVSIDISLEDENGKSTGNLMA------------------VDAFSQVRVRVTNRSPNPIFPLLRLVPALCHRPANMAMESTRKFAWNGVLQRRLPLLGANGSTEVVLG. 725
47 0.000e+00UniRef50_A0A194RN12 Protein brunelleschi n=2 Tax=Papilio machaon TaxID=76193 RepID=A0A194RN12_PAPMA  ali  13  13......HACLLVLVRGIGGV-LKNFNKLWERIQRVNNIKVTDSTGQVRD---------------IWVRYVRDYPVENNDWGDFQTHRRLLGLITLSKFTN--------------------------QIELNEVCRVHESLKVKYSNTLYSRAFMFGPGSNLKKPEQEPETYSVYEEKQTEDKS---------------------SLNYKPTNE--PGDSLSSNDSYAQSTSSSASYVVQEENFTIPSNFKTHAMFYGENEPVSDLEQNVADLINSLFWVVESKRLERSREKLDKVSLLLAPFEKRDFIGLDMDSRNNKK--RCMGRVTKNLADLTLQSGLVSESLTLYHSAAEILKAVNDWLWLAAAKEGHCAASAILIYPNLRSTMPLHRNASLQESSPNKTKPLSLFQPSVDSFRKYKLTSSPLRSSKTSSPINPPSELTPSSSDSVETSSRQSESDNADTESLASSSDIEYQSQKSYITMDIPSIPRQVNNQYLLNGEDTEACFKAARIAVEQNNSLLTSSFVIFINLTLSEQEKIQRFDTLAEIYKEIGFLRKAAFYQRLAATRQVSANNPNPDWQRCYYLMLHSFPGHMLSLDPGQVVQHQIGWPALQIQLLQEVVVASRRMGHPALATRHMTFLLQAMWPHLTRQE-----------------------LWWPALQIQLLQEVVVASRRMGHPALATRHMTFLLQAMWPHLTRQEHRDLAIQLQAVSAQCE-----GGPVPLVLETGEVIPPANLTHVPQCLSFSPKPLPPTRTPHSIKCKVQQGPFIFTPIHFGS---LERKSKKEEGKMEYLWVEDDICEVQMKLTNPLPFELKVSNMLLLTSGVVFESLP-ETIILPPDSPTIVNLHGTPKEVGELQILGYSTHTLGVKSNCRLKNLPLS-------NKFPTSYVIEVIPSLPTMLIETSLSLS---------------------GHLNVSGESNNVTNVSLYNGECTECTIKITNTSAVPIEYLDMAIQSNMDNQLQS----------------------KVFQWSNDDV-QSQLPILPNEVATIKLKLYAEADFGVGENLFPNSLTSNYPSRVGSPVPNAQLSLPTQSSVNRSFRSSNSQTTSWSAPLSVMPPSRGRQVEAQMILRYSGGAGKESHCRQSTLQFNLELLPSVSITHWDVLPAEIPTQLYLVLDVTNLTSEEMAFHYTSDK-----------------------HILIESKESRRVPVPLERCPFNVTPNKYNDEDTAE--------CKSTSTSSGSLSLELMCSEHITSNVSLRWQLLQSGLRGAASVRGITLSHAMMDIVRMSPLNWEVSVNKQCIKPQE-----------------ELNCTAGECLALGVSVQNLLSRPLHLCLSVQFYQDYNNGVLSYKLDNRIATAGNNKVVLSTLTETSKAFHECTV 1296
48 0.000e+00UniRef50_UPI000D8015A6 hypothetical protein n=1 Tax=Tilletiopsis washingtonensis TaxID=58919 RepID=UPI000D8015A6  ali  20  36..AFCAPAQVRILLVPAGAVLPDEFERWRRAVETFEVVKLVDLPPSKSGAKRMPSGSPLARGEVHLSFVTS-PLGSPPFLAPFSLSRQVLAVVGLGTSTADGRNRAALSRAPAALRAAYPAALAHRVLGFDIGAARPQTMDFSNLDLDGGDAGIARESSSGAATPISEGLVIFPSDMKDVRFYLRTLLPELVSAILDGLDATVAALEGTP-LETPRETLVPSLPLTNGAAAKEGSGSSSPLPHMQLQQSGGAASPSAAFTAHSFTPSSPAPSSATSRASAFFSSFSGPGTAGSSTASSSKKHARRVSVGTNGP--------LGLGRLTKVRADACLLAGDLWGALSNYESAMTTLAGGQDAVWYAGALEGWGVARVLVRRMGG----------LVEEKAPSLSLPGGSAKDKDKKAADKEPAIDLPYAHLPWGDVAEAYSTALVIYSKSAESPRDYTHPLLHAGCCLAYARFLLSIWASGGYNGEAFDQMIYGGIPPPSLATYTQHATATGVQRHEIAAAASAALTHSIAALKPP-DQIAVLSAAASIFGCIGFSRREAYLLRQMQAAMVALLARSTTETADPVAPVPRYIRGAVQLAATVCDEAYTINTEAEPAHIALASAVCETGGINADVPPVKRLPRQHVLARALQLEGISNGDEDEEAVVERSLLQDEAPFGWAEQQIGLLRDTIGVCEVMDDFVGVTHYAALLLRDFHW-------------LLSPDEQLRLARGLPRAVEAARHRGAKTLELQYWGPEPVCRIAVVPVARERIPEQRPALQLREDASEAAAKPNNPFVMA--TGKPTTKEAHTLVVDEEAVFELTLQNTFAISLECSSIVLETTGSAFEALELRDVSIPPRAMHTLRLSGIPRDTGKVTVRGCRITLDGCAARSFSIARATELDDRRVRIKAAGLEARPAFVAERRRAALLAGDAKPKRQSSNGVELLLECVVVPAQPLLAVEAATTSHGSLVLWDGEVTTLHLRLANIGRLPVDFLRLSFADNLADSARASLGEGELDAAEVHALETSLTRAPALAYARAPRDPL-HRIAPGETTTLEVSLRGKLGCTNMTLQLEYAHVDGPPTDETRDFYTRRHVVPLGVTVLPSVDCSGLEIRDAHPGEAVRLVAESMAQ-------------------LERGGGALPDGKADAEVIGKASEAQDGEACLLCFDMRNLQRGAVDVAFDVAQDE---------------GPALRVRRSLPGGGRARIVVPFARLHLSSLSAPIPTLSA---RQFVVSRVKLSAREEQAARARFWLRQELLRRLGTRWTERASGRRGEVPLAAFTLNDEQGGLVRLGGVDVSLAVGGAAPAVNGDAV------------HALDQAQVEEYTDVVGTITNRSDRPLQLLYRLIPLPSSSAAANDAMLSHVLVTSGSLSAPVAPLPPGETARCETG. 1525
49 0.000e+00UniRef50_J5QVP4 Uncharacterized protein n=2 Tax=Trichosporon asahii var. asahii TaxID=189963 RepID=J5QVP4_TRIAS  ali  20  9PLSPIALARLQILVVPVHSLSTPVFDYWSALFRNRQSLRGDEVASDARERFFPSASGANMSRHVHLSFPAQPPPKHLYPLSLLRMTAFPLVIIGVGLDDDGNDMDQNEKEAAWAQAFNRTLATFMPSTSAFPLVKRLMLVPPQLPMPGSSRNLISYAPLDGGDNFVADVLGETTANDKAAALESQSGMSTLSGTLLPSLSSTASASGASTPVVSSKAEARGSLPGSSSMPLMPSANMSQPVSRALTPGGRPASVQPPSAPPIQTSAISPVA-APQPQSANPFRRSTAGLTSPFHRSSATSSPSNKDSGKDAAMAKYTSAPLTGIGRLIKLLGDMYLVTGMYADALKCYEDGAERCRAVGDVLWEALAREGRAVAGIIEAWEGRDGSTLSTPFPSSPVPVEILSHYLSALACLSRAPLPFPEATPNGPAGAQTPHL-----------NLSNVGTGEGLLAWLYASMCLRISRXXXXXXXXXXXXXXXXXXXXSNTLPRTFPALLNNPNDPSEISRQTIFGHAQVAIGPF-RRAMTAADQLAVFVEVVWIARWLELERKEASATREIVKLLAMAVVEGREEHRDQQTGAVMSPTEMPGSSNQAVTIRRKESTDGNAGVMALIERVCAVFGIDLLSF----------------------TDEQTEPVLQAAKELRPTHFGWPELQVEIMKEAIAVSEALPDHPAAVRLCVSTLHSLYAYLSP-------------ASQGHLSKLYPKALSTMRRRAIEFGSVPWWLPRVVLSVEISSLASNRVPLEHTRAEI------TAQGKKDPFLYNPRVKAPE-LGKTLLVANEQVEVFVTLQNVFAFDLEVQNLSLLTAGAPFITNPL-PLILPASSVQTVRVTGLAPNAGSLEIRGVSVRLMDGSSAEFLLPVVDGAGARRDSKHRSRLQAQSGLDVRKSLMFTQSDGGLPPLPTKEDEHRWLECNVVEEQPLLWIKKTSLSHGTVMLFDGETSVIRITLENSSSVPVDFIKLSFDDSVSREAQAMMSE-EISPQQAFDLDYDCTQRPVFTWDK----NSNVHIPPGGRTTLQIEVLGKVGCTDGSIRIDYGFINREAEDPANVFYTRRITFPVLFTVYHTLEPHALDIACLRSSSESQEKLRKRLANGTPRSSTFGTSGDEVLRRA--------------------LAQDDDNMVLFCLNVRNVYSVPFEVALSSKRTASPSALNPDSESSSD----LVVTRLVPPGATERLVLPIQRQTLSDDERPIPTP---EGRQYVVEKSKMTPDQMKRQRELFWYREKLLDLIDISWREPSSLRRGRLSLRDQPINPAHLDALRRDQLSISLDVQPRDGKA---------------------SFTAMDFVDLRINIVNRLERKLRAYVRLEALPTSSNDASWSQPPKSIAFDGVLGAAMPVLEPGESATHTVG. 1426
50 0.000e+00UniRef50_A0A1E4SJB6 TRS120 targeting complex component n=1 Tax=Suhomyces tanzawaensis NRRL Y-17324 TaxID=984487 RepID=A0A1E4SJB6_9ASCO  ali  22  5.YSYVTPAKVKCLLVPINGCSQSNFDRYVDIIRSASEVRLLDITP--NTALHYFNPQTFPNGRIIFDFVTTAPDSESIFLHDFEPFRKTFIILGIGKYASQVDPQESIAQ-----------------------------LKKRYPSSIVHKLISFDPNPEHKHASDDQLSFFHDGSMDHNITAMETIMCDVSGHFLSALDNYASSY-----------------SNITLRSPVSITDSHTLTKTIHQAQKRLS-------------------------------SGSTSFKASFSSSNPNQPPTT---------DPKSKPQQRHIGRQSKLMGNLYLLAGKYNQALQLFTDSLVNLKKCEDFLWLGSALEGIGISCLLLQYVHLAYQLPSQTICSVLQISKSKNSNLSPRNSTSSNLSFNFGSSPDLSSLPLPTFIKLISSKVMHFYNLSTNDYENMVPDIVYVESILRTIKYMIGIYLSGNELDSSVIDHIIKATRIPEHAADKNH-----FLKADILAEIEKVFSLQLV-DMGITDQCRIYCSLASMYSDLRLYRKRALILRTLLVGILPKLEQ-----------HVLQTQSDLDEITTSINGLADRKDQTSS-IRDIFNYLFATYNINCESESYSEAAYDHSQ------------------------------GNWTALQILLIRLCLRISEILKDWSFILKLCTLLLTRFTHCL-------------TAEDQQKLKEKIDNLIYLSNRN-KLNLSTSYWDPFLVRRVKFITNRHKDELVSFLEYEQINKLPKSAPLTNGPIIFNPYTKQKPSNKDKLLIKDEIYQLKVQLQNTSTIKVNGLNNKLRSNSSMLKKPPANALVIPPTSLEQFLVTFRPLDDGDLTIIGFYITIDNCEEQFFKIIDKEILKQNF---KVKPLKSPENQNEIIEKVSRNLETSNIESRVDL---KSLSLTVIPPQPSLSLTHVLVTNGWIMLLEGEQIPFSISLTNHSNELINYLSFSFWDSTVDALNKKLNSNQLSASDIYEIEWHLLKFKPFKILNKDVISKKYEILPRSDITIDYEITAKRGIRELKIILEYAHKLADL----SKSFVKYVQVPINLSIMPSLEVVGCDILPL----------------------FSSSLHGFEGLKSEYTHQNLEEVLKFITSIIDSDTKDISDYCLLIIDLRNSWNEKLVSHLEYAIEKSV---------------TFEVEDLIEPGKTSRFLLPMKRISNEDLSKPIPSL---RNKQFVKNYS-LSEQDEMQMRELFWLRSVILENLKGTWRSVGDNRHGYTELRNIRLTNKMANILIHNPIRITSSIFSDTRPTE-----------PIKKVGTQYILNIEEFYFLRTTIINNSNVKIKGILRHLPFSLNTPNYSQMSLDRRILINGVLQNYLGEVNPGDRMDVDIS. 1354
51 0.000e+00UniRef50_W4KJL7 Uncharacterized protein n=5 Tax=Agaricomycetes TaxID=155619 RepID=W4KJL7_9HOMO  ali  23  17.................................................................................................................................................................................................................................................................................................................................SSHGRLYKVLGDFFLLAGRTEDASIWFKSSIALFKLPSDTVWHASALEGLAVLSVLDAWSSGQGLQASFSNS-----------------------------------REPWSDISERLSQAITLYSKAVPSSSSDILAYLYSTAVLRQTSLFFATWSAKGWGPLAFTAMLHPGPLPNTPANRDRLSSISGITASHISVILAQAHGPWL-LHMGHRERIIILEEIASMYSSLGYHRKEAYILREVIGCVMDLMVCGREEAGDIGLGYALANAASMMQDKGAVGVKENERPDGNESVLKLVKHVCNVHGVNLSVVKLID---------TGSITSDGPLETEASQNEDPEEVILEDPYGWPELQVGIVREALAVAEALPDSPAAAQFALSALKSLH-------------AVLSEEDQYHFYYTSARALTTARRRGD-KRVIDYWSGRPVDSIEILPLPPVKLLVENPMSILSPRQSHGVSIMTDPFLYNPR-RAFASQGQTLVVKNEILELRLTLRNPYVFNLEIEALALSTSGVPFESKPIS-VVIPANSFHSITMSGKPLDTGILTIRGCFVQAPGGASHEFVLPLSTLEEEDKKSRRRSGRSKYHGLESRPWEKAGKRLSIQKKGTKASTELRRFDCKVVPEQPLLRIRWSSLTHGAVMLYDGETSTIRLTLENVSSLPIDFLRLTFDDSTIPPAQQALVDGELSVFDTYETEYELISRPVFSWS---SDLQQTKIPPHRKVTIVITCLGKVGCTSGAIHVAYGYVHRKQDTPSDVFHTRRLSYPVLVTVYHMLECHRMDILPFRPQAVFNSNDDQGDNN-------------------------------SDTARKKLLCVDEDSWCLFSIDVRNTYGLPFEVTFDRIQEGSLHASTTC---------------LVAPGSTSRIVLPLKKFLLPDDIASQPIPTL-SDRQFVVAKSNLTSGEEVAQRELFWYREELFKCVRGRWREAGGTRSGELSLRQQRMSLPMLENLRTESARVSMCLVCRDNALDDPWQT-------VDQKDSKFLPKAYDFVYLQIKVTNLSLSPLVLTVDVLA-----------DPSDHVIQEGVLDIPLGNLDSGESREIE... 1038
52 0.000e+00UniRef50_K2R9Q6 Transport protein Trs120 n=1 Tax=Macrophomina phaseolina (strain MS6) TaxID=1126212 RepID=K2R9Q6_MACPH  ali  26  5PFSPIAPARIRVLLVPAGKIKRSRFMTFVERLQPESAIRLGDVTPDPRPDRTMFSPLRNPHGMLLYYFTTSMPPASYISLSPFELFREPLMVLGIADGEEYQEALDSESANAAEDKTNV-------ALKREELNEVVDVMREEYPRAIVHKLLLFDSGLPSLPGWLPEETMLVPPLSESTMTTMKTVMCDLSSLLLAEMTGLAKSLQALPEISISAGAASPNPGNRSPFSLVRQSSFGFGAAENSLSRTASPASLGLRLSPPAENPSRAITPPELSPGEDPSSGRSGETTPTDSAPSRPRALQRFSIQGFGSGSMEEKARLSNACRHDLVDAQVCLMAGHVVEGLKRSHETFLKAELCNEHLVMAKALEQMLICCLILVGHEQEFEIPTSCTPATKGMPVSGTIA------------------------NVLEWIPELTSRIMGFYRLSFKSDSGHLLTLVDAENKIRVSNLLTAIERLGKKFTPQEFLEKVESQSEDNLP----PVKGISGRVVHISNILSEAIDSATQSATTDTERATIYSEAAGCLAKLGLSRKRAFVVTLLMDILVPALLQARKLGAAEMGIHPAAG----MLSGGLVQPTDKKYGET---VFIFLEQFVREYGVQPRTRLEAQVDGSSEH---------------------------LRAYGSLVLKAEVLRRCINVCEAMADLQGVLDFSSSFLSIIAPQEPLEETDPGFRCLMPREDQHRLVQNIHRSLEAAKAVGMEQTEATFWYDHLVHSVKYDPDRAGRDLTLRKNVSAD----DSQQRVSARFEHQAFGDKNKGSAVVPLVAGEPSEFIVTLRNPFAFPLDIESIKLVSKGVEIACPPNLTYQIPPCAVQPLRVPVVATVPDVHELVKLRVKVRQCRERDFDVSVSRTTIQEVEKMKEMGHSVAKAKRKKEASRPGTATTIRP---VSRGMPVLPSVTVVPQQPSLTIK-TNLVQDTLSLLEGETKSFKVTVEKDKHIKANILHM-LGRNNTVDVLRVSRRSSNLPAQIYELGQDIGR----AEWKSRDFNPSSELAPNKTMTFTVDVFGVPGLNKGTVGVEYAAADQPP-EIGDYWVTSRVSQEIAVTVQPSVTASHFSILP--------------------------------------------GREAGEHIEAKFPNANLDNHFVLVFDFLNISDRELSVEAWYDD---------ASMPRQPVLELTSRSDFLKPRQASSMAVLLPKIYLSYSNDAIPA---AQDRQFVLTDTHQLSREE---RMCFWYRQKLLQCLQCRWRDRSGTRHGLVNCAALELTPEMVGFI-MSILSISMSVPNALRSDPAFEDPDVAASTLILNADAHYLLQRGATASVRVELRNTSAAAYTFT--VAPVVRVAAPHLDPDDSIR.......................... 1310
53 0.000e+00UniRef50_A0A1S8BDA9 Transport protein particle subunit n=2 Tax=Diplodia TaxID=66735 RepID=A0A1S8BDA9_9PEZI  ali  26  5PFSPIAPARIRVLLVPAGKIKRSRFMTCVERLQPESAVRLGDVTPDPRPDRSMFSPLRNPEGTVLYYFTTSMPPASYISLSPFELCREPLMVLGVADGEEYQEALDSEGANAAADKT-------NTALKREELNEVVDVMREEYPRAVVHKLLLFDCGLPSLPPWLPEETILVPPQSESTSTTMKTVMCDLSSLLLAEMTGLSKSLQALPEISIASGPSSPVPPKSPFSLVRQSSFGFGVAENSVSRASSPAQPVQIQQGSLGLRLSPPAENLRAITPPELSPADDRSGETTPTDSMPARPRQRFSIQGFGSGSMEEKARLSNACRHDLVDAQVCLMAGFVAEGLKKAHETYLKAENVSEHLVMGKALEQMLICALILVGHEQEFEVSHTPTFMAPVNYIPTTCTPSTKGMPVSGT-----------LANIIEYTPEIISRVMSFYRLSFKSDSGHLLTLVDAENKIRMSNLLTAIERLGKTFTPKEFLAKVESQSENSSP----PVKGSSSRIVYISNILSDAIDSSSSATITDTERATVYAEAAGCLAKLGLSRKRAFVVTLLMDILVPALLQARKLGAAEMGIHPAAG----MLAGGLVQPTDRKYGET---VFIFLEQFVREYGVPARSRLEPKVDGVSET---------------------------LRAYGSIVLKAEVLRRCINVCEAMADLQGVLDFSSSFLSIIAPQEPLEETDPGFRCLMPREDQHRLVQNIHRSLEAAKAVGMEQTEALFWYDHLVHSVKYDSERAGRDLTLRKNTNDDPLQRTSAR-----FEHQAFGDRNKGSAVVPLVAGEPSEFIVTLRNPFAFSLDIESIKLVTKGVEIACPPNLTYQIPPCAVQPLRVPVVATVPDVHDLVKLRVKVRQCRERDFDVSISRTTIQEVEKMKEVGHSVAKSKKTKEGSRPGTATTIRP---VSRGQPVLPSVTVVPQQPSLAIR-TNLIQDTISLLEGETKTFKATVHDEKDKPIKKILHMLGRNNTVDVLRVSRRSSNLPSQIYELGQDIGR----AEWKSRDFKPSSQLDSHKTITFTVDVFGVRGLNKGIVGVEYAAADKPP-ELGDYLVTSRVSQEIAVTVQPSITASHFSVLP--------------------------------------------GREASEHIAAKFPQVDLNEHFVLIFDFLNVSDRELGVEAWYDEAAVVPTSPTRQLPPSSEHPLTSRSDYLKPGQASSMAVLVPKIHLPYSNDAIPA---AQDRQFVLTDTQPLSRED---RMCFWYRQKLLQNLRCRWRDRSGARQGIVNCAALRLTSETVGYI-MSILSISMSLPPELRVPDTTNMDHPSSSSSSHFPRPLYTLRRGDTAKVTATLVNTSPDTAH-SFTVAPVVRVRGGSPLLDPDDSV......................... 1318
54 0.000e+00UniRef50_A0A161HFL9 Trs120p n=1 Tax=Sugiyamaella lignohabitans TaxID=796027 RepID=A0A161HFL9_9ASCO  ali  24  1....................................................MFSPQGYPNGKVVYDFSLSQNDEQYYSMYDLEPYRQTFAVFALTSYKEFCGESGHG----------------------QWLEEALKRLRNQYPAAIMHKIFVFGVPKEGVLEIESKHIFGILSSASKLSTSLETAMCDVTSDFLAELAVYVISRQKSPSIKGLDAPPGVSNRNVSGRGGPLRSDAEGSPGAKGISSGGSGQATPTNTSPTPPPTSTAHDKPYNVSIHKSFSRQISPSISSNLSGTTMSNASSYSNSGSISLGLSDRTKSKQHGRMIKFLGNMYLLAGRLSDALKEFTEAATILKTAYDHLWYGSALEGIGICLVLQSFLEVPVTIPTVRNESTSSINGTPPPTSPSPSPEGPTMPAPLRTSGSDEPPRLNDFLPDLTDAVIRFYNRTPTSSEDTIPQIVYCETILRFAKLLVMSRQGGGWNG-AVLSAIVRGTPLQLNITSDSPSAAS------VAAWCNKIYSTGI-ANLPIPLQVRLYSGLASLYSGVGLHRKRAFVLREMVLRMVG------------------------NPIAAETGVLQMLDRSQKGGIIEFLDSVCRVF---------------------------------------SAGEVTSIGSGWLELRLSFLKSCISICESISHYQGVVYFISLLFSTMADSL-------------DRDEQLRLFSSLHRAVELSRKSERGPVYGQYWDPYMLRDIKVLPPT---TVMPTRFTRRRSESKSVESQNSEVFLYNPYSKSKD-VSERVLVQGERVEFSLKIQNPFEFEVHVNEITLLTKNVELIDAKLGNVFIPGSSVHDLFIVTSPKTPGELIITGCKIEVSGCHPEEYQLSNQG-LPRLEVKLKTHGIN-------SGIKRGDIDETRNTVNNNSLVTVRELKLAVLPSQPLLLPKNQSLEQTWVMVLEGEKKNFTISLSNQSNTNCKLVNFGFVDSTTEPLQATLADKDLPLNEVYECEYFLYKRRALQILNS------PGIGPHETGEYDFQVSGKRGLTSAVINLDYGVMDSDESEKSETTWVRRITVPVNVTVNPSIELSACDIIPLTEYRSSEHPLTRIDGLLQPLEP-------------------------------------NSRYFILVLDLRNAWSQAMNVKIWSK--------------SADNKRLSEVTQLIYPSRTSRFLLPIKWEPSDSEFYPQKPIPTMSRKQYVVDQ-NLTPEQVKLMTETFWYREQLLSYLGGEWEVDGSTRTGSVELRGIRLSRWMVTTLRTELVKVSMNMFSSSSSIAQVNELTWQVDVDDDQLVVRS------------TIFNGSDVPISGILRLVPSLRYGNEGPADEIHKKIIYNGVLQRPVLQIMPGQSVDVDLGI 1264
55 0.000e+00UniRef50_A0A1X2G9L7 Trs120-domain-containing protein n=1 Tax=Hesseltinella vesiculosa TaxID=101127 RepID=A0A1X2G9L7_9FUNG  ali  20  7...LTSACRIPILVVPILPIKHSVFTRYLHILQQLSVVRLKDITPDEHPDHALFSSQSFQEGVLRFKLVTHYSS-NNQPFAEIQPHRRLFGVIGIMDCQEWKG------------------------RSLANGYEQFTSYMQEFPQPMVTRCFAFDPMDSQTDD--TKGVIMIPNV-GDTQFYLGTMLNDFSSEILNLFGTLV-----------------------------------------NTANAAQSTTGYTNHATSSSTTAGSGTPPPTAHTLLPTELTRSATPPPLQPNP-------------CGVGDLSKNKKQAPGRIKKIHADYYLLAGSLPDAIRTYKQAMDMTKITSDYLWLASAMEGYVCTTLLMEQLRLESRAAASRQASAISTSNEQAPEPMEAIEPWMTVLDILETYNGVVFHYAKEQQRAKPTESL-HEEFDCAIPPSFVPSVLHAEACLKVARFLLTVYHHGRWDRQTIASLIVYASPTAESPSPMLVDPPPYPLPASVSAMGTEARRDAYFDRWPASAQVHIMGHMIRVLSGIGYRRKAAWVTYECLRRLVPFILNGQFGGAHLAGSHL--------------------GSVKISSLLLTLQNLCNVYGAGSSVGPLGLLDPFQQHDPM----------LDQASESFSTGEGTPAAFGWSALQLTILRQCITISEALQEYKQVVMYAALSMKNYYS-------------LIAKDEQMRLATLIHRLVRLKKYNDDELPTINYWGVNLVSRIQVMPPISRRAVQRHPMERQALYQSLTANLGPDPFIYNPYASKDTVSEDTWIVKNEVVDFQVSVTNPFGFELEMQSFRLSTSGVAFTSSPTS-ALLQGGKSTVLTVSGEPKEAGILLVHGCHIKILGFAEQEFTIDCPPPIELQASRMKSSGLAVR----------------SKSCIEHRSSGIEPYKLTVIDEQPMLKCKSTSLIQDAAMLMEGEQKCITLTLENIGCVSVDYIRISATDDATLPF----ASIDISPTQMYDLE-KATLMKVFEWVDHDHQGKLVSVPPKTDLPMDVFVHGKSGCMHGTIEVEYGHLGTNGQSPSTPFYTRTLTIPLLISVYQPLQPYDWDLVSIRTPGRKEADPDHQLPHGHIDLEQLCSTL-----------------------------RSRADFCLGLLDIKNQWSCSFRVTFTIDNSLPGDTATTSN----------IVSRTIEPWATNRVLLPLRRISLDEGTTAQEIPITSTQKLFTTEEGK-DAQQQRLDLQLFWYREHLLERIQAIWTT-DDGRHGTLDLRCLRLSYLQLQILKQPDIAFEVNIKGA-----------------TALDQRQFACQANEALIMNIKIRNQYFKPMTLILRIQPVLVATEHQNQVD-NTMVFIEGLTQLVLPTIGHGDYAEHSVPI 1314
56 0.000e+00UniRef50_A0A061H3D7 Uncharacterized protein n=1 Tax=Anthracocystis flocculosa PF-1 TaxID=1277687 RepID=A0A061H3D7_9BASI  ali  20  24..SFVDAAKIRILLTPVGDVSPADFARWSQHVRNFDIVRLKHLPGAAARKWPAHDSPLRQVGEVHLSFVTSTDP-SHSFLAPFNLNRQVLGVLGLSTFGPGSD-TDALERTPGALRELHPGAIVHRVFGFDNGATRPQTMRGGMPRSVSANSIASESSEGGFSGRNAGGLVIFPADAKDVNFYLRTLVAELVASILDGLDGIVSALEGTPGIVSPTRSSASSALQAVTSPTASSFGTAASTAASRASALXXXXXXXXXXXXXPTTSVGASSMGTGGGTITPSSSSTASRPVSTTPSSLNDAKRRTILSPVSTGKKGRKTSPTGTGRFAKVRADFHLLAGDLWTALEGYEASLNFLAGGQDAVWYASALEGWAVAKVLVSRMGGEV---LEKAPAFDLPAGVAAAASANSGKDKDRDKDKDARDAAPYAKQAWGEIAEAYSLALAIYSKTNETPRDFTHPLIHAGACIQYSRFLLAVWASAGWNGECFDQLLYGGVPPPSQGTFTRMSALSGVQRHDIASAASSALTQSVAALK-ATDQITVLCTLTSLFGCIGFSRREAYLLRQLQAVIVSLLAKSMLQRSRQPTTTTLPLLCDAADDELVSQVSHETLRSGPEAILVLAMQVCETHGVPGSARMDGASSDLWGAAAARGAAQLGSTSGTDATPSRLELESEAR-FGWPEQQVALLKDTIAVAEMLGDNIGMAFFAAILLRDYH-------------ALLSPDEQWRVHDGLVRVTASARWQGAQDLQVRYWGPEPLCSLQFVPLQGHRLPTERALKDLDASPSEGVAGLDNPFFWNPGASRTGGKDSVMAVAGEPLEVMATLQNPFAFDLEVETIRLVTEGVGFEAAPT-RTVMPAGAFHTIRLSGTAEASGMLRIKGIALALAGCSEETFLLPIYDEQSERERRIKNVGLDARPAVVKHREAEGGDKAKRRTASNRPQAEPRYLECRVAPPQPLLRVECAALRYGTLHLFEGERKTLRLRITNTSSVAVDYVKLSFSDNLSETAKQVLLEGDLLPSDAHELEWDLLHRPVLQVXXXXXXQHRLHIPPGQAATLDVDVLGKLDCSAGRITVEYASLSAKQPGLGDKFYTRSLTLPLNITVQPLLECGPIEVRPLRASTAQSLALAEPGASVPAGSGSGSGRSLDTAVAGPEAGADLENAVRESKQVDASVAADPDGFCLLSMDVRNVFSEAVAVKFALN---------------TGGLKKLDVERTLAPQTTSRFVFPFPRLWLASARQAIPTL---SRRQFIVSKLVLSPRDERQARRRFWYRQELLGRFRAEWTVLRGKRVGEIGLRDQVLSDVDVAALQREGVKVEAATPGQPGSPNGDDAGRQEDKTKTRTGRREVMVQRETTVTIRATVHNQSDRPLKLLIRFVAVPSSSSCSLESKVER........................... 1615
57 0.000e+00UniRef50_A0A1Y2FNL0 TRAPP II complex n=1 Tax=Protomyces lactucaedebilis TaxID=56484 RepID=A0A1Y2FNL0_9ASCO  ali  29  8PLSYVAPARIRVLVRPWLPIKRAAFDSFLTQLRAVNEVRLSDVPTGPAAELGTFNASSYPSGRIIFDFCTTV-DKDHDHLESFEYYRRIFVILLVADGQEGDVDAQKCEV-------------------------KLKELQKQAPTAILSRTWVFNANPQQEASALT------FIPENAHIHQLRENMSDLVASVLVRFNVLTGELRQRSTITSPF-------------------------------------------DPASSLLKTSTSNLSASALSDMRITPSSSPGPDRNPRFTLA-----------TSALTERGKMQGQGRIAKTSGDLFKMCGFFAEAIKWYAEAAAISKANSDHLWYAAALEGLGQCCVLMCYAELTPQIPSVAMNAIQRAASKDHKES--------AKIDIEPAPTPKKDVDFIDFIPDLHSAILNLYQRSTAFPQDTVPPLCMAESALRLAKFLAAVHLAGGF-NKHALAHIVLGRPIPP------LTIGAYPPRAEITAWAMRAYSGSIDSLN-LADKCYVLGGLAAIHGSVGFRRRRAFFLREIVLCLTPALVQARVTGAAGLGIHPAAGLA----MADNNIATLMAQMGKQTSLHALLDDLCASYDIPN------------------------------AKDAQSIQYHALTGAGWRSLQTTVLKDCTAMCEAIPDFRGVQRFTTRVLETTATELG-------------REDQVKLVSNLPRIAGVAKKYGALDMDLDYWDPYLLRDCKLCASILP-VPTKRDASAL-------TQAQNPFFLYNPYAKHDEVPDSNVIVQHEPAEFEITLQNPYHFDVEAISLSLVTEGVAFEGSPATCFIY-AKSIQTVRLTGFAREPGSLVVKGCRIKMFGCRETFFPNIVPPSRQDVERWYQAHGGLDRLKPTCSLI--------KNTKQEALLGEQRTKTLDVIPAQARLCYRGSSLGQDTLSLLEGEHTSFQITLENDSETAAHGITLTFMDSTTLALQSAIKARGKAPHELHELETFLYDRVAFSHTAKD----DCQILGGGKRVFDIDVVGKRGLSNVEVVVEYA-----SGTGSEALYTRQLRIPLKANVSGVIDITRADILPFNMLDQQVNV-------------------------------SNQSSAQVQTLFAKLRAGHAGDFCLLLINIRNLHSQSLLTTMTMNMGEDNEPYVVAASLNAG-------------GATSLLLPLQRLYLDDASTKPIPS---RSKRQFVVS-SVPDSEQEALSRQVFWYREALLAKLSASWTETEQPRTGTVELRAISMSPRMMRALSLSPLRCRLSIID--------------------------SLMTDTFGKLRVTIINETSASYVVLLR............................................. 1176
58 0.000e+00UniRef50_M5BN77 Transport protein particle subunit trs120 Short=TRAPP subunit trs120 n=5 Tax=Rhizoctonia solani TaxID=456999 RepID=M5BN77_THACB  ali  20  6...FATLGHVRVLLVPVGPIRKPTFDKWAALIRSFENIRLDDIPPDPREERARFMPSTLSTGYIHLSYPTHPPPEYYGSLSLFRPSVFPLAVIGIADCSYQPPLPKDGEGSQEPLSLSGILAEFNARL------SQLFSSRAAYP--LASRCFAFEPPNGQNSESAGPGLVIIPSEIGHKRFYLGTLLAELCGAVLGEFGSLASFLETPAGLDALSTGLFPTLGVAEETPAPGLTFGSHGMVSNGPISRSHSDPHYGMASTLA----------------------------------PRPTPKRQSTVGVGSVSRKKGGTAPPTGRFGKVMGDFYLLSGKLTDAMAWYNEAISMFKSPIDYAWHASALEGFATAIILDAWAQGDGLNTSMAASNMREPWADVLDRLSQAVGLYWKCNPTTQLSDTAP---------------------VTADSEYSLLSLLYTEAALRASTLLFAIWSAKGWGPVAFGTLVRGGIPPIFANLASEGANAKSDGPIDPTKNLGPTLSHLSDRPTAPLAPLLRMSTITQIS--------RAQIANVAGQAHGPWLQHLQPRDRLRALTQLATLYACL------------GFRRKEVYILRELLACIVDLVICAREETGTKVSTGRMSMIADPNESRGGGWPGPGANQTGEISENTGEIGVRIAEESILRIVKYICEIYGIDVSRVEVGTDVADTGKDGGGVDDDIELDSPRFGWREQVGVVREAVQIAEALPGMLVGTRLLTVIKF-----VEVVPLASDRMPVERPWKDLVPSEADSAKDGATWYSFNPRARRRGNTKA-TIVQNEIVEFAVTLQNPFAFDLEVQSLSLSTTGAPIQTAPVS-LLIPANSFHIKHISCTPLEAGTLVVRGCMVQLPNSTPKEFALPLASETQEASVEKRRTKLLDDMVRVKASGLDARRRSTLMSEPPTQERKEEFLECRVVPQLPLLRVRRTSLTQGALMLYAGECFRIRLTVENVSLLPIDFLRMSFEDSTLPALQQALAEGELTIAEAYETEYELVNKPVLKWDLDGIDASNMTLAPRQKMAVWVTCFGKEGCTNATMRLHYSLARRDQVPSPESFFLRSLYYPLLVTVYHTLECHAMDIVPYGGGLTSDDSPKLW--------------------------------------------------CLFMIDVRNLYGQPFEVTFERTQQGTESAST---------------TRLVAPGATSRITIPVRRLSLEQASRDVPTL---SDRQFVVSKVGFTAIQQ----ELFWYRETLFDIVKGRWSEPGTGRTGEVSLRQQRLTLPMLETLRLEDITVQLSMVPDNPEGGIE---------IKVSGVNTYRVPLNEFVHLRTEVHNLTTRDVPLILDI............................................ 1259
59 0.000e+00UniRef50_A0A1Y1V5M1 Trs120-domain-containing protein n=4 Tax=Neocallimastigaceae TaxID=29007 RepID=A0A1Y1V5M1_9FUNG  ali  17  15...YLDPARIKIAIVPVGKIKKKSFKKFIEIISEKDILELKDI-PFIQQENGVVNSKKPENGKVLLKYVTSHN-IEHGRYEDIQPFRRIFGVIGIIDCEQQQDIQKEYQKFK-------------------------KLISKKFSTILSRVCFAHNPTEEQKAELLAIEPVQFFTDDESFKKKFNEVLVQLISNIITRFDTLITDIKRLQIIHSPKPN-------------------------NPTAKDQKDYVTNPIPNNITIKKEPSNFPILPPSVYVSGTAREISQNSQTVETASPTVLTNPSLQNVVGMLADSRARKLTASRSQKLSSDLLLLAGRVSDAVKNYSTIIETMKSNNDSLWQAVCLESYQCALFLEA-LQNNKDTTIKIQKKDNSTETQDLKFDTLTSYEHFKKTGLTVYHTNIKLKTLICELPERTREAISLYDKVSNTEDKPAYPFLAITSCLRIAKLLSIMHNIHLNSSFLSGASIQLNSSKSPTLNIDNNVNIVGVSKIAVASWLNRAWHGGLQFL-SENLKIDICASISAIYGSIGMLRKHAFFLHQTDLMTVTYIRNLTQKNLTKSTTSPPLSPVSPAHPRTNSITTIDGISDDDDENNELMERVCEIIGIPLLVPYKDDLVWEMRKDVLKKKEALKWNDRQSSQNYKGKPNFEELQYGWPELQIFMMKQCLEMSLISEDFQKTISFSGRLLRRLHSYLIPSRQKEIADLLCYVLQRRQIELLHQQKIESSKRQENQNHYSKLSSLIILDSIDINEYLPKRIPYPYHKYKNEEIEDEASPFIYSPFVLNNMLSRSGVNEKMLMVANEPVEFIITFTNTYSFDIEIEGLTIKTYGVKVKSVPVSVIIPAFTKYYQIKVFATPLEAGTLRIRGCQVKMFGGSIEEILVPPSLNNENNRIEIRLLGKSSLEYYKKYKIREMMIKEGQEIKEISKPNKSWEKSFKVLEEQALLQVKEVSLTQAAIMLFEGEISKFTIKLENIGTVPITYMKLTINEQYGDRRNS--NMIYEFADVLYEKEIYEKGKKTFWLNKSDTELIPINLLPNQQCEIVIGTYGNILCSSGSMCIKYGNVNLDDQDDEDPYYYRQIDIPIMITVQRGLTTLNADMLVFNGNSEADTLRNFRNRKKQITEEEESGNKNLADQNDPYISNSLEELLEMVQFEQKI---NFNKYCLLTFELNNLWNIPFEIKFLIDEEKNS--------------DSIEINVLIDANSTKRIFLPILRYNLPESVLSQEIPTPNRQ-QIAFKVIKLVEHEEKIRREQFWFKEDLFGKIRATWNCSRI-RNGELSLRSLKLTSSMLNILKVKDITFDVCL-------QSLKSTKEGAIISSGQDGDEISCKKREMVGLKWSIHNHLDVPKKICIRIEPVQDFDNGLLDYHLQGRMAWSGSLQKVLEEIPANSSIDYILPV 1442
60 0.000e+00UniRef50_A0A0H2RFS4 Trs120-domain-containing protein n=1 Tax=Schizopora paradoxa TaxID=27342 RepID=A0A0H2RFS4_9HOMO  ali  21  6...FASLAQIQILLIPIGSISRTTFNSWAQTIRTFNEIRLSDVQGDSKDDAHRFMPKPLESGFLLLNYPSHPPPQSRFSLGIFRPSSFPLGVICVASGSQPDSISSIYAEYTTVLSELFPEGTV---------------------FPFARNCFVFEEGDGSTNFNMGPGLTIIPSMMGNKDLYVGTLISELCSNILGGFSSFVSVLETVPGNQALNAGMLASMPNFVAARRVAEVNEGLPALNAQHSYPGLSPSSNEPLDVSRIPLKRTSTTGPGNALPSSRSSLGITTAKKRQSTLPPTTS---------------------HARLYKVLGDLFLLAGKLMDATIWYNEAVALLKQPNDVLWHASALEGIATANIIEIWTSLQTSSESSL------------------------------------PDSAWATIAEKVLQATSLYSKAAASVDGGDLSFLYVSAVLRHSVLLYRTSLSNGLNSFALNSL-----------DTQAENSSGLPLRSDISASLSQAHGPWI-LHLGPREKIDVLRFIASLYESLLYRRKEAYILRELVSCLMDLFVHGREESRSASLVSSRTSLDGSGERGDREGEVGVREADDVTGNSSIIEIVKYACKVHGVDLGCVQFSDNSGHP----------PGRSLSSSSRSRKSISNCHFGWPELQIGLVREALAIAEGLPDYPSVVLFALSALRDQ-------------EGFVDGDDQYHFHVTASRALATLRRRGDERKLKYWAGNDIVSSIQLMPPSAMRTVIERPWRELKSDQAPSSVQLSSSKRSSTSNSHVEVYKQRIVVQNESVEFAITLTNTFSFALEITHLALWTTGVPFH-QDGCPLTIQGHSSQTITLSGKATESGNLIVRGCVVHLLGAEPCEISVPLLTEDEEHDRLNSLIAAENEQRPKVLDLNHRLYSSRDRSSTVPNADASRHLELKVVPDQPLLRIRRTTLTNGSVMLYDGETATVRVTLENISGVAVDFFDLSFDDTTKAMEEMALADGQLNVFDAYETEHSLVERPVLSWDRQAHRQKVL---PGKEMTVEVKCFGKAGCARGLVEASYAHTESQDEPPPSAFYVRQLPLPLLISVYEMLECHGMDVLPVSSLVVEDIEDNVGDSAHGGEWRS------------------------------LLARHDKSEWCILALDVRNTYGLAFEVRLTCDEV--------------------TTCRVVPPGLTYRLMLPIKRFSLTNEVTSSPIPSL-TGRQYVVTS-----EDSSVHRELFWYREELFKRVHVTWREAVGPRKGELSLRKQRFTTSMLSVLRHEQVTVELSVRHGDQPNGVYQSVP-------------HCVKPNQFVSLEAHIQNRSSTSLALRLSLEA-----------EPSDYVLHEGVLNVPFGNIDPGSSKTVIVP. 1260
61 0.000e+00UniRef50_C4YCF2 Uncharacterized protein n=2 Tax=Clavispora lusitaniae TaxID=36911 RepID=C4YCF2_CLAL4  ali  22  43.FAFSAPARTKVLVVPVGAIGAGAFSRRFDLLRQCNDIRLLDVAPLP---SCHFNPQSFPQGRVLYQFCT-QPDDETAFLHDFEPFRKTLLVVGLG-----------------------------AETGPEDAAKELKTLAENYPTAIVHNCIFFGSSSSE-DPSAPAQHFYVSPEAERSVTGVETVMCAITRNYLQALDAYAASFATITL-------------------------------RSPVSLTDGHVLTRSITYAQKRLSSGSGTSAFSVFAAPPV------------------------------ADSKLRSSQKQSGRQAKLMGNFFLLAGRCADALQYFTDAAVNCKKTEDYLWLASALEGLAVAASLLSFLGMPYHVQNPMLSAVLNVPKSRLAPPQQSRLSSESVARASTTASPRNSVSLPAFLRLLCTKASQYYQLSTSEVEDCVPDLVYVESLIRSAKFLVAVHLGGGESLQALLDYLVKSVPVKRLPIPDSAS----VSRQDIIHELDKLFSLQLVDLE-FTEQCRVYCALASIYADLGLHRKQAFVLRILLVLLLPKLSHMEQNGA-------------------------IAGITSVAAISNILELLFSVYKINCEPESSAVSAKENASN-------------------------------WVSLQLQLLKICLRIAEALKDFHMLAKLCILVFARYSHCLPAQEQVKMRDKL--------------KWLTLLFNEDPESVPLPHPDPFLVRDATFVSTSACSALQPFVDK-------GGSSVQNGPVIFNPYNKKPSPTTEPVICVNDLHQMKVSLQNPFKFTVELSEIELVADSMDQFSGHSNSVILPPTSTTQVLVSFKALQAGVLTVKGFNIRV-GAAPPQFFQIVEREKFSGFQKTKH---NCIKHSEEGVPALDKLLDNLRNGRIEDRVATKKISLNVISAQPSLSVTKNSVTNGWLMLLEGEKKKFTLELRNTSDVTIDYLSFSFWDSYSETITAKLNQTQYTVEDVYELEWSLIKKKPFCINKQEIASQYKYIQPGGDVKIDYEVTGKKGMSELKLILEYGNKKTDASTIPDVSYMKSVNVPLEVSVEPSLEIIGFDVLPFFSSSLYGYTSKNGDMSNDIVEK------------------NMKYLLDFFTKAKSNDKDSISSYCLLVLDLKNLWKQKLLAKVTNNDVG------------------FAVNEVLDSMQTIRLLLPVKRIKFDCVDVSKPVPSL-RNKQFVKNYS-VTEEEEAAIRRNFWIRSRLLENLVGEWATVGYQRAGEIDMRCIRLNNVMTNSLVFDSIQIQHAIFLADGSKQE-----------VSKEADSYHLEREQFYVLKTKITNNTSLTMSGVLRHVPFPVDANTKQDLSIDQKILYNGVLQKHIGRIKSGESHEVVLP. 1309
62 0.000e+00UniRef50_A0A1E3PSN1 Trs120-domain-containing protein n=1 Tax=Nadsonia fulvescens var. elongata DSM 6958 TaxID=857566 RepID=A0A1E3PSN1_9ASCO  ali  26  6.YSFLSPSRVRCTVYPLGGIKKSFFVKNVERLQRLREVCLVDVSPPSDSHKSMFSPQGFPNGRVVYDISMSVEDKAKAYLEDLEPWRRTLCVFAVTAYD--------------------------TDRSNTELKRYINRLREKHPRAILHKVLIFSTPNEDESLLVNNGIIYVPSQRSSVVTSLETIMCDITADFLSKLSILVLSYQS------------SVLKSPNVKEMELLSGVNNNQSISFTATFKPTISSHSPSNSSILLPNASSGP----------------------------LPGSKTYGGSSAVSPSDKLKLRAKARQGKLLAHFYLLSGRVNDAFREFTETVNICRSIHDHLWCGSALEGVIICMVILSSLNIPFSIPVAISSFISASSSIASTSGTTHLLSLPHRNSSGSKSGDVSPAMLLGFLPELFDSILKLYVKSQALADESVPQLVFCETLLRCTKLLTVAHLCGG-LNEIALSAIFHQEAIEPKRSMDC--IPVGLSKADINSWVNKLLFTDLSTL-PVPYQCQIMCGVASVYSNLGMDRKASLILRSVFTTITPNLIHTD-----------ATSGKGHTTGTAKDNLLPYVGGKNETGLTDVLDSMIKIY---------------------------------------SAGNVIAKGYGWSTLKKESLSMCVEVCDTVGNLQGIIYFGSLLLSTSAD-------------ILTSNEQQNVLSKIKLSVKRSEEFG-SRIDVPYWDPLILRGIRVLQPPPLKKSKDIILDETDDSDDDEESQASGAIIFNPFASRTPGSQSITLVENEKIEFAVKLQNPFHFNLNLESVIISTMGGVELECNRIKVLLLANTVSEVIIACTPRGTGDLTVTGCEIAIIGIKGPYKFGICSGVIVSRQERIKVIG----------KNSSNEIVSQDKKLLISGSPVMTTVSFPVIPKQPILSVNHLSLEEKCVALLIGEKRKFQIGIKNLSAVDINAMLLVFNDSTVKPLKQVLGNDDIPPNEIYEIEYFLHNRQALKWLRSATPEENNLVVAGFDKELEIEILGKRGMVDASIKIEYCNIPADQEQQSGESWVRDLVVPINVTVHASIEFVSFDIVALQPGFRFGSGDTSNFLSEFFDNQLN------------------------------LETIDMSEFCLMTIDLRNCWTCPMEVSLVTQIDNQD-----------SCASGYTITAVINPSCTSRFLIPIKRIHLSSLRQLIPSL---SGRQFVV-NNVVNNEQDRSMRELFWYREELFKNLRGTWHESKYGRTGEVELRGIRLTPDMIKVLQVSPIDVVVRIE-QVGDDQKKTDAVTKDHIDKNMGQSVIIRDGSEFVKVFTKITNNTDRNLRLILRSIPYLQEVSTRQLYDIDSRILFNGVLQKTIPQLGPGQSFTNQLG. 1325
63 0.000e+00UniRef50_R4XHD4 Hypercellular protein HypA n=1 Tax=Taphrina deformans (strain PYCC 5710 / ATCC 11124 / CBS 356.35 / IMI 108563 / JCM 9778 / NBRC 8474  ali  30  3......HARLKVLLAPLTPLKRARFQEFSQLIRQVDNVRLEDVAVNENDDYNFLNPRSNPNGRVLLDFVSEV-DREHTYLESFEYSRQVFAVLLMADGQEHHD--------------------------EELLQSQIDQIKKTVPTAVSIQIFVFDSNPDTKILWPPDTPQLSTALTPTLQLSLRDALADFTSSLLAKMNGLYINTRERANVTSPYEPA---------------------------SEFIRPQLQRVSSYALADAQITPAS-----------------------SPPPGAERPTRSSLGPGILASIERAKVLSNGRSAKLCGDLLLVCGFGSEALKLYTEAAAIARANNDYLWQGAALEKIGVCLVLLTFLDVSFQIPPIAQSSAGTISYKTSDRKSTSSSKGE--------------VNLVDFLPELYSGVLNLYQKSTTTQNDQIPAFVMAETSLRLANFMASVHIAGG-LTRRALENMVLGTERALLGKT----FASYPPRAEIAAWAMRAYQGPIQSL-SLADRLHVLSGLASVLGSIGFLRRRAFFLREIVLALTPALVQARVAGAAGLGIHPAASLALSNHNNNFSREVLLKTRQTAESLVSLLESVARSYGLPEYSNDAD------------------------------LEEITLGGYGWPYLRNATIKDCISICEAIPDFAGVLRFSAR-------------SLAFGAANLAQDEQVKLLANIPRILAAAKRSGITDLEIDYWDSYLIRDISVHVVPDTL-PVKRLTRELL--AVDQAAVNRAPFLYNPYQKKTSTLQQLSIVQNEPASFIVTLQNPFAFDVEALEIDFITDGPRISCSPSSAYLKAMTTTTTV-LKCTAQESGDLKVLGCRVKISGCRPRIFSVREAPSRTDIEDWHVARG--GLERVKRTGVAAKTSVTPGTEAKPLNGAATKEVLVKVLPAAPTLLYKDIKSSMLTINLFEGETTQIQIGLENISEVPITFLTFTFSDSTIKPLEQAINSKTKQPHEIHELETFLYKIKALQYFP---AGQASHIEPSSTTSFTIQLYGKRGTASADIIVNYGHLPIPSNPAPSEFYTRQLIISAKVNVHPALSVVHCDILPITTPKTLD------------------------------SILTSCHAQFASIYSCI-PAEDQDDYCLMILDIRNAQHQTMTLHVSFDNETSTFTATEEFSGLAQ----------------RRLLIPMRRKYLTEASLKDPVPSL-TERQFIVS--SVCADVEAANRESFWVRESLLARLAMTWTVA--HRKGRVEERSISINRRMIENYLLPTRSVTLRLDCD--------------------GAGRDVMRVGRLYSLLLRVHNRAPDASRMMVRVT-----VAHDSLTDLSMHFIILGTAQYPL............... 1212
64 0.000e+00UniRef50_A0A2S5BFV9 Uncharacterized protein n=1 Tax=Rhodotorula taiwanensis TaxID=741276 RepID=A0A2S5BFV9_9BASI  ali  22  652......PAKLQVLVVPVQPIRRRVFDRHVETLNRYSAVPLTDVPPDRRGDRAVFSATPNAAGSLLFDFVTYAASRPLAFLADLQTHRRVQGIIGILDASEY------------------------TSHSLDDALASFQASLKALPKTFATKVYGFGANEGQLEQKESEGLVMVPS-EGDVGFFLKTILAEFASGILWEFSNTAAQLESRTSIPTPQEHDSLSLQRAVSRASVESGRSYHVPDRGTPPLQHSSVMNRTGV-AAPPQSHPHTVPNGVSTAPKRDSLAFGTASLSSSPKPILPSTSAASGVATTAQLVDARARRRVAGREKKLMGDMWLLSGRPQEAIMAYNEAILLTKAWSDQVWQASAYEGVAVALVLQA---------------TQPRGSQGTQPPSLGQQRSDSPIPSAPI---PHSSTFLSAIPERLTLAVTLYEKAGSLDPDRAHPLLYIEACLRSAKFLLAVHEAQGSMPKALQRLVLPPQAQARQARLNSLVPSNTVPRSSIAIWLNSAYSSHLQSL-DPPVRIRALSEIAALYARVGYRRKEAFVLREIAALCADAAVQQMVGDASPRGKPFSPKIPVINEANGTERAGGQRARVDSTALVSVLGKVCEAVGLGA------------------------------ALEALASAGDVARVFGWPAVQLGILKDAALMAEAVQDHRAAIGFIVQALRSLAATIPPF-------------EQYDLSASIPRITAAASMTGA-TLELDYWGPNLVMSLEVAPLASSRQPFEVNQSVVGAGAVGELPVKQNPFLYDPRQQKASTGSQALLLQGEAAEIYVTLRNYFLFELEIKSMSLSTEGAAFASESTSVSI-PPNSLQT---------------------LAGCTTREFTVVREASGGNDARLSPVDSLRERIKKTGLDAAPTRASGSTPSNVAEPATEPEFIECIVVPEQPLLWMRSTSLTHGALMLYDGEISTIRLALENASSTPVDFLRVTCSDSLTEATRAYLADAELDAAEVYELEADVVERPVFRWSG----DPETDIAAGQSHMLEVECRGKIGCMSGSIQVEYGNRGSGIRDGAGKIWTRRLTCDVLLTVHQTLVAHSLSISHLKS---------------------SKGAVRSHARSASVVSLGQRGAAVDSRLEDSLRGVEAGEHCLVSLHVTNVCGKPFEVKLERREEENDFYLKRKRAEPGSTHRLLVRLDRLLLSD-------------EELARPIPSL---SERQFIAAKVKRSASDERLERELFWYREALLRRIRLSWNEVGSLRTGDIGLQGVRLDSAMLEVLRQDEVRIELSLAGESAEQTGD------------RPHSAYSAVADDFLEVEATVTSSSATALPLRLRLELLPPNSAAASLSHLARYVVIEGITPISLDLLPPGQSTHAIIP. 1957
65 0.000e+00UniRef50_A0A286UUT0 Trs120-domain-containing protein n=2 Tax=Hymenochaetaceae TaxID=40424 RepID=A0A286UUT0_9HOMO  ali  22  3.YAFASLAHINVLLLPVGAIQRATFDKLAAEISQFVEIRLSDVPADSRDDRARFMPNPLATGSLFLKYIKHPPSHYRSILNLFRPSDFPLGVIGIASCTQTDVLSSIYSQFVGSITELLPPGSVL---------------------PLAQRCFVFEEGDGNTNLNIGPGLVVIPSMMGNKKLYIGTLLAELCSNILGEFSIIVRELESLSGNDFL--SAGAFGRIPNYKTIASESRPSLDSSPNGFTPNGTLGSNRLNDPRLNLKRSSTLGPGITNATNRNSQLLPSSKKRQSAIGTGNMS----------------------HARLYKVLGDLFLLSGRTMDASIWYNEAIHGLKQPQDMPWQASALEGIVVAGVIDCWL--------------------------------------SGHGLSNQSKDLVTDFLEKLTRASALYSSAVEAPELEGSSLLYITSCFRHCSLLYHVWITDTTGSLS-LDFLLHGTSVFNTSNATVQKDSITPSRSDVAAALGLSHGPWI-LHLGPRERIEVLRHMAKRYSDLQYRRKETYILRELLACIMDCIVQGREEGKGSSGSGTEMNTTPRQNVGDVA-FREADKNIGNSGILSLIRHVCGVHGINLVSV----------DLTSDTDSGKSIQQPKPRLTNSLRQKTLMPQYSWIEIQVGLIREALAIAESLPDYAAVAQFASSALRELH-------------LLLDADDQYHFHTVSSRAMVTVRRRGD-DRKLGYWLEELVYAIRFIPPPFAKMPSEKLWSSLKSSNTGNGATKSDPFLFNPR-RMTINKRQAYAVANELLEFVVTLENPYHISLEILRIELSTSGVPFK-GKAQSLVLQGDSTETITLTGQASESGTLMIRGCKVTLPGVELHETLLPILSEEEEEKALLNSISLLNEKERKKPPLSPEQNDKNKSEKGTKPQAPPKYLELRIVPEQPTLRIRRTSLSNGAVMLYEGESSMIRLIVENISPLPIDYIDLAFEDSTKATLGQMLT-CELSAFDTYETEYSLVSRPVFSWDPE---YRQKSIGPGKESAILVRCYGKSGCTDGTINITYSYTDFPRDDEPTSFFTRQLLFPVIVTVYQMLECTGLSIMPI-------------------------------------SQLVLLDKDTQSEWYPLFKDLDEHEWCLLVLDVQNTYGLPFEVTVSNSDELS-------------------QSKLVPPGANYRLLLPVKRFSLPESTTTQPIPSL-TGRQFVVTGLEHN--EDDLQKTLFWYRDELLKRVRASWKEASGSRTGELSLRQQRFTLPMLNSLRTDDIRIDLSLSENMNESNNCSVTIP-----------------NSYVGVMARVKNLRPSSAVLSLTI-----------TAEPADYVVFHGVLKIPLGRLQSNDSGEY.... 1258
66 0.000e+00UniRef50_A0A0L0H6Z7 Uncharacterized protein n=1 Tax=Spizellomyces punctatus DAOM BR117 TaxID=645134 RepID=A0A0L0H6Z7_SPIPN  ali  20  6PFDLLKFARMRILLVPVHPIRRDTFRKYVDSLSQFDVVSLMDLTPPDSSRSSKFTEQMYHHGYLHINYVTSYN-KEHLPFEEFQLYRQIVGVIGIMHCQQ--------------------------VDSIGEGYKRFQNILSRYPSVLASRCFAFEPTEQQADD--TRGCIMIPDDPKKLSFYLMTQINDLANELLVAFGNLAAHFDKRPMISGPLMPSS------------------IASTPISAHATTLPASPASFTPTMQSLPSSASIVQSPSVSASLPLSGVSTPIREGSAPLLSAQDSTASMLGLGNLFTPDKTKKRTPARAQKLIADLFLMAGRVDLAISSYSAAIEAMKATGDYQWLAAAMEAYYCALILSLLPKTGLWPNTEDSPSSETASPTGSTGTLGRQPLRSPTYSFAAAQSHPQFRMLICDIPDRYREIASLYERSFQPGQPGFYPLLHIHACLDMARYLAAMWVAKGPVTNGAGVMLVVSESPAFDKDRIILNGGLGASKVDVSTWVMKAWASGV-EYLTLSDQIGCVTSIATAYAQIGYKKKHAFFLRQTALLLLATLKGNRKAR-----------VSMSDVSEIGGERGRSAQLTHTRGLFECMRRVCETFGVGDTSAVEGRETADGTTSLEEDDNEWLDDELDAHDIMSKKIQISRLRYGWPELQIDVLKECMEISEAADSHVTYITYALRLLNRLYKHLSEQEQVEHLEAMHTAAARSKALEVAIGPNNNPLKSPCALVKGA-SKVPVLRRLRFVRQLATGIPYPHPRSSLDGTLTAAAKAA-DPFLYNPFAAKKDLGRDVILIVNEPAYFDVTLANPFSFDLEVQSLLINTTGIPFKPRPISIVIPAESRSFTVRLSGIPLAPGTLLIKGCTVRLFAGAVEEDIAPLQRLLDDPRQKTK-DGRRKRQDERERFGKKRIEFAEKRKEAGTVGPKVEREPIKVIPEQPLVQVVRDSLSTGPMMLFEGERTTFPIHLVNKGTTPVDFLTIGFAESYLPEAAGAIDGAAEEPEDVYERDVHDRSIRVFWLEKEIVERIPVALAPGEQVTIVIGAFGKKWSTGGTIKLDYGHVGSSTSPPDDHFYTRQILIPILMTVQPALQPLNMDILLLSDASSSSSILMSATPNGAMINGTQRNLSMEEMTLDAELALLQQEGLPEEDRKRD--------HCLFTFDLRNVWRSPFEVVFEVFDGAEDITPS------------HSTKTIVHAGMTKRILLPIKRIHLPSATTTLPIPQPD-WKQFVVGKTRLSPSEDRERRTLFWYREALVGRIVATWY-YSQARVGSLSLRGLRLRRGLLSVLKREEVRIEVKVVPFTDYKGGQAEVTGDADHVKKMKKGSFQIGLWETAVIEWSVWNLKDRPFQPLLRILPHPDPPPTSLPITIDRSVTFHGPLQTPLSPLAPSEKTTYALPV 1495
67 0.000e+00UniRef50_A0A0C7BZM8 Uncharacterized protein n=1 Tax=Rhizopus microsporus TaxID=58291 RepID=A0A0C7BZM8_9FUNG  ali  21  6..DITSCCRVRVLLVPVSPIKKSSFWRHVELVKKFSLVRLGDVTPDLQKGNAKFSSQVFQEGHMHFQFVTKYN-RDHSHLEDFQPHRRIFGVIGIMDCQEWKDK------------------------DLSEGYQKFVDMLVQYPTAIATRCFAFDPTENQPDD--TKGLIMIPNV-GNMSFYMSTMICDFASEILNQFANIAERIESLKALESPIPMGSFS---------KKYDMPNGRIHPQPSTSTPSGKSQGQQNNRASQPVPTSSISSSFLKRASSAAGTGRQNISASPPSPRPSLSRSTTFSNLVLGGESGKTVQRTPGRIKKLLADFYLLAGRLPDAIQFYNEAIDMTKDHSDYLWLASAKEGLACTMLLMAFLQADVGHIISRN---------GTATDLNTSQETNRPPPISDKTGVENQKSVFSEITEMYEDAVQTYLRVNSSTNIPIPSLVFAEACLKISRFLTLVFLNNGWSD-AVLAKVVYADMTDLKNQRNDRFKNSGIARYSIAKYVTKIWLVDIDEL-SMMDQVNIMTHMTSILSVIGYHRKSAWFMYEMLNRMVPLLIQGRAAAAS------------------AVNGNKKHLDKNDDGILEVLKRICEVYGIGESNVHDGGALEILQNKV---------NETYQRQQETSTKKVNTLGFGWPALQIDILRECIVISEAIQDHASMLYYTTVLLKNLYQY-------------ISKDEQIRLASSIQRIVNISKRSGQIDNNVNYWGFNIVKSIEPIQPIPRKAIYQHPIAKALAASKEGRINSGDPFIYNPFAKKKDDKPQINLIKDEVCEFKVTLSNPFGFDLELSNIVLSTSGVDFSPVPA-AATIPANDTLTIRLMGTPVETGLLTIKGCVIKITGFAEQEFLYEKQKVEQVKQREHKTLRPAESKGYKYSGLQALYKTLTPGIERLTSNHDDEYQQINVIEDQPLLKIKSSSLLHGAVMLFEGEM......................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 930
68 0.000e+00UniRef50_M7NKJ8 Uncharacterized protein n=4 Tax=Pneumocystis TaxID=4753 RepID=M7NKJ8_PNEMU  ali  31  150...................................................................................................................................................................................................................................................................................................................................KGRKIKILGDLYLLSGCTLDALKKYTESAMLAKASKDYIWHGSALEGIGVCLVVLSFLQIEYQIPITALPSSP---------PQLDKIGSTKMMTFKEIDLNVSKPHVLDFLLDLHMNIIDLYQKSYNCSNERVPTLCFSESVLRFGKLLSLVHLAGGWNHIALRSII-----YDEFYLIPKTRVSGYPPKADIASWSMRAHSPYVNEL-DVVDKCRIYGGLASILGMVGFRRARAMFLREIISTLTPVLINSKVDWITDDSVRLIAQIALTNYS---ISPKHSNMQNSSFLIHNLLDDLCDCYGILRMDERCKS----------------------------RSEVELLEKYGWPSLKITILKECISFCEALPDFSGVLNFTTKIL-------------SIASIYLSRDNQIRFASNIPRIILAVRSLGLDELEADYWDRDIVQSIEFIPGSSKFTPILYSGSELDSVDKD-NNYPRDPFIYNPFIKKSNIPVKHLLVEGDVAEFKIVLHNPLSFELECVGISLFTEGVEFESQSTS-VVIGPQRIHIVRLFGCPKEPGEFVVKGCRIHLSGCKDDIFLVNRGLSSVEHEGKIKSMGLNVYSVIKSSIMSLKNGEIPLKNTLSSI-PMTIEESFEVLPAQPILIVTRTSLVNGSIMLLEGERSTFTITIKNVSHITINFLLLSFTDSTINPLKDALASKNISREEIYELELFLYKRQAFVWNKKV---SHFSLKPDCEEVLEIEIFGKRGLTDGKIQIDYGNVENDSSHG--RFYTRRVVVPVIVTVNASLELVNCDVINIVNDIKERENIPDISEEMGSLFQYAGTHEHEGV-----------------------------EYCLGLLDFRNIWPKPLCVYLNVQNEGD---------------ELFKIEKLIYPGETNRLIFPLKRIYIEDSQKPIPI---VSTRQFVVSNTKKDSEDDYQQRESFWLREALFRIIDGTWVQPGADRKGVVELRGLRMTPKMVYSLKVEDISVVLEISG----------------VVKKIQRLTWLVKLYEFVTFTLKIINRKEYPIKTLVRIQPSLRYQNQTL-VDLSRCVTFNGIMQTVLPLIESQQSHE..... 1145
69 0.000e+00UniRef50_A0A060SWW9 ARAD1A03586p n=1 Tax=Blastobotrys adeninivorans TaxID=409370 RepID=A0A060SWW9_BLAAD  ali  25  4PYSYVAPSRVRVLVCPFGSIKQNAFFQSVERLHRAREVRLLDVTPDPRQDRSMFSPKGYPNGKVIYDFSTSVIDEQLHLLYDLEPWRQTMVVLGLTIY---------------------------RQDMEIDFEKSLRELKSRNPNALLHRLVILGVPSQEVRDSLASAHKGLLPVLSSKVTSIESAMADLTTEFLAELAVFTISKQ-LGSFKSPGVK-------------------------------------------QLDSPASASRPGDKPYNVVMPRASSYLKHSASESSVSVGRSASISKTGSISIGMNDKTKSKQKGRSAKFLGNMYLLAGRVPDALKSFCEAATILKATYDHLWHGSALEAIGICLVILAFLEVPTPIPQVALHSVSLVPSNGSAKAYDSTSSLPSTNSPGPTQGGRASIVMTEFLPDLTNAVLRYFDRSHTSSDDSVPQIVYCETILRFVKFLVVSRLGGGW-NPAVLSAVVRDTTLDKNITSDSPSCSI------IGRWCNTVYTTEVGNL-PVLAQCNIYSGLASVYSAVGMLRKRSFVLRELLLNIIPKIVQSRQQREAPTNAENPSSMGKRKFSPFSHNRKVSTPHHNSNRFLSLLEGV---------------------------EEKGILDLLDTVVTVYGAGDVTARGSGWADLKLSFLKVCVSVCQSMPDLEGVIYYSGLILATSAD-------------VLSKDEQVHYFEAIQHALDASRKLGRGDIAAQYWDLFILRDIRLVSPSS----IVPVEKSTGPRTAEASPFLYNPYTKRPQSRHSDASSRKILVQKEAVEFVVKLQNPFEFEVQVGELVLLTEGARLDAS-INNVYIPPHSIFEVGVQATPKSVGNVKVTGCKIQVVGCAPGEYHLLRRSELRP-EEKIKMVGIESGIQAKDIQTSALAT---------------RHLEFTVVPNQPIVALKSLSLTQGWIMLLEGETHTFTLTLSNISSVPVNLVEFHFTDSTADPLQQAIQSKELPLSEVYECEYFLYKRHPLKWLNS----TQSRIDPHQTGQFDIQISGKRGMTSATLNIDYGHDSLDADDVRLKSWTRTISVPVNVTVAPSVELGSCDIIPLRYREPLESAIELMANDGFESSGHEIAQLAHSIERLKSFP--------------------DSQCVLLLADVRNAYTSPLEATVWSLVSEDSEEK------------LAEVTETVYPNRTKRFLIPIRWEPLTAEQVEQ-NIPLMSRKQFVVDSSEQGEHG-RMMKEAFWNRSKLLKLIGGQWTANTGQRSGSIEFRGLRLTPRMVNVLR------------REEIEITMEMECDSQGIVTRHKDTSYRVKMDESGVMKVSIRNCGTEPVAGMLRLIPGERYSDTSAPDHHDRKILYNGVLQRPIKLIEPGQTVDLCMGV 1329
70 0.000e+00UniRef50_UPI000D77E99C hypothetical protein n=1 Tax=Pseudomicrostroma glucosiphilum TaxID=1684307 RepID=UPI000D77E99C  ali  19  15..SFVSPAKCRILLTPAHPVTPAEFEEWSSYVRSFESIRIKDLPPSTSGRTGPTPGSSLHTGEVHLSFITSYDP-QHAFLAPFAMHRQVLGVLGLGSYSSAVDKME-LERAPSALRELHPNAIVHRAYMFDTEANKPSAAKPKEPGAKGDNLLEEAATAAGFAGRGNSGLVIFPAVRKDVRFYLRTLLRDFLGSILDGLDSIVKGLEGKP-LETPRETLDGLSPXXXXXXXXXXXXXASSTAALAASRASSFFSSFGXXXXXXXXXXXXMGGGSLPAVLSPGASSDSKTAASRSSASKTTTGKRSASLVGAGPS--------GAGRYCKIKADYALLSGDLWAAIINYDACMTWLAGGQDAVWYASALEGWAVTCLIFRMSGLEEKGPSLSLPSGGTKEK----------------GKDKELYEPPFARFEWGEVAEAYSLAIQIYSKTLDTPRDYTHPLIHASACIAYARFLLAVWASSGWNGECFDQLIYGGVPPPGPAMYAALSKSSGVQRHEIAIPTSLALSHSVAALKPP-DQISVLCSLASIYGCIGFPRREAYLLRQLQATVVSLLARPREPVTVMSALKQIAGSDHTVLGTMVTQSLTSGLGEGADAVLILALQICETYGIPPHHILSRAALSGKTTTTQQPLLKKGGAQAQGKGESDRPTLHDEAAFGWADLQIALLKDTICVAEMLQDHVGMAFFATVLLRDFH-------------ELLSGEEQRNLIRGIANCVRTARWQDAQDLEVHYWGPSDPLCIEPVPMPALRLPTEHPAKDLAEADKEAAAGLNNPFFWNPVRATGAAKQQMPLVQDEQAEFLLTLQNPLKAPLELTNVRLSTTGGEFDADSID-VVLPPLAYYTIRLTGIPRAAGTLSIRGCFATLAGCLEREFKVALNDELDDRRTRLKTQGLDARPAILTQKRAIKVSQAVKRLQQSNATAQEHFLQCRLLPSQPLLAVDSPSLTHGQMILFDGEQTTLKLRLTNISSLPVDFARLSFSDDLSEDIRASLSEGDLLPADAHQLEWQLLHQPVFTCARR---PRSIKVLPGRSVLVPISVRGKLDCTRGTIHVDFAHVDAPVTEQTKNFHTRRTSMAFEMTVYPVVECGALDVRT------------------------IGGGDAENIVRGASKGAKRIAVNGDSRMHEEQAATSPADLCLLSLDVRNVHHHAVDVELTLARD---------------DGPPLHFQRSLPIGLTAHLVMALPRLSLPDSKALAPIPSLSS-RQFILSRVKLSPAEEQRERRRFWYRQEILGRLTATWTEARTGRRGVVGLEEQVLSDEHVDVLRREDIEVGLELLDEQAQVLSRGLGAEKVST----------ASAESFLTVRATILNHSSRPLKLLYRLVPLPSAGTHSTDAILSQVLITDGSLSAPVRPLPPGEEATITTGV 1510
71 0.000e+00UniRef50_A0A167X2R3 Hypercellular protein HypA n=1 Tax=Ascosphaera apis ARSEF 7405 TaxID=392613 RepID=A0A167X2R3_9EURO  ali  50  5PLSPIAPARLRALLVPVGKIKRSRFLDLAKRLQSYNVVRLGDVSPDGKPNRHAFSPLAFPTGMIIYDLDCSVSATSHIDTFPFELFREPGVIIAIADGLELKG---TAAQNNDGVLDARSSGDHPTPEGLDDLQEELNLLKTEYPKSVLQHLFVFDYDGVEDLIVGPEKTIWIPNPRACRSTTIKTAMCDMTATLLWEMNKYGEYIRDMPMVESPKFVFQQSSRRGTSNSPTPDKMQQRMTMPVQLPSRPGSPSDPDGSTGHLSGTESPVTFDDITRSMGIDK---SPSERPQSSSRFASPMSRDRMSLGGAIPMTDKMRQRVKGRRSVVLGTVYLQTGRWPDALKELSEGASIARTNNDYVWHAKALESILLCLLLFGWAGMDFQIPSVFYPMSEKASHKTLL----STSSTSNDHGNSSANRTISLQNLVNVLPDVASYIINLYARATIITDDPVPQLIFSETVIRLSKVLCAVHMRDGRLDDAALRHIVLNDRIRLHRSSERPKDVISISKTDVAAFLFRAIPPS-QLDVTITDSVTIFAGMASVLSILEMERKKTFILRELFAVLVPGLVQARKVGAAEMGIHPAAGLQVLNTTPFDLNAMDYGAGNMEQSIRSLLSTISGVYGVCGETPGISFSSQRSSHINMQETE-HPPHDSTEAITSRVLQHAYLRTVGDPRLKIDILRSCINFCEALPDLEGVLQFTVDLLRVQNPMLHTYPDVYNIPPALPREEQIRLLANIQRTVGVAEKIGSMKLEAEYWDECLVRGIDVAQVSANQELLKRTKADNSSDEAAQDKQRKEPFIYNPFAKVSPKGGENLLIAGEPAIFRVTLQNPFDFEIEIESLKLEADGVVLEGE-AHNITLAASCVQQKLITVTAKDPGTLAITGCIVKVKYCRQRRFPIFDKYWQPPLTQAQK............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 923
72 0.000e+00UniRef50_A0A1D2VDV0 Trs120-domain-containing protein (Fragment) n=1 Tax=Ascoidea rubescens DSM 1968 TaxID=1344418 RepID=A0A1D2VDV0_9ASCO  ali  24  5.YSYTAPSRVKTLFVPIGDLSQDEFLNYYKEVENDYEVRLLDVTPIS---SSAFNPQGFPSGKIIYDFQLCLNDNESIFFQDFEPFRKIFITTGIIKYNENLTH--------------------------DILNEHLLNLKKKYNTSIVQNLLIFGSPDNQFHNKYIFNIPF---------SKIETIMCDISYSFLNALFLYAQSFQHV-TLRSPGTISANDVLRTSLNSKHRINDSISLPAI---------------------------------------SAFSKSSTRTSKRASETSLSLIAEMNKISLKTSSEKKELKQKGRQLKILGNFYLLAGKITDALKTFSDSANLLKSGNDFLWLGSALEGIGICLVLISFLAVPYQIPATLNSIGKRDSNPSVNYVSPISSPRNSIKSTKNTTLDIANLPVPEIVYKLTKRALWYYSLTLDDHEDYVPQLVYCETILRFMKFMSIIHIGGGFNFRA-LDHIVRGKRIPSKK-----IDSTYFNKYDIIKFSNKIFTVQLK-NMDLLSQCRVYCALSSIYGDLELFRKRSFILKSLLDTLIPELIKNNTTLLTIILTEINC----------------------------LLDSLLLVYGIGCSPESS---------------------------------IIESKKSNWSQLHKMILNLCMKFCMSLNDIGGVLNFSSILLTRYLHCLSLEEQTFLFNSFKEYME--------------ISRSLNLFLKIYYWDPFIVRDIILINNDESLRPMKLDNTDSKNINRFSKSRYSLNNKMEDVVSEEFFDQSVELIQDEAVNILVTIQNPFLFDIEINEIKIETDGVELETLVHNHFIISANTLQNIQVGIKPLSSGILNIIGCTMKVCNCESQFYKISLREKNRKIEKTKVIGFLNNLPDFKSQSLLVQSSKNTLKINNTKDRVDVKNLKYKVILPQPILALIDLSLNNSWMMLLEGEKNLFTICLRNLSNLTINYLAFSFIDSTIEPLRASLDSKETPASEIYEIEYYLLKRKPLKVRKNNKLNS---IKPFDSLPLDIDIKGKRGMRNASIILDYGNQTLD-----SEKYFRRLTIPLFVTVQPSIELAGCDLIPLFYNVENSKNNLTTLSNLNDDIRNQENIWSYLKNKT----------------------ENISDYCLLVLDLKNSWTQKFKIELKSNEKST-----------------YIIKDSIGPGHTQRYLLPIRRFGFPDLEREIPSL---RNKQFIKKDTRFAKEEMKFIKDSFWYRKEILRHIKGLWAEDKTNRKGFIELRGIRLSPKMVSVLKLQELEI-------------NNLKSDKYQSSITHNGFYWEIKAEEFFTIKTKITNNSSEKLRGMLRHVPIVSGG------SIERKILYNGCLQFNIPAINPGESAEFDLGV 1281
73 0.000e+00UniRef50_A0A1E4U3A4 Uncharacterized protein n=1 Tax=Pachysolen tannophilus NRRL Y-2460 TaxID=669874 RepID=A0A1E4U3A4_PACTA  ali  23  5.YSYTSPSRVKTLVVPTHNLSLQKFEEYFHILSKYYEVRLVDV----NRNNGLFNPQGYPHGRVVYDYQLVDSDTESLFLNDFEPFRKMFNVIGICSYDE---------------------------GFVDVAEEQLIELKKYHNNAINYNIIAFDTPIEGKIQDKNKNIFYLPKITSSKLTNIETILCDVTSNFLEALSNYASAYQHV-TLRSPGSIXXXXXXXXXXXXXXXXXXXGFSSGNTLNSKSKRSISGAFSLNGGSSSPTLSTNSFNSTHTITTEKKKKRISSANFLPNF---------DSNSNLLHQERLKNNKNKGRQHKIFGNFYLLSGRLNDALKEFCECINLLKSCNDFLWLGSALDGLSVCVLILTFLEVPFQLPLSPNNSPRNSMNSVTRTISNQMNNGTNSPSSTPGSLEYSLQTIPELVNKLVNKCIFYYKLTFENSDDCVPGLVYCETLVRYIKFMTVVSLNKG-LDFHVLRNIVKSTPLPKEHIDDGSISPMVFDKLEIMRFEQEIFNNQ-FEDMAVINKCRIYCSLIAVCADLDLLRKRSFLLRQLFFLILPELQDKKF---------------AINTAITISGSCKISETGDETALTKILDDLLKSYGISTDPNDTSTLQSFVPN--------------------------------WMKLHKTLLKNCIKLVESLSLWKTSLRYNSILLKNYSYSL-------------SEEEQVNLLQKMRTQYAKLKHTRLDKIKLLYWDEYLVRDISAVQTVNQAAPV---IRNSRRNSYLTNGSHLKQNIYNPYSNKNITAEDERLVEGEPVDIRVTMQNPFLFDIDISKVQIHCNDFKIKTVTSNFFVIKANSIAELFVSFIPLQKGELKILGIKAIVCGCDEQVFEVCLN-KNFKVFEKIKTFGIEKFLTKNDAT---KENNNQILYDNDYSSIEIKTLKYHVLSAQPMLSLVDMSLNNNWVMLLEGETKEFSISLKNISSVEINHLISSFIDSTTTPLSKALATK-LPGNEVYEIEYYLIKKIPFRINKENLKLIKN----NEEFKIDLEIVGKRGMTSASVLLEYSN---NTGEEVDSKYIRNIEIPVNVTVYPSVEISSCDILALFTSETVLENSDLLKALNLSGKFDRRSFWSYLNNRV------------------VKKNEKMSDYCLLVIDLRNSWRTEIEVELRSDDGLLPLPSDYDESDQEKSDDCCVTSCIIERGATERFLLPIKRISLEQLSQDIPSL---RNKQFIFDKTTPK-EEQNFIREAFWYRQELLRHIKGVWSIKREEKTGNVELRGVRLSSRMLNILKVESVGLEQFILRNVNDDETSNS----NQLLSKKDNLAYDLKLEDFYIIKTKIINRTHTPITGILRHVPV----SKSSSLSIERKILFNGVLQYTLPTIMPGESFEVDLGI 1376
74 0.000e+00UniRef50_A0A0D1Y8F7 Uncharacterized protein n=1 Tax=Exophiala sideris TaxID=1016849 RepID=A0A0D1Y8F7_9EURO  ali  32  5PFDPTAGAKVNVLCVPAGPVTPERFQKFLKSLQDAAIVKLKLVEPSQSTED-ESNDAGREDGCIIYD-ISAGQDLRRPSIFPFETNSRCQILLGLVDG-------ERVEHALEPGSNADGAALDGSISRLQSIEEDFLQQTASNPGLLVRQLISCGQELPSMPESQNHDILFLP--DNDREGAAGDLMVKLSKRLTTAVSRAVEDLQDQPISMVPGGKSDPLPR---------GRDTPNLGQGTSTPVSAQSSASSSTPKENGVRSDTSIGRFNIIRGMFQMQSGLWSD---------------------AMTSLSEGASIAGDGRDHLWHG----------KALESLLICMILL-----------------------SWSDLPFTIPPICRSLPNRRDVLQA---------------GSSRNTVELRKTLAQLLPPMVESILELYARVSNLDLGGSLQDILRESRVRLVNLLVCVKGNGGILSKHCLDIIVLGHVADPGEADALDGEPVATSRAGLANILIDTLQASQSSN-DIGHYTSILVAVSSSLSTLGLDRKHAFYLKLLMQQFVSKLIEARKVGASEVGVHPAAGLPPVTTAKGVL-------PEMMHGTRVILSLAAAAYGSPLPAVPPPPETILADMN---------------GVQDNLRIWASEHASGDVFLKLEMLRACVSVCEALPDVPAGLYFSSHILRGAKQAVMPIQQPGTAVPLITADEQARLIESMKRAVSAASRLGAQGYRGAYWDDFLVRDIVVFERDSFAKLIAHKPSDLSKRGTGLAETIRDPFIFNPFSTVKSVVAAPVLVADEKASFAVLLQNPLEIDVEIEQIQVITKGCGFVP-SQHSVVLGPFSMQTFTLSGTPTESGDLEIIGCRASIRDCYTQEFFIFYEDWQLPSPPKQNAVSKRKLRTNR---LTFSDENDSKPNELDLKTPVSTSLKLKVIDPQPRLTIKLKTTQSSSIMLLEGERRVFEVDLVNSSTVAADFVLVTTEDSVTTRLQEALTNKDLNPADMYEFQNQLAASPAIDVHDQDRPKSDSVLSPGAAVGYKVAVVGRPGLVNAAVLADYAYLGSPSTDVKGTFYTRQVRFPIAVTVNGSIEIPRCNILPIHSDFVWNPDHNGHTE--------------------------TRDSDDSHLSHWLRMRPNAGDYCMLSLDLRNVWPQPLSINIQARKPAEDV-----------WDDAFSVHETLQPGHVTRVVLLIPRLFVQNPYKSIPNLD--TQKQFVVTTSKFSAEAEAASRESFWYREELLKCLRGTWKEATSDRHGEIDLRGIRLSPRMIDALKIDHVEIEYSLAPVEDAGE----------AVKQIGRSHFVVKTEVFATLSIKIRNHTEDTLGLILRLQPALRHQPHNIALDLSRRFAWSGVLQRALPAIEPGGVFVADLGI 1286
75 0.000e+00UniRef50_M5G9Z9 Uncharacterized protein n=3 Tax=Dacrymycetaceae TaxID=5254 RepID=M5G9Z9_DACPD  ali  22  4.LPFASLAQLNILIIPIGPIRASVFNHWASLIRSFTSIRLADIPPDPRQDRSRFLPSALSSGSIHLAFPSHPPPSTAQPYALFRPASFVHGVIGVADCSSSSSLAALLAEFYGVLHEVFGPNPV---------------------FPLAGRCYAFDPADSQTDLDVGEGLTVIPTVVGDKRIYLGTLLANFCGCIIGEFAGLVRVLDNQPTPLSPVFAYAYSSVTPNSSSLSSRHNGSSLEINIERSDCPDTLPSLTRSETLPSLFIPVAPTARFPNGRPLSGASGRTPSPLPFIPKRAATASPANFQGFKSRSASPPKRKQGGGRLGKITADLFLLSGRLGDAAQWYSEAVGSLKGSADIIWCAAALEGWVVANVLDAWGKQDQPTPPQPTSGHDPPPDPWVDP------------------------------LEKLTQAVALYWKASPTAPDDTSTTLYCDSVVRLTKFLFAIWAAGGWGHGAFNMLMSTGPPLGFSPRGPSPSQTTSITRTQIANVAAQAHGPFLLALLPL-DRVRLLSFLASTYSLLGFWRKEAYVLRELNAALMELLISAREEAQSESTMRFTAGLAQTSLGSEFSLALPSGRTQAQDGGIQLMQHVCEVYGVGTDAVRIRD----------GMDGGEGSGPDEQRVEQKLGVRGTWEQFGWPELQVGVMRESISLVELLPDYPAVAQLALSAIRK-------------LGRYLPSSEQLHLYAVSMRALGTARRRGD-TRRLHYWSDNPLVRIEPVPLPLARLPTVHALSDLQPPRPEQAGQRKDPFLYNPRLQAASS-ASVIAVQYEPLELIITLRNPHAFDFDLQSVVLDTRGVPFRTQPASVSI-PANAFQVLRMSGVPLEPGTLAIRGCTVQVNGCLPRTFLFPLQTKEDEDYETIKDGGLDARALPFVIENKRRSILLPTEVDESRKYLE-----WNVLPEQPMMRVKRTSLTHGALMLYEGETAALTLTLENMSNLKVNFIRVTFEDSTMAPAQAALAEGELSTAAQYETEFDLVRRPVFKWERA----GDIDIPGGKTSTISLTCLGKPACTSGTVQISYGCLPDEPAERAQ-FYTRQILYPVLVTVYHNLECQSMDVMRFSPTAYSLKDNLEKQD----------------------------------IRRTLLDVPKDGDWCLFTVDVRNMFGIPFEVTLERTQKDAPEGKA---------------TQIVPPGSTLRLMLPLRREYLSSTSEPIPSLL---QRQFLVSKARLSTLEEREQRLLYWYREQLFSSVRATWREPISGRAGELSLRKQRMKMPMLEAFRAQKVQVEVSVLAEGEGEVREIEQN----------MGRYEVPSNDWVYLRVKVTNVHWQAAHMALSF--------SAIPPTPTAFVLHEGSLTLPLGEVAQGGSTEREV.. 1388
76 0.000e+00UniRef50_A0A1X2I3T5 TRAPP II complex n=1 Tax=Absidia repens TaxID=90262 RepID=A0A1X2I3T5_9FUNG  ali  21  7...LTSSCRVTVLLVPIYPIKRSVFTRYVKLVREFSTIRLNDVTPD-NKSGQVFNNMNFQEGQIHFQFTTHY-SGDHDNLIDFQPHRRLFGVIGIMDCQEW------------------------RERSLKDGYQQYLESLDKYPSPIVTRCFAFDPTENQPDD--TKGLIMIPDV-GDKKFYMATLLCDFTSDILSQFSVLAKDFGQQLQSESPIRNTNYATSPLTNQRHSVPQQPYP---------------------------------------------STTATESPSRHSVSAANLPSSSGSTSPSTGHASRLQKRIPGRIKKLYADFYLLSGRLPDALSLYIQAIDMTKITSDHLWLASAMEGYVCTTLLLEQLQRGNEVTSLKKSSTGDISANNATQNSVETPSAP------------ESTLTVSFVLDQYNTLLHYYSKYTADDDNSIPTAIYAEACIKVARFLLTVYLNGNLDTTARYLLVCGHNATPNNQQKTVSPVNCNIERWDIGLWATRVWEASLGNL-TVIDQIHLMTEMTFIYNSIGYRRKAAWLKYQSIQLMLPILLHRQTK---------------SNQDTKGGNTIKSFPSIDRQGILVVLKWICKVYGILDFDSQAGDTALEKQDM--------------PATKIGTRNKSVDTTVSWPSLQLTILRKCIITAESLHAYTDMLYYTTTLMKNMYHYVSKEEQVRLSNSIQRIS---TLQRRLLLSSTSDTENDEQEQTINYWGVNIVTGIRAIQSIPRKLLHQYPHTENNYPSDNPIATNNDPFIYNPFTRKKDQKEQILLIKNEIAEFHVSLMNPFGFDLELQSIQLCTSGVSFQPIPHS-TILPAYGTSTLCISGVPKESGVLTVLGCRIKIVGFAEHKFLLNQDTLK------------------------------------SEETANTNQKEFNVVTEEPLLKVKSTSLVQGAIMLFEGERAQIKITLENIGSALVDFVALSFTDNDILGRSSGPVGSDLSMEQQYELERISTDRKVFRWHNDQTIGDNVWLSPDSTLEISLDIYGRRGCTHGTIKVDYGHLDYNEVDLSTTFYTRQLYIPVLITVYCHLKPQYWDILYIQREYASGNNARDPRTSDTVTADNTRKHDMGLLPIEQVLKTLNEKQLGANVMDDVSGPHEQNEYCLATIDIQNRWSFPFRVTFSIDNTGED------------GDTLMDVDSIIQPGTTSRTLLPIRRFILPENITNQP-ITLETKKQFVVPQNQALPEQENYWRELFWYRENLLRRIKATWSDDEVNRQGDLDLRCLCLTSEQLSILKVPDVTFAFTLEG---------------HGVKQIGFKHFVCQSGQHVMLTIIVNNHLTKATKFILRVQPIQNLNGGVKEYDLQDQLLMEGMNQVILPQLSLDHQARHTIP. 1364
77 0.000e+00UniRef50_G4TIE7 Related to hypercellular protein (Hypa) n=2 Tax=Serendipita TaxID=358905 RepID=G4TIE7_SERID  ali  22  5..AFASLARLKIMVIPVGPIPKAAYEKWHAVVSSFDSLPLVEIPPARNDDRSMFMPTAASTGHLHLEYVAHPPPIWHHALALFRPALFPLG-------TEFKRKVQHMYPYNS-------------------------------PYPLAQTCFAFEESSEGTNATDDVGLEIIPSVLGNKVTHVGMLLASFCSQILAGFSSLTRSLDSPRGWEVLH-----SALFPTYPLESEDDQGQNLRINVESPRSSSEMKRTSMAPAVTASPPRPSSTLSRSASLNTSTRNSVALSKKRQSLLNSGGPPN--------------------ARLSKTVGDLFLLAGRLNDAITWYNDAATHLRSTPDPVWHAAVLEGLSTAHVLEAWAGSSGLQTSMSANM---------------------------------LRDPWSEISDRMNMATHMYFKADNSHDFPTVTLLYCSCVLRFAHFMFCIWSSNGWGPMAFITMLSSSLPPPTTARRWRMTSMTTISRTQIASIVAQAHGPWIMHLH-PHDKIRALSYMAGLYSCLSFKRKEVYILRELVSVVMDLVYMGREERREQNIARMGVTDGNLAEIAASTHMTIREHQDGNASILRLLTHICAVYGINLRAIRLE-------------EEGQKEDETEDRDEMDSIDFARQPSYGWPELQLGVVREAIAVAEALPELPSLTQFSLSSLRALYTHL-------------TASEQHSLYIAAKNAVQVSQRRG-EDFRVEYWSGRPVVSVEVVALPFGRIPVQHSKTELVPTILSPTSGPKDPFIYNPRLRT-------LLVQKEQLEFILTLQNPFLFELELTNVSLSTSGTVFVTQPVS-VTIPPNSFCPVRLSGVAEKPGQLTIRGCIAQTVGCEPREFLLPLSSEEEERNMEKRRSMKEAEQDRFKFTGLDARPLEREKKRLSQAGPPPKFVECYVVPEQPLLRIRRTSLTHGAVMMYDGESTTIRLTVENVSLLPINFLKLTFDDSTIAPMQQMLGEGALSIAETYEVEYDLRRRPVFQWRAKD---EPKEVRPGQKSVLTVSCLGKIGCISGTVQIAYAHIEES--DTSDFFYTRQILYPVLVTVNQTLECSSMDIFPFSPIAVLSSEDYEYDSEEKS-------------------------------RRNLLEVDSDGDWCLFTVDVKNSYTLPFEVHFDRRQEGT---------------EPVSCSRLVPPGSTCRITLPLRRISLEEITRPIPAL---TDRQFVVSKAEPSSGDQMVQRELFWYREALFNCITARWKEPGGSRHGELSLRRQRLTGPMKDNLKTDPIRVNVDLIQHMEKDGQEE------FSPIPAINGKVYAQPTEFYNIRCRAYNATDSPHVLVLSL--------AAHPLDL---FHVEGNLTIPIGRVDSKCAKEVEVPI 1269
78 0.000e+00UniRef50_B8P4N5 Predicted protein n=2 Tax=Postia placenta TaxID=104341 RepID=B8P4N5_POSPM  ali  21  337PPAFGSLAHVRILFLPVGSIHREAYEKWAAEIRSFDHIPLGDIPADMRDERARFMPNPLANGHLHLNFQSHPPSLSHQSLGLFRPSELPLGVIGIASCSRSDSMSSILSSFRNSTAGLPSQGSI---------------------FPVAQTCFVFEENDANLDVGDRPGLVVIPSMMGNKRVHLGTLLAGLCSQILANFATLMQSLESPLGNEYLNSTLFPTLPPTSEIPQSLEDEGR---------DSIPPLPSRNSQPDLGSNGMARSKVTSALKRVSTGPGLA-PTRHSSLPPTPATAKKRPGAIGAAS----------SHGRLFKVLGDLFLLAGRHQDASVWYTEAIALFKGPQDTAWQASALEGLATIPVVEAW-------------------------------------SSNIGTISTGDREPWQDTVDKLNQATALYQKSAAPSEYPILAYLFAQCVIRHTSLLFAVWCSKGWGPLAFAQMVHPPQLRPSYAEMERLTTISGISRAQIATVLAQVHGPWL-LHLGARERIVILQTVAGMYGALGYMRKEAYILRELLGSVMDLVVCGREEGGAGRTATGLGIRLPSGPGNGTVGVRENQRVEGNESVLRIIKHICRVHGVDLEAVKLVDF-------GATGGKARTEEQDVDEDQEDEMLDSHQDPFGWPELQIG----IVREAIAVAEALPAIR------------------------------------------------RGDRRTVAYWAGRPIVSIEVLPLPLIRLPIQKPKSDGQSNMNPVIAGMKDPFLYNPR-KTMSGQVQSILVQNEKFEVVVTLRNPFVFDLQLESLALSTSGARIESESV-PVIVPANTYHPVVLTGKALEAGPLVIRGCIVQTPGGVPREYALPLSSDDDDDRRNRRRSGRSKHAGLDSRPWERARKRISKSAVASSSTPSVRYLQCTVAPEQPLLRIRRTSLTHGAVMLYDGETSFVRITLENVSSLPVDFMRLTFDDSTIAPAQQSLADGELSVFDTYETEYDLMHRAVFNWDGTGDMQ---RVAPGDKTTITVRCFGKVGCTSGAIHVSYGHVERETPEDSSVLYTRQLSYPVVVTVYHMLECHAMDIVPY----------------------------STIISFASSLSDEDSDSPVVHARKALLNVGDVADWCLFTIDVRNTYGLPFEVTFERHEPGLSQKSSRMRSSLIRWGFRLCINNL---SCTARLNFTKMLLSEEHISKPIPTL---SDRQFVVAKSSLTSSEEKAQRELFWYREELFKAVSGRWKESGGTRSGELSLRKQRLTLPMLEALRTETARVEMSLLSYDDDRTVPVPIDPS--------GSKSLPPPHEFVYLQTRVTNLSASELVLTLTL-----------SLEPAQHVLFQGTIRVPIGRLAPGESQVADTPV 1631
79 0.000e+00UniRef50_A0A165GB87 Uncharacterized protein (Fragment) n=1 Tax=Exidia glandulosa HHB12029 TaxID=1314781 RepID=A0A165GB87_EXIGL  ali  23  7..AFASLAHVRILVLPLGGISKSTFDACAELVRSIDSVRLVDIPADPREDKARFMPAPLAAGSIQLSYVAHPPPASHAPLAVFRPSLFPLGVIGIASVPGKLSPAELVPHLNASIARVFPDEHA--------------------PFPLARTCLAFESEETDHDSPQTKGCTVIPAVMGNKKLYIGQLLADLCSNIIGEFTGLYQLLETQHGMDMIAAQALPSFPSPSAT----------LPTNLNRNSVPYSDSPRQSLDLASTPESRRSSFQR-PRTTSIPHSNSQPHITHKGPTSPPLIKRSSTQVGTLKQQRRATSMLLPNGRLYKVLGDLYLLSGQLDQANVWYTTAQNMFKSAGDMVWHASVLEGLCTVAVLEAY----------------------------------SALETGSEAASTGDKEPWAHINDKMSMAISLYSRASPSSEYSLFSLLLSDSVLRHTNFLFAIWSSKGWGPAALSHMVVFASRPVPEAHLLTLDAESKVTRSHIASTLAQAHGAFLVHLR-PHDKIRVLSAVAATFSLLGYRRKEVYILRELLCVLMDMIVCGREETARASAVSPVSGGGAVSPVANGRPRTPNGVGSPVPQQPQQQVTVRAHESTAGNTSILAIVRQICDIYGVPLDSISIVDDPNTTEPTSGVDAPRQVHFGWPELQVGSVKEVMAIVQALPDYLALAQMAHSALKTLQPVMEIRDHR-------------HLYDTAMHALTTAKRRGDE-RRLSYWADNPVVAIQVILLPFERTPIQHSTRDLLPPSEEDTSARKDPFLYNPRLKKAST-AQALAVQGEAVELDVTLYNPYTFHLEVQELSLSTTGVTFESQPLN-VVLAPLSFDMARIVVTPPEAGMVYVRGCVARVPGSVRKEFFLPV-LTDEEKEKSEKRHSMQALELGRHKRSGLQARSRLSGTAASSAAPVHKFMEIKIVPAQPLLKIRRTSLTRSALTLYSGETVTIRLTLENVSNIDVDFMKVTFDDSTIGPAQGALADGELSVFDTYETEYELIHQPVFTW---AAPESEKTIAAGKRVALSVNCFGKIGCTNGTIQISYGLTKPVLEAGVNSFYVRQMLYEVDVTVYNTLECSGMDILPLSSFDVHDRENISDAN--------------------------------LQLIADVAASVDEDDWCLFTIDVRNCYGLPFDVIFERSQEETPSCQA---------------TKRIAPGSTSRILLPVKRVLLPESSKPIPTL---SDRQFVVSKDKLSSAETAAQLELFWYREELFKTVQARWQEAGNSRFGELSLRQQRMTMRMLHAFKIPPVKVHLSFVSSPVVQN------------PSSSRRRTVCPPNDFVTLRVEVKNTSRAPQVLALSL-----------ALSPADYVLSDGILSIPLGRIESGATGSIDVG. 1307
80 0.000e+00UniRef50_A0A2K1QFM6 Uncharacterized protein n=1 Tax=Elsinoe sp. CQ-2017a TaxID=1983410 RepID=A0A2K1QFM6_9PEZI  ali  29  1........................................................................................................................................MENVQEQFPGVLLTQLVIMDSASDEQKPWIPDGSLLVPLLSQSDGTTMYALFSTLIGKLLGEMAGYAEQVRSWATVATPLSLQAQTQRFDGERRPRSERRPRYSSPRPTSQAFGSPSTSVASSPRPDSPSLRSEAPSSPDLSNVPTPTSSTAPEAMWKAKAKYASMQSDKPSGRSLYPATEKEKKIGQARVGIVMGSLYLMAGRWSDAWRELVEATAKCRSNNDYIWLASGLERVLVCMLLLGAEGFDFQIPSFCYLGQERQSTLYFIDASREQNTTISPRDPTAANTT--LRKLASTLGEVVNTLLHYYDRAGTFTGEALPQVAFSEMVLRLTKLQSFVATRGSTLADE----IFQDGRLDALRRPIGAKDTSDMSRLGISEILFRAYPGPFADISSPS-RSAVLAGISAVLSALKMHRKRAMVLKDLITLLVPSLQQARTLGAAELGIHP-----SSNLPLADGNDKVSASDASSLSIRQLLSHLLEVYAVSARESPDDHLEDIEA---SSSGEEGGYERLIHATTQATARLANLDKAGSANLKIDILRSSIEFCESLGDLSGIAQNAALLLRTAGPQASVDPTQMVRHVHLANEEQVLLANHIMTAVHTAREAGTQIDRPRYWDDFLVRSVQMVEDDSSSKLVEHSKADM-------NTVKKGPFLHDAWGKNAKKEEENITVAGESTFLGVVMQNPYDFEIEIDEITIVAEGGVVELDPPN-AILGPGRLQEVVCVARVAEAAQLRILGCKVRMAGCREQFFPIYNDEWVPEDHFKIKEASREV----------GLRNETITDDDSADRAPQPSQMALTVIQSQPTLVLDKMELTDTSLMLVEGETQSFRIVFLNTSNIDVDFLRLSFEDALTSSLRSAATSKDLSRAEMYEIEANLTQEPFFSAIRVNVSESQSQIRTGETATFEVSITGRASIKDVRILLDYARLDTELAESSGRFFTRQLAMPVSVTVSPGLQVQHFEISSLPLDVALEGLQLPAQSERLTMNGSLATSHSE----------------------RDPSPDSSNQVCLLVIGIRNGWTNPIAVKFEL----------SPSTRPVSLCRDVQYQQTILPGQTHRFVMPMRKLYVHKAYAQIPWLSTQSRRQFVVSTGGDTLQQELAMRELFWYREKLLESISCQWHEQGSSRYGMVSLRSIRMGHRIVEALKLDDLDIVLRVHNTGDHDEVGGTISRGGMS--------FDVRCGDYLSVTTTLHNRSDRRIHGVLRLLPMLAEQSQDESMELSRRFIWSGLLQQPFESIEPGQRRT..... 1255
81 0.000e+00UniRef50_A0A022Y235 Uncharacterized protein n=1 Tax=Trichophyton soudanense CBS 452.61 TaxID=1215331 RepID=A0A022Y235_TRISD  ali  49  1...........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................MQVRDGSLDTDGLQHVVLNKPLERMSLPDQQRKSNTFRKTEITSFLFRALPSSLSSDVPVTDAVQIFIGVAAVLSPLGMERKRAFVLKELFSILIPGLVQARKIGAAEIGIHPAAGLSALSNASFDINALDIGPANMEAGLRSVLSLIGGVYGAKLTNGRINSEWQNDGHDF--------DYDSIEAIIERTFQNSALDTYGDLALKIDILKSCINFCEALPDFSGVLKFIVALLHAAKGTYMLTTDLQKNRPLLSPDEQTRLYNTVKRTVSVAHKLGVSNLEAEYWDDFLVRDV-LIQPSGAEPPVRRTKQDFGVTFSTEKGGETEPFIYNAFSKPLTPTAEAPLIAGEPATARVILQNPFDFELEIEHIQLEGEGIAFDA-SASNLLLAPFCLQEIGVTLLAAEEGVLKITGCTVKVKFCRERRFPIFKKIWKSVAETKLKRSGLAAKDPSLSRPTSWSSNTSQGAI-PSRKPPETTTLSANIIKAQPMIEVRSSSLLQSAIMMLEGETSLFEITLHNTSDCPADLLLFTFQDSTTAHLQVALNNKDNLPTEIYELEYQMLKRPPLRLRTSGPGQEIPSLDPGESKTFTIEVLGKPGLRKATIQVDYACIGASPSELPDTFYTRQISIPLTVTVNASLNISRCEILPFNGHLGWI-----GDASSDIKSKKHPTTYATLPDPSIVSTGGRNDPQISPVISQLGSKYTGSDYCLLLIDLRNSWPNPISAYLKVTD--STEEKIDRSEAGSSTLHLQEVSDVLQPGHLSRFALVIPRIYLDDPHQKIPVLNAANRRQFVVSANKLSYEAETAKREAFWLREKMFENLHGLWKDEVTGREGVIDFRAIVLTNRMISSLRVDDIEPSFNLLP-LQKTIDQESCSDQYPAILQTGQSRFSVSTDTFFNLQTTLFNRSSKPIHPIIRIQPTLRNQPYTIALELSRRLSCTGMLQRALPVLGPREQRQINLGI 949
82 0.000e+00UniRef50_A0A2X0LTS9 BQ5605_C010g06078 protein n=1 Tax=Microbotryum silenes-dioicae TaxID=796604 RepID=A0A2X0LTS9_9BASI  ali  22  3PSTFVAPARIGVLLVPLHPIKRARFQQCADQIRAFDTIELSQVPVDNRGERAIFSSSPTTTGQLLFEYLTYASSHPLAFLAEFQLHRQVHGIIGIFDASEYADDSTSLAL------------------------AQFHHALRRLPKTFAVKLFGFHPSEAQKHINENDGLVLIPTTTQ-ISFFLGTVLADFAGHILREFSNLV-SIRRDPWAPLPNKTDLSSRRTSIPTPQETPQLTSPFTFIPTKPDARSTIHSYTGRATRPTATRSSSLPPNITPNNSTSTSTNPLASSSHLSNSLAAPPQSRTSLGLGSTLVDSKSRKKVAGRERKLMADMWLLAGRTEQAIACYEEAIALLKTWSDNVWYASALEGLTIALVLQAWPAVAVAAAATAKHASTNSISKSTNSISKKTANGTSTPTSTLASNAADPSTFLSSIPDRLGQAVGLYEKMLPNLADRCHPLIYAEACLRIARFLLAVHEARGKIDRAIEKLVIPSNCSASEARWRSLSPSNPVPRSMIAQWASMAYSAHLGQLA-LPTRLRVTGEIASFFGRIGYRRKEGFVLRELAALCGQGVGKGVEVFSAVHGPSPTSPVSATMNDRTASIVRTTSDSAGNESIIRIAEKVCESFGIFVVPRIAKDTA--TTNPASGHHLRQKSLLQGRPLELDYRLSSSSSPFGWSHLQMGVLKDAISVAEALPDYQAAIRFTVTALRS-------------FAETMPAWDQLELSRNIPRIFAAATRRGAAFELEYWGPTQLVMSLEMAPLIPNRVPIEHSIKDAEANGTFNNFAKKDPFIATYDPNDASPRIRPRLITNEVAEVFVTLQNPLGFDLEIQSMQLSTSGVDFICDALS-TIVPAGSFHTVRLSGAPQAPGRLTIRGCHILLAGCTSREFLLPVWNDQEEEKRQKVALLETARERIKTTGLMAFVRQASQQSTTTTTEQEFRFLECTVVREMPLLCVRSTSLTHGALMLYDGETSTIRIALENVSTRPVDFVKLTFSDLHTTTTQAYVDENELPPAEAYEIEADNRDRPVFSWTVDQMP----RIGPGQTYLLDVQCLGKVGCGSGTIQIDYATLPPSEADPTTVFHTRQILCDVFMTVHRALLAHTLDILRLQALPEH--------------------VAFAHGRSASVAQLGRRGAALDQRLEQSLRDVDDGEHCLVSIDVMNAYGKPFEVKIERCEDES---------------GFFQVRQRLEPGATLRMLARIDRINIEEAERPIPVL---SERQFVLSKHQVSAAEQRSTRELFWFREELLRRIRATWNEVGSLRTGTISLRSLKLSSSLLDVLKGDEVEVELQL------VENEASSPEAFRFKGRGNRLVYAAQPNEFIDVCAYVSNHSPLAVQLALRLLKTPDATVASSLTHLARHIIIEGVSPVAVRTLLPGESETVKVSI 1507
83 0.000e+00UniRef50_UPI000455EBFB hypothetical protein n=1 Tax=Coniophora puteana (strain RWD-64-598) TaxID=741705 RepID=UPI000455EBFB  ali  22  3PHAFASLAHLRLLVLPVGTISKSAFEEYASEIRCFDTIKLSDIPASVKDERARFLPNPLSSGSLHLRFSSYVGPSVRAPLSLIRPSQSTLGIVGVGVCSSKQTPTTLQRQFNKLASSL--------------------ALTNSFPTSKV--CFAFEESEEVAGAAMSPGVTVIPHLMGNKKLYIGTLLADLCSQILGEFGRLMSLLETPIGNEHLNATMFPIFPPSSDSPSVFEDPMSFTSSTMSQPELTSAGF---SSPPGDLKRNLSAGPGINPITNTPISRQSSLGFPARKRSSTLASS---------------------HGRLYKVLGDMFLLAGRIADATLWYTEALVLFRSSQDPAWHASAVEGTAVISFLDSWS------------------------AGQQASISYSKDG-------------WYSIMEKLSQAALLYPKTDNPQENAVLTSLYVDSILRQTTLLLAVWVSRGWGPPAFASMLQEDTSAAAWSHLESLSVASGISRMQISTTVTQAHGPWL-LHLDPYERLRALQTVAIIFSSIGYKRKEVYILREVLSCLMDLVVCGREESETAYRSDSDDGNHSPDLATGAIGIRLNETQEGNESILQVLRYSCSIMGIDLASVKLV--------------NSSERTPSQGEESSNNSLPPLNEPFGWPELQVGMVRESIAVAEALPDHLAVASFSLSALRALHS-------------VFTVGDQYHLNQTASRALAVACRRGATKT-VEYWGDSPIVNIEVMSLPFGRLPVEKPMSLLSQEVQADPTGGTNPFLYNPR-KAGNSQGKVILVQNEPAELLVTLYNPYVFELELQSLSLSTSGPSFDCQALTTIYIPPQSYYHASFTGKATQTGTLIIRGCIVQAMGGAPQEFTLPLPIEGVSEQFSRKRTYLTSEIGRIKSPGLQARSTAKNTKRVSTPNEQVRYLECNVLPEQPLLRMRWTSLTHDAVMLYEGEKSVIHLTLENISSLPIDFLKLSFDDSTIAPAQEALAEGELTVFETYETEYQLINRQAFSCGEDSTTQ---GIRPGEKATLPITCLGKVGCTRGCINIAYAYAQRSHESASNTFHTRQLSWPVNMTVYQMLECSNMTILPVDSDYH----------------------------------------------SEDSLGQDMTDLCMFSIEVRNTYGLPFEVIFESAQEGV---------------EPTATSTIVAPGSSSRVVLLLKRFMLPDPSQTIPTL---SERQFVVAKTALSAEEERRQRELFWYREKLLEVVKGSWKELNGIRRGDLSLRQQRLTLPMLKSLKTDIVKLQMSLAYDDGKP-------------LSRRAGKFLPPPNELFYVNIVVSNTSETALVLFLKVL------ADPSDYVLSDTI----SSDIPLGRLKGGESQTLDIPV 1278
84 0.000e+00UniRef50_A0A165ALS4 Uncharacterized protein n=2 Tax=Sistotremastrum TaxID=139133 RepID=A0A165ALS4_9HOMO  ali  23  6...YASLGCIRVLLVPVGSIRRATFQKWSEIIKSFEHVRLGDIPPDGREDKARFMPAVLAPGHIHLSFQSHPPPQWYYSLSLFRPSEFPLGVIGIADASSADSVSSVLAEFNASLKTLIPQDSF---------------------FPLATNLFAFEEEDGTASMEIGPGAVVIPSVMGHKSIYIGTLIAELCSRILSGFSDLTQSLEVEAALESLNTTLFPAFPYTVSSPVEERSIP--------MNPQQDGLKIIVDPPRPPSAPINPSTLRPLAPSPLNITRSASTPNRQSTLTVNTTNNKNR---------NSGLNQLLSHGRLYKTLGDLFLLAGRTSDASIWYNQAVPLLKSVADDVWHASALEGLCIITVLDAW----------------------NVEAGVTGSTSNSNEH-------------WNSLSEKLDLASSLYGKAYPNSEATLLTLLYTDSVLRHTQLLFAIWAGKGWGSSAFQTMLNGKLPPPSEADMFRMSAITNISRSQISTILARAHGPFIMHLK-HHDRIRVLSSQNLIYRCLGYKRKEAFLLRETLSVVMDLIVSGRRTSRTPNPKTPLTGLGISSAQTGTTGTIGIRELENVEGNQSILSMVHYLCGIHGVDLQAVK--------ILAGDEEVHHANGSTNVEANDLP-VERPPYGWGELQVGVIREAVAIAQELPDHTAIAQFSLSALKLYTNH-------------FSPEEQHQFYMSSQRALTTARRRG-EDRKVEYWSGNPILSLEITSLPFVRMPVERISIASISSSTSTVAR-VDPFIYNPRTKSTSSQA--LAVQNEPIEIVLTLYNPFPFDFELQSLSLRTTGVSFHSQPVT-LQLPPASVHVTQLSGTPLEDGILTIHGCLIQCLHGAPREFVLELPTDAKETDERVKYSGLEARPREKDKRRSGAPVPN-AKPVVNGVHASGRFLRCTVVPEQPLVQIRRTSLNHGAVMLYEGESSIIRLTFENISAIPVDFIDLTFDDSTITATREALSDGSLSTFDAHEAENSLINRPVFQWEPNNAP---AGMDPGQKITMSVTCTGKLGCTSGTVTVAYARTQK-RNSSKESFFTRQIVLPVLVTVYHILECQAMNIVPYSGFDAPELQKLDQAD--------------------------------SEYLTRLQEVEDPHAWCLFVMDVRNVYGSPFEVVIERN---------------QNGASPAIVTETISPGATRRLVIPLLRLSLPSHSKPIPSLL---ERQFVVTRSDLTAEQETLQRELFWHREALLKCLKAHWREASGTRTGLLDLRRQRLSLPMMEALRSSNLLIQFSVTDKPDIPDQ----------VLKWSHRKAEAQPDIFSYLRIRVINASLK-----------SSLLWLSLTLEPHDYVTFGGVLSIPLGLVERGGTHGVEVPV 1298
85 0.000e+00UniRef50_A0A1E3QE09 Uncharacterized protein n=1 Tax=Lipomyces starkeyi NRRL Y-11557 TaxID=675824 RepID=A0A1E3QE09_LIPST  ali  31  16.LSYAAPSRIRAFLCPVGLVSRPRFLDFVCRLQDTAIIRLGDVTPDPRPERVMFSPQGFPDGFVVYNFVTAIDS-HHAFLEDLELYRRTLAVFGLADYNNIND--------------------------LTDLQVVIGAIQAQHPQALIHKVILFDCPLDQNELP-SVDFICVPPKRASRITSLRTTLCDLTSALLAELPLLAKAFQAADTIASPLA----------------------------------------RDDDYDSVMLTSSAF------------THSRSSPAGSTGSLPSTINKDNRISYPLSHHTERQRMRRKGRSMKMIANMYLLAGRTFDALKEYNDALNVLKGVSDHLWHASSLEGIGICMVVLAHIGVPFVIPNAVLP----------------------PLSPSSEKKELEQPQLLDLLQQMTSNILSLYNRSQNFPGESVPQITYAETILRTTNLLACTTLAGGW-TSAARAAAVLSRPIPEVSIPHSQ---FHHAKMNVMNWISAAQAVRL-DGVDAVDAARILTGVAATCGKLGYFRKRGFVLRQLVLELIPRIFQARQVEQNRKSRVPRSDIDDDEYW-EGSRDVHVQPQDLDSGVLAVLSDICTVYGIPVDST------------------------------------SEVSTFGWQDVKTSILKTCIGLCQVIPDFVGIVRYTSMLFR-------------FSAEDLSVDEQLTLIRNFGNAYTAARSMGVQDFEQEYWDAYLVRDIAVVESSLWAVPTLVP----LDAASSNRSDSSGPFIYNPFAKKGEEGKKHLFVLDEPVEFKVILQNPFAFELDILTMSLVGTGTSFSSDVIS-LVVPPRKLYPASIYLTPTSTGVLNITGCRFQVLGCKETIFSMTPTQAAVTPPVRIKNFGLDARSSSMVKIPS---------------PAFVKNVSVEVVPALPVLRVNRISLPQSSLMLLEGERRRFVIVLGNVSTVPATSISLKFTDSTTKSLSAALQEDFRGESDRYEIEMFLHKRAALRC---VTDLNDVKVPANGEAEIEVEVLGKRGLTSACIEISYSHVFDSDVVLKE-MYVRTLTLDINVTVNASIEVAGCDFVPFSYDMPMIRTGDGKATTTDILLKFLDQVG--------------------------IPFEEMDNYCLMLLDLRNSWPSQLAVEIDSR---------------TSANDIHTVKKVIQPGHLTRLLVPIRRIIDIDTSLPIPSLAPPKQRSSVKSLSGNVWKSPEVERTVFWYREELLKVLDGRWIDIDGLRRGAVELRALRISPQMVDIIRVDDVVVNLSLAPSQY--------------IRKSGKYHWIVEADSFITLVTSVTSHSADSVSGILRIQPTLRNLPASIALDINRRILFNGILQMPVVDIKSGDTRRVE... 1231
86 0.000e+00UniRef50_A0A0C9XUE9 Unplaced genomic scaffold K443scaffold_6, whole genome shotgun sequence n=31 Tax=Agaricomycetes TaxID=155619 RepID=A0A0C9XUE9_9AG  ali  24  5..AFASLAHIRILLLPVGAISQSSFDNYAAEIRSFETLRLGDIPSDSKDERARFMPSPLSTGFLHLSFPSHPPPHSHLPLSLLRPSHFPSAVIGVAACSQTETLSSTFSQFNASLLDIFPSGAI---------------------FPLARTCFVFEESDGNTTTECPPGLVVLPSMMGNKKLYIGTLLADLCSQILGEVGVLVQAME------SPLGNEYLNASLMPILPPLSD-----IPLPLDRGDSAIQLTSHNSQPEMSRASFNLTAP--------PPMKRNVSSGPAFRQASLGIQAPKKRLSTIGTSSS--------HGRLYKVLGDFFLLAGRIEDATIWYLEAIQLFKNSNDSVWHAATLEGMATILIVEAWS-----------------------------------AGHGLYDSTVPLKEPWVEACEKLTQATTLYHKSSTSDGEPIHSYLFCSCVLRHSFLLFSVWSAKGWGPPAFTAMLQPGTRPYFPPNLERLSSISGVSRSSISATLSQLHGPWLLHLGS-RERVSILEAMASIYSCLGYMRKEAYILREVLGCLLDLMVCGREEFSYPSGVPSSAGLGIQGVGWGSVGVRLSESVDGNSSILHLLIYVCQVLGINLEAVRMINSVDRLASLANDRESILKYEEEVMEGF--------KEPYGWPELQVGVVREAVAVAEALPDFPSVAQFALSSLK-------------ILQSVLSPGDQFHLYSTSTRALITASRRGDA-RSVEYWSGRPVISIELAPLPSVRLPVEKPWSQLKFGDPTPLLQGRDPFLYNPR-KALVDKEKSLVVENENLDFLVLLQNPYIFDLELEKVSLSTSGVEFESESV-RVVIPANSIHQVILSGKALQSGVLTIRGCIVQALGGVPREYILPLYSNEEEQKHLRKRSLQACEAGRTKHPDKERRVNVTQGIIEQSTITSFRFLECKVVPEQPLLRIRRTSVTHGALMLYDGESSTIRLTIDNISSIPVNFLRLAFEDSTIAHAQQTLAEGNLSVYDTYEIEHDLINRPVFSW----TSDESRPIAPNQNLTFTLLCFGKVGCTHGTIHISYAHL-AHQAPAPEVFYLRQVSYPLTVTVYHMLECCNMEILPFPSYAA----------------------------------TVHKAGHPREGVTKGLVVDQSSGWCLFSIEVRNTYGLSFDVKFERIKDGATVAS---------------IFATISPGSMSRLAIPLNKIVLEQLSRPIPTL---SDRQFVVTKTGLSEAEDRTQRELFWYREELFKSVRGHWQETGGVRTGELSLRDQRLTLPMLKELRLEAVEVAVKL-----------AMCEDEGSSLQQSGTKYYLKSSKFIHFCTRITNLSDSSLVFTMDIE-----------VDPSDCVVCEGALTIAVGRMRAGESREV.... 1290
87 0.000e+00UniRef50_A0A1Y1Y685 Trs120-domain-containing protein n=1 Tax=Basidiobolus meristosporus CBS 931.73 TaxID=1314790 RepID=A0A1Y1Y685_9FUNG  ali  24  6.LSLTDPCKTTVLIVPVGDIKPAAFQKYASLISKFNVINISDITPYRADEKARFTTNLFKEGSIHFNFITSY-DKELAYLEQFQIYRQVLGVIGIIQCQ--------------------------GSTNLSEEYQKFTSTLNQYSTCLVNRCYAFEPSDSQADD--TKGVIMIPNV-GNVTFYMNTMICDFASSMLNAFGTMAASIESSPAIPSPK--------------------------------------SCDKHLSTPAATPSNAFPPAGNFLRSPSPNVDSPTSATSLSTP------------FSASTPDARVRKRTQGRIYKLVSDLYLMAGKLPDALATYTNAIETTRNNTDFMWHASALEGYYCALILLADIQ-----------------STEESATSIPIPIFPSSSFSNSNTGPVVRKSLFGEFVERFRNIIALYDKIDI-------PCLQVESRLKGAKLLTIILKFG--TGEAALNAILDDRI--ETQPPSGTSAKSHVLKAELMNLLMQSWNI-ARENISSSYQIRVSSLMAAMCATINYHRKAAYFLRQCALVAAPFI--------------------------ANSELSNSSLRRVKAGLLEGMRRFCDVYGVNVISVPEDEEVEEVDS------------------------------YGWPDLQVDAIEDCINISDGLSDPEQTINYTIRLLRKYHRAL-------------TREEQLRLSFTLQRIVNNKDSPVELT---SLTKSISHLPVLKALDVCRPVPARVSYPQRKQKIADAECSSADPFIYNPYAKKSGESIAVPLVVNELSFFDVNLVNPFAFDLDISSIRLSTEGVPFNSIS-SAAVVPSGSSISLRLSGVPQASGELVLRGCFIRLFGCAEEEFLLHKNEKKNEDKWKIELDHLKRVKQSGLDSTSYRAEKRLSFKRSSAKFTESKFHIVSVIQEQPLLEVTSTNILNNSIMLFEGEKSHVDLVLKNMGTTPIDFLAFSFTDNTIDSPQNHHYSKETSAESLYEVEIAVHNDPVLSLEEADHNLASGAIKPGQEHKVTITTYGKRGCTNGNIIINYGYLERA-DDESDIFYTRQLNLPVLITVNQGLSVLDIELLSFQRLESLDSQSPLKSSTPDGTVRRKDISTIEN-----------------FVSSRIDRQAKGD-YCLMILDIRNVWMLPLEVSIAMNENDTITSDWE------QDPNVRCYSTTVHSGCTHRLILPFKRIALSEEILEQPIPNVTNKQYTVPKGPKLTKEEEKLRRTMFWYKQELLKHIHATWVSESFEHRGVLHFREFRLTEAMLESLRKEDITFGASLVDVAGDADKSSQPS----AIKQLDANRYSCRPNDILNIQFDIHNHQDIPARLCLRIQPVHDHYNGRLDYELSSFMAFNGPTQTYLQKIPPQKSIQWRLPV 1260
88 0.000e+00UniRef50_A0A0D0BRG4 Unplaced genomic scaffold GYMLUscaffold_41, whole genome shotgun sequence n=1 Tax=Gymnopus luxurians FD-317 M1 TaxID=944289 RepID  ali  22  6...FSSLAQIRILLVPIGTISHQTFEKYASEIRSFDAIRLADIAVEGRDERARFQPKPLSTGYLHLSFPSHPPPHSHQPLALIRPSHFPLAIIGVTTCSSPQILPNILAQFDDTVTDMFPASGF-------------------YP--LEKKCFVFGASVAISSSDQHPELVVFPEMMGNRKLHIGTLLGEICSTIFGEFGVLIQRLESPLGNEYLNASVFPTLPALTDLPPSLDNKDTLPPLPSHNSQPEIS-----------------------------KSALSKVAPAMKRNSSLGVPTVRKRLSGIGATSS--------HGRLFKLMADFFLLSGRTEDAIIWYAEALQQLKSPLDSIWNASALEGMATIPVLDAWS-----------------------------------AGHGLQTSTSAGREPWADVADKLVQASTLYFRVPPSEAEHYPSYLYCCCVLRHTALLFAIWSAKGWGPLAFTTML-QPGPTPYLPPTLSHSESTSWANLERLSSLAQVHGPWL-LHLGPRERISVLEAVASTYSCLGYRRKESYILREVLGCILDLIVCGREEDAHTNM--------RSFGNKGNVGIRLNESSDGNESILRLLKQICKVLGVNLDAIQLI----------------EPNSQLTSQTDVDNDSDVYREPFGWPELQIGVVRESVAVAEALPDFLAVAQYALSSLKTLQEFLEPG-------------DQYHLYSTAARAMQTARRRGAIK-AVEYWSGRPVVSIALAPLPFIRLPVEKPMSVLEPRSSDSNAIGTDPFLYNPRRINTS-QGKPLVVQGETLEFILIVQNPYVFDLELQSLSLSTSGVPFESPPI-PLVVPARSYHRVVLSGKALSTGNLIIRGCGVQAPGGVSREFILPLATEEEEERGRFKYSGLENFPWEKKGKLSGNESSRTSKAM--------SFLECKVVPEQPLLRIRRTTATHGALMLYDGEMSSIRITFENISPLPIDFVRLAFDDSTIAPAQQALAEGELSVFETYETEYALIHRPVFSWNKNDS----VAIGPGRKVTLTINCYGKVGCTEGTIHASYSYIHRNSPDISSVFHTRQLSYPLMVTVYRMLESHGMDILPYPSYPVDLDTKHATRNSNLF-------------------------------------VDDQGAWCLFSIDVKNTYGTPFEVSIERVQEGVPWGEAV---------------VNVPPGSTSRLVLPLKKFLLSDEHVSQPIPTL-SDRQFVVDKTKLSDAEQKMQRELFWYREELFKCLRCQWREAGGTRYGDLSLRQQRFTLTMLETLRTEKASVSLSLVRSQDSAPVEE------------RAGKYQPPSSELCYIRIQVTNLTSYPLVFTVDV-----------DIQPQEHVIFDGVLCIPVGRLDAKASRVVEVAI 1257
89 0.000e+00UniRef50_A0A067M8L4 Uncharacterized protein n=1 Tax=Botryobasidium botryosum FD-172 SS1 TaxID=930990 RepID=A0A067M8L4_9HOMO  ali  23  5..SFSSLARVRILLLPIGPIKRSTFDKWAALIRSFEHIRLGDIPPDSREEKSRFIPSPLSTGFLHLSFPSHPPPIYHGPLSLFRISSCPLGVIGIADATETTSLAFISAEYNTAIATYFPSTSA---------------------FPFAGKCYAFEDGDGNANINNSSGIVTIPSVMGNKKLYIGTLLADLCHDILAEFPSLVRALDSPGGLESLHSNLFPSIKLGSADQPPPN------------------VVDPNTLDPTRPYSQAMEGVASTSTVHIRRTSTAVVTSTNVQPMLAVTGTAKKRASTINTGASS--------GKLCKIIADLYLLSGKLVDAHYWYGESVSLLKSPQDTVWLASAYEGFSTIEVLDAWQVIE----------------------------------TMSETLESIIKDPWADISERLGQSTMLYAKSAADSEYASLTLIYTSAVLRHSQLLLSIWQAKGWNPRALRTLVQMSSSPSLSADLFEMSSLTSITRSQIATVASQAHGPFLMHLQ-PHDRIRVLESLASIYGCLGFKRKQVYVLREVVAAIMDLIVCAREEAQSAGGGADPTLLKVMDLEKGMVGVRESENVAGNDSMLRLVRYVCDVYGVDLGAVKVLS---GDSNXXXXXXXXXXXXXXXXXXXXXXXXDGKEHTYGWPDLQVGAVREAVAVAEALPDYPAVAQFALSTLKQLHAYLTP-------------SEQQHLFATSSRVLSIARRRGD-DRQLEYWSGRPVISIEISPPSLLRVVVERPIRDLMPRSSEMTKVTRGPFIYDPRLK--SSTTQTVAVQNEPLEFVLTLRNSFAFDFDIPSLTVSTSGVPIQVDPI-GVLVPASSFHVVRISGTPLGSGTLVVRGCVAKLADGIPREFILPLSTEEEEGRLKVKRSGLSARAVERAKEKNRMSTTVVAKKEVL------KFLECKVVPEQPLLRVKRSSLMHGAVMLYAGEISTIRFTLENISTIPVDFVKFTFDDSTILPAQTALAEGELSVAEAYETEYDLVHRPVF--SRVPPVSEQLDIGPGKQVIVDVSCLGKPRCTSGVVQISYSYARRHLPTAPDVFYTRQILYPILVTVYHALECHDMDIIPFQKIDAP----------------------------------LQSDGDDERVRRALLDVNDEGDWCLFSVDVRNVYGLPFEVTFERKQEGVPQALA---------------TRLIAPGATSRVLLPLRRVSLPPSVTSQPIPML-SDRQFVVSKSHLSSAEESIQRELFWYREELFKCVRGRWKEPGSTRTGELSLRTQRFSMPMLKSLRVPRFKAEFSLEGQDG------------HVSSISSNGKLIARPNEFSYLRARISNLSDQPCTLSLTYD--------LIPPTPGEHVVVEGSLQIPIGLVAAGEVVE..... 1305
90 0.000e+00UniRef50_A0A0C3PVT3 Uncharacterized protein n=3 Tax=Sclerodermatineae TaxID=227327 RepID=A0A0C3PVT3_PISTI  ali  20  5..AFASLAHVRILLVPVGPIPSDIFEAHAAEIKAFDSIRLGDIPGDAKGEKARFMPSPLASGYLHLSFTSHPTSPAQAPLYLFRPSLFNHAVVGVASCTPSYTSEAAQEQLENIFIDIFPESSTPPPSKV---------------------CFVFQSEDSGNINDVPPGLVLIPSVMGNKKLYIGTLLADLCSQILGEFGRVVHVLE------TPAGNECLNAALFPVLPAGGDMSTRINSHPYLPPPVSATATSSQFELSLNTSVSANYGMKHNSSVGPGLHPSSSSHRASTLPPLK---------------TRTSAVGITSHARLYKVYGDFFLLAGRMQDAKIWYQEALILFKTGLDPAWQASAIEGLAVTSVLDLWATGQGLQTSI-----------------------------------SDAKEPWMELFEQLSQAISLYLKSATTRDYSLLAFLYVTAVLRQTSLLFCVWSSKGWGALAFASMLQPEPSDNSVAGLDRLSAITGITRYQIANTLSQAHGPWL-LHLGAYERLVVLQSIASIYNCLGFKRKEVYILREVVSCVMDLVVCGRGEGSVGLTIRTEPAVVDESEAPTLGNVRRKENLEGNQSILKLLYYACKVLGVNLESVPAPTENRDDSKAIDSETESRPQWE------GPGRSETLRVQFGWPELQVGVIREAVAVAEALPDYLAVARISLSALKTMYS-------------ILATADQCHLYQTASRALNTLKRRGDATT-VEWWAGNLAVSIALLPLPSRRLPIERPVSLLNSTLPSEHPLTTNTFLYNPRES-VNVQDKGILVEGEAAELIVTLHNPFVFELELQSVSLITSGVAFDCGPVSSIVIRPNSFYNIPVIGIPKESGSLVIKGCTIQAPNGAPGELLLPVSAESDEGEQLRRRNDSERTKYGGLEALPWERDGKRLSATVPPSKSKPRYLECLVVPQQPMLRVRWSSLTHGALMLYDGEKSNIRLTLENVSDLPIDFLKLSFEDSTISSAKEALSEGELDTFEVHEIEYDLVHRKAFSW---QQDDDVKVVNPGGKVALSVTCLGKVGCTSGAIHVLYAHAHRQGKGQTDAFYARELTYPLTVTVYQMLECYDMSIMPVDA----------------------------------------IDSLPSRTNVPTVGADDFHHWCLFSIEVRNTYGLPFEVMFTRSQDGLEDETD---------------SSIVSPGCTSRIILPVRRLRLGDDVISQPSPTL-TDRQLVITKSNLSKEEEQARREAFWYREELLKIIRARWKETTSNRFGDLSLRQQPVTMHMLNAFKADQVHVDMSFIHPDAEH--------GSPMPLKRSPGKFVVPPNTIVNLRVQLTNTCPSRLAMTVTLLP-----------SPEEHILFEGVLNIPVGTVEGGQSKAVEIPM 1305
91 0.000e+00UniRef50_A0A0C9VAS1 Unplaced genomic scaffold SPHSTscaffold_44, whole genome shotgun sequence n=1 Tax=Sphaerobolus stellatus SS14 TaxID=990650 RepID=  ali  23  6...FASLGTIQILIIPVGNVNEHSFKKWASLIRSFDTIRLGDIPPDSRDDHARFMPAPLSTGYLHLAYPSHPPPIWHAPLAVFRPSDFPLGIIGITEGSANTSLSSILAQFNAEVAQLFPPNS-------------------QFP--LAQNCYVFEGEDLDASNESHPGMVVIPNIMGNKELYIGTLIAELCSTILGEFASLLRTLESSAGIETINSYLFPIMSNLSDSQSRP--------------------------SISLSEEQRSSTPSVIRSSIYGPGRSVPSRAVSMMSPSSKASHRHSGMS------------VPPTGRLFKILGDLFLLAGRNSDAAVWYGESLTILKSPQDTVWQASVLEGLCTIQVLDAWNAGQGAQTSITN----------------------------------EGKEMWSDLNDKLTQAIQLYSKGTPWATSSAPEYLYTQSVCRQTSLLFSIWASKGWGPLAFTTMIHPGLPPAFVPHLTRMSSLTGISRTQIANTVAQAHGPF-MLHLEPHDRIRLLQYMATIYSCLGFRRKEVYFLRELLSTVMDVLVCSREE-ASKNTRDRNSILGVPETANVGLRETESLEGNES--IIGLIKYICEVHGIDLTNVKL----------------FDPDADIMQAGSDDETMDGCKTQYGWSDLQVGIVREAVAIVEALPDYATVAQFDLSALK-------------ALRTVLNSADQTYLYTNSAKALLTARRRGDG-RRVEYWSGNPVVNIQVTPLSTIRLPIQHHARDLFPRETETSVAIRDPFIYNPRLVASSTKSKIILVQNEPIEFILTLQNQYSFDLEIQSLSLSTSGVPLESQPLT-VTIAANSYHVAKITGNALESGILVVRGVVVQMQNGTSREFIVPLATDEEEKNRRFKETGLDARPWLRSKRVSII------QEKTLKSPEQLTFMQCNIVAQQPLLRVRRTSLTHGAIMLYDGETSHIRVTVENVSSIPIKFLKVTCIDSTMAPAQQALTDGELSVFEMYETEYELLHRPMFRWDPDN---EPKSVPPGRKAVLTIVCSGKIGWQVTLRILYFTRTNPSESLTPSTFYTRQVIYPILVTVYNTLECYDMDVLSFTTPKAF---------------------------------LQSETHNDYEEWKQVLETLPEGDWCIFTVNVRNTYGIPFEVNFERNQEGTSRNTA---------------TRLVAPGSTTRIIMPIKRLLLPESQKDIPTL---SDRQFVVSKSKISTKEARHRRELFWYREALFKCVKGTWKEAGGVRSGDLSLRQQRFTALMLNALRTDRTSLKLAIVGYDNEAVSPEERN--------------FCRPNHFVYLRAALRNQTPNPLILTMTI-----------STSSAEHVLYDGVTNVPVGRLESGEEQQLEFGV 1267
92 0.000e+00UniRef50_J4IA65 Uncharacterized protein n=6 Tax=Polyporales TaxID=5303 RepID=J4IA65_9APHY  ali  22  4.LAFGSLAHIHILIVPIGNIHRATYEKWASEVRGFETIPLEDIPIDSRDDRARFMPTPLAKGHLHLNYLSHPSSLSHNALSLFRPSEFPLGVIGIASCSQSDSISSILTAFGTAMSGLPLQGSAIPAT---------------------RNCFVFEDSDVGLDVGDRPGLVIIPGMMGNKRVHIGTLIAGLCSQILGQFAAVMQSLETPLGNEYLNASLFPNLPPSSEFPKPLDSSGGFRDPAPLPARNSQPDLSNGSSRSKTPLGAKRVSSGPGLA----------PIRHASLPPTPATTKKRPSAIGAAS----------SHGRLFKVLGDLFLLAGRHADSSVWYTEAIALFKNSQDAVWHASALEGLATIPIVEAWS------------------------------------SSNSMLSSDNEKEPWQDIMDKLNYAQGLYHKTAPPSGSHVHQYLYAQCVLRQASLLFAVWTCKGWGSNTFANMLHTLPPKATYAHMERLTTITGISRAQIAGVLAQVHGPWL-LHLGPRERITILQATAGMYGALGYLRKEAYILRETLGSIMDLIVCGRQIGIRDSGSSSMNRGLAQPGASTSQGTVGIRENQRTEGNDSLLRIVKHICRVHGVDLETVRLVDVSAVSQATSRQDRDMTDDVSNADDDDLSELPQEPFGWPELQIGIVREAIAVAEALPDYPSVAQFSLSSLKMLHPVM-------------SQSDQFHFYHTATRALATAIRRGD-RRTVEYWAGRPVISVEVLSLPLIRLPLEKPLSLITTKPNNPSSGSRDPFLYNPR-KLMSGQTQSILVQNERFEVSVTLRNPFIFDLQLESIALSTSGVRIESEGM-PVIIPSNSYHPVTISGRALEAGTLVIRGCTVQAPGGVPREYTLPLSSEEDDQRLQRRTTALAGRSKRSGLDSRPWKRVDKQAKRQSARTTTIRYLECNVVPEQPLLRIKRTSLTHGAVMLYDGETSTIRLTFENVSLLPINFLRLTFDDSTIAPAQQLLTEGELSIFDTYETEYDLISRPVFFWDSSQGTH---QVDPGEKTTVTVKCFGKVGCTSGAVHVSYAYIDRHEVPDKSLFHSRQLSYPVVVTVYHMLACHAMDILSFSAITNYASSMLTADDPVALEREWGQ--------------------------KGVWNVDDAADWCLFTVDVRNTYGLPFEVTFERSQ-----------------PDLASTTRLVPPGSTSRLILPIKKILLSEEHRPIPTL---SDRQFVVAKSALTSAEEKAQRELFWYREELFKVITGRWKESGGTRTGTLSLRQQRMTLPMLETLRTETVRVQMSLF-------YRDEDGVSKDVAVDPTRSKYFASPNEFMYLRIKVVNMSPLELVLTLNL-----------TLDPAQHVIHQGTLDIPVGRLAQAESRETEIPI 1330
93 0.000e+00UniRef50_A0A2A9P178 Uncharacterized protein n=1 Tax=Amanita thiersii Skay4041 TaxID=703135 RepID=A0A2A9P178_9AGAR  ali  22  4.FSFGSLAHVRILLVPVGSISQATFDAYAVEIRSFEAIRLGDIPADAKDERGRFMPNPLSSGHLLLSFPTHPPPHSHHPLTLFRPSHFPLAVIGIAVCSQAESLDSLDSIYAQFHDSLVDMFPP----------------RSIFP--LAKNCFVYDESDGTTNPNLTPGLVVIPNVMGNKKLYIGTLLADLCSIILGELSLVVQVLE------SPIGNEHLNSSLLPLPPPPSELPHRLDSSSSGTSQLPSHHSFPDLSRNNVLLGPAPTAKR-------------SASGSAFRQSTINVPTAKKRMSTIGVASS--------HGRLFKVLGDLFLLSGRIEDASVWYTEALQSLKTSQDSAWHASALEGMSTISVVEAW-----------------------------------TAGHGLHSSTSSSKDPWTDISERLAQATSLYQRSAITEGEALLSYLYSSCVLRHAFLFFSIWSAKGWGPLAFTTMLQSGPVPYLPPNLERLSTMSGITRSFISSIITQAHGPWL-LHLDPRERISVLEAIAGIYACLGYKRKEAYILREILGCIMDLIVCGREELSRPTNVPGINGLGIQGIGDATVGVRFSESDEGNISVLRLLRYICRVLGVDLEAVKLVNLADEAADTVDPFFADAELESGYHELR------------GWPELQIGVVREAVAVAEALPDFPAVAQFSLSSLK-------------VLLPILTPPDQIHLYSTSVRALSTARRRGDTK-CVEYWSGRPIVNVVVAPLPLSRVSVEKPLSALRPRTSDVTPILSDPFLYNPRKAARGNN-NFFVAQNEILEFAVTLHNPYVFDLELQSVSLSTSGVQFHSQPTK-VVIPGCSFHQIVLAGTPVSIGTLVVRGCIVQAPGGSSREFILPLLTPEEEERLAHQRSVMCELDRHKYSGLDCLPWKRTKKRASAGKQVVSRFLECNVIPEQPLLRIRRTSVTHGAVMLYDGERTSIRLTIENVSHLPIDFVRLVFDDSTIAPAQQALADGELSVFDTYETEYSLIHRPFFSGIKVDSI----CVAPGQCHTLTVQCFGKVGCTKGTVHISYAYAHRPESEATNLFYTRQLSYSMMVTVYQMLECHAMDILPFPSYSVTRNGH---------------------------------------VEEEDILYVHEPGWCYFSIDVRNTYGSPFEVILERLDESTNQNSTST---------------ILPPGAMSRLVIPIKKFSLPSEQKAIPTL---SDRQFVVAKSSLSSTEEQLQRELFWYREVLFKVVRGRWRELGGTRFGELSLRQQRITLSMLDALRLETARLSLALTNPQGNGSGNK-------------------RPNIFLRLKAKIQNLSPSPAVFVIDFR-----------LEPSEHVIYEGTLQVPVGRLVSGDSKDVEVVI 1277
94 0.000e+00UniRef50_A0A0C3QMP5 Uncharacterized protein n=1 Tax=Tulasnella calospora MUT 4182 TaxID=1051891 RepID=A0A0C3QMP5_9HOMO  ali  21  4.MSFASLAQIKILLLPVGRISQQSFEQWANLIRSFDHIRLDEIPPDTREGQSRFMPAPMSNGYLHLSYPSHPPPPWHTSLSLFRISHFPLGVIGIADCSNPDTPLTSVLAEFHATL------------------EQYFPVESAFP--LASRCYAFEEGDENPQVSSDPRLVVIPSVMGNKQVYVGTLISELCTEILSSFANLAKALESASGITALNGQQLPVISRSDDLGGHFMQYTFGLPKKSRPSTFSHSSSFNSVSSMRDSMETPSNGIRPHPHRATTGMPASPSGSMLTSPASKKRTTTYMSATSN--------------GRLGKLVADLYLLSGRTSDAVQWYVESLAQIRGPQDMIWQASALEGMCLAEVLDLWSATDAPLPPVPGSKPPWSDISARLEQAVSLYSRASPAMSSPTPSGQPL-----------------------DTESPTLSLLLCQAALRHAHFLLSVWSNKGMGRSAFDTMLGQTPTSPSEGLFQRMSVITSIPRSLIAEAINSAHGPHIMNLLQ-RDQLQVLSLMAAMFSCLGFRRKEVYILREVLAVIMDMIVASREEATAKAAKAIMSGNSAASLGAGTVGVRANVSNDGNESILRVVKYVCDIYGVDLSKIGITRPESDPPEDESKGDNSTIAASEEDEGTT--------EAFGWPELQLGVVREAVAIAEALPDYPALAQFSLSTLRVMNPHL-------------THSEQLHLYTTSGRALATARRRGD-HVVVAYWASKPVLSLEITPLPFSRTPVQHPISDLEPRLSGQAASIRDPFIYNPRLKSAS-ASEVVTVQNEPMEFVITLYNRFCFDLEVQSVRLSTSGVALRAMPVS-TLIPAESYRVLRINATATEPGVLTVRGIWAQLPGGAAQEFLLPLASILDAESLRTKSSGLAARPEERS-----KRRQSLVEAAKAAPPASQTFLTCKVVEEQPLLRIRRTTLSHGAVMLYNGETSTFRLTVENISSIPVDFVKLAFDDTSISIAQQALADGELSVAEAYETEYDLVNRPVFSYQGI----SNQSIGPEKKATIAVTCFGKLDCSHGSIQISYSFAHRPRESPTDVFHTRQIIHPVEISVFETLRCETMDVTPFWHTNVSGSEDP--------------------------------------ILGNLFQINNPDQWCLFSVEVSNKYDAPFEVTFDRVQDES----------------KDSTTRLVSPGATVRVILPLKRLSLPGAVTQQPIPTL-SNRQFVVSKEKLSVTEEQIQRELFWYREHLFKSLRAHWREPSSGRQGEVYFRSLRLTMPMLRALQTSPCKLQITLIRQEDDNEA------------VRRGPKYIATPCEFYFIRARVTNYSTSPLSFSLSYVPA--------YFGLMDSALFDSSLQIPVGLLAGGDSVEVDTGV 1334
95 0.000e+00UniRef50_G1X9Y2 Uncharacterized protein n=3 Tax=Orbiliaceae TaxID=47021 RepID=G1X9Y2_ARTOA  ali  30  6PLSFTAPSHIRVLLAPVGRIKRAKFYEFVERLQVVNTVRLEDVSLDSRGTKSL----------------------------------RRYQVIALADYHE--------------------------RNSVADLRAGIQDLNFQYPKALLFPLVMFDTP--------------IGDDLFSRDTHLWKEDGEVSSNV---------AEYPKLTIPIPSKYESSVASIKSVMSDLTGLLLSGFSRLSK------------DLQTLPTIEAPASGDNERPRPNTRMSLPVPGTLPNPALSNLGVGSRLTTMTGFGNATISEKERSRGKARINIAIANLHLMTGFVTDAFREFTEGALAAKNSGDFLWHGKALEGIGVCLVIMAYMGLDLQIPTVVFPATTPLSETK---------------WKLNGAVTETLETLFSMMPELLNTILGLYSRAGTFNSEPAPALVQSETIIRFCKLMVVAQQCHG-LNANSLGHIVLGTPLPANLGKPQMK---NLSRGDIASLVMKAYPNNLQSL-TVVDAASILGGMASVLDKIEFKRKKALVTRELLKLLVPSLIQARVVGAAETGLHPTASGGEEFRPASRNGPSRPGTPQPQEGQGGLDGDEADIVRTSRLLDDLCSAYGITHDTLSQAIETSTDEEKNTLLRKNLADANHFRSFGWLSLKVGVLRSCILLTEAIPDYEAILRYTTKLL-------------EIAGTELSKGEQGKLAESFTRTVGLARKSGLDEGVAEYWDDYLLRDIELVESQIWKPPIPHAAAELSAVTEAAK----NPFIYNPFASKSSTTIKTLLVESEPVDFLITLQNPFDFEIQIDTVELDVTGVEFQTLPAS-VVIGSYRQHTYVITGIPQSSGTMKLLGAKIKVYGCKEKFFPIVPDMVPVDGEDKIKKVGIGAMKLEHPRPKSHISSNSNSQIPQPTFGPDLKQLSINVIPSQPKLSITHTSLPQNAIMVLEGEKQLFTVHVKNESSVAVDFVTISFVDSTTEPVTNAISQKQGLPAEVYELEVILYKKKAFEWIR---PEEKVTIQPGGTGVFKVQVLGKPGLTSGKVVVDYGFIDRDEGEGSGGWYTRRTETDVTVTVNAAVELVRMDFLPWSGVSSSLIAEHP-----------ETQQLSNGNGEFSKSKFPTRNEQVRELFTRLSNVDNPSTYALVLIDIRNSWPHPLRVSMGFDPAEEDIG--------TGDDMRFTASDTIPAGHSTRLILPLKRVYVSNPTAPIPSLS-KTQRQYVVSLTKVSPELERVTREGFWYKEAVLKRISGTWEEVGTERQGVVECRNFRMGSRGVDVVKAEEVEVTVDLENDGEAGDGAE--------VKSTGRGRWSVKTDHFFKVKVSVRNRGLKKVRLISRILPCLRFVTGNSGLEMTRRAGFNGTLQKSLGWIKGGEERTIEMGM 1309
96 0.000e+00UniRef50_A0A120E7F3 Uncharacterized protein n=1 Tax=Rhodotorula sp. JG-1b TaxID=1305733 RepID=A0A120E7F3_9BASI  ali  22  72..SFIQPAKLQVLVVPVHPIKRATFEQYVQLVKQYAAVPLADVPPDRRGDRAVFSANPSSSGSLLFDFVTYAPLRPLSFLAELQTHRRVQGIIGIFDASEYS------------------------QRPLEEALASFQASLKNLPKTFATKVYGFGANEAQVEQKESDGLVTVPS-QGDVGFYLKTFLAEFASGILWEFSNMAAQLESRTSIPTPQPDSVSLQRAVSRASVDSYTVPDRASTPDSRTPINGVPLLGVAAPPQSHPHTVPTGVSAAPKRESS-PYGSSPLLPPIKPILPTASAT--SGVSSSAQLVDARARKRVAGREKKLMGDMWLLSGRPQEAIAAYNEAILLTKAWSDQVWQASAYEGVAVALVL--------QATQPRGSQGTHPPSLTPQRSESPASLGPAPDISTFLSAIPERLTLATTLYEKMLAPLNSSRDSAGALDDRAHPLLYVEACLRSAKFLLAVNEARGSIPKALKSLVSPTSPVPSRARLNSLAPSNTVPRSSIAAWLDSAYSPHLATL-SVVTRTRILADIASCFGRIGYRRKEAFVLREVAALCADSAASHQASLALQDPSGNGSLDLRIDTGSKSSRNGTNGKTDTQLQILEVLERVCSAYGLDPGPTGDNH-----------------GTEENASPIEPTQTSSAENRFGWPSIQLGVLQDATRMAEIVNDYQNAIRFTILALRT-------------LATVISPEDQIALCREIPRIVAAATRSGMPLILDYWGPPQIVMSLEIAKLAKSRQPHKQRMPDAAAEGSGTKPTTTNPFLYDPRMQSSPSRDEAVLVQDDIAEVFVTLQNPFLFELEIAALSLSTRGARFASETIS-VVVPPASLQTVRMVGTPLEPGTLQIRGCSVQLAGCKSREFLLPKSTSTEPDKTPVKVNSRPERIKHTGLDALASRTTAAATSKESGGEAENRFLECTVVPAQPLLWMRSTSLTHGALMLFDGETSTIRITLENASTVPVDYVHITCADSLTTATRQYLSDAELEAAEIYELEVDAVERPVFRWLGSQGFS----IAPGSSRVLEVECRGKIGCMSGSILVDYGFRGNATRPADETLWTRRLCCDVLLTVHQTLVAHSLELSHLRSTAR---------------------AGSAHARSASVVSLGQRGAAVDSRLEDNLRDVADGEHCLAQIAVTNVSSKPFEVKLERKEEE---------------NSFYLERKRAEPGSTHVMLVRLDRLCLEQVERPIPSL---SEKQFIAAKVKRSAEEERLERELFWYRQELLQRIRLVWNEVGSLRTGEIGLQALKLEPSALDILRQDQVQIQLRLSGE----------SVIVGHRHGRSPPAHTAAADDFLAVEARITTKSGTSSLHWLSVLVPPGSPPTPLALHLARYVVIEGVSPIDVGMVDSEKEATVSIPI 1430
97 0.000e+00UniRef50_A0A1Y2GAD9 TRAPP II complex n=1 Tax=Lobosporangium transversale TaxID=64571 RepID=A0A1Y2GAD9_9FUNG  ali  22  6...FTSAARIRVLLVPVGPIKKATFENRVKMLRQHNSVKLEEVWMGPRTENSFFSQNVPHEGQLYFNFTTSY-SAEHQYLEEFQMHRRVFGVIGIMDCQEWPD------------------------GNMAAGHQRFQQILSKYPSAIANQCFAFDPSEQHPDDLRGGGVIMIPNV-GNTSSYLRVLICDLARTILTEFENIASAIGKRQDIESPNPAVSVYARHGPMPLTASVTSMPDMSTLTAPPSAMTT--------------------------------SGSSTHSRALSSAGFTSIASGNQYVQSAVMTDQRLRKRTAARAQKLYGDLYLMAGRISDAVSSYQSVIEATKSNSDFLWQANAMEGLYCAVVLLAFVQAD-----------LAQFHQQQVAQTIISPTSPTSNEHAKIQNTPVIKPLIVDIPEKYQAILTLYNKV---PGNATPPILCVEASMKVTKFIATCFVCGGILDDRALAAVVSGNILMYSPMTQSPSSSLGITRTDIMNWIAKTWTGRLEELW-IVDQIHFTLSIASVLGAIQFRRKQALYLRYAVRMITPLLHQTRLAHASAAQASGNPLKKPMN---------------MDHGVLGCLTEICNVFGVGENFTSSNNL---------------------------------YMDHGWPELQIDVLYECIRVAEAVPDYKAMMKFSTTLLRQLH-------------AYLTREEQAGLYASLPRILAAARKTGSSDLETHYWTKILVVDIEVCSPSARKIPFTRSKDTLESKLTTKSTGEIDPFIYNPFHRKVNNITKLDLVAEETAYFIVTLTNPHGIDLEVQEIRLSTSDIEFEPIPTSTMI-PAQTTVSIKVGGVPKHPGELVIRGCWVQIAHCAEHEFFVINPSKNGSDNSNKNGTASNSSEPLVRFKKRGLESFTLVKPVNDDVVTEPRFTTVTVIPKQPLLKINSTSLQHGSVMLFEGEKTTVRLTLENIGSIPVDFVTLTFSDSTQLALGNHYGNTELSSEDAYEMELFLKKTNVFSWNRE----VECHIPVGGTHEIMVDVLGKRGCSSGMIQIDYAYLNREDDEPSTYFVTRQLFSQVLMTVYKTVESLNLDILYLQSHGGMDIPATEP--NTPVLDDFSANSHATFSKANRDSALPKLDFSNDGFLAPPSNSNDGDGTKTGLSPQSNDNKQPISKRLSSNFAKIDKGQSVEQLLSKARGDAILPGEQIEAAISRRVALGTKNLDVNKLIKSTTVIQPGNTQRIILPVRRMALSTEQLSTPIPTLSNELLKRVVARWTCDTSGRYGKFDLRNLRLNKSMLNVLKIEDISFLVAMEPTA-AMQRKSVDQGLTKGLEQIGSNRWRCPVDQFAQIRVTVVNRSHIDVKLCLRMQPVQVHGDGTMDYDMGTRMVWHGVLQAPLAKMQPDSTTSHVLPV 1443
98 0.000e+00UniRef50_V2XCS6 Hypercellular protein n=4 Tax=Agaricales TaxID=5338 RepID=V2XCS6_MONRO  ali  22  6...FASLAQVRILLVPVGPISSHSFEKYASEITSFDSIRLGDIPEATNDERARFTPKPLSTGHLHLSFPSHPPPISHNPLSLIRPSHFPLAVIGIASCSHPDNLGAMLAQFNGILMDMFPGGSI-------------------YP--LAKNCFVFEEGDGTCSSESIPGLVVFPGMMGNRKLYIGTLLADLCSHVLGEFSILISRLESPLGNEYLNASLLPTLPSLSEVPMSLDQIPPLPSHSSQPELSKGGV---------------------------------STPQMKRNSSLGVPTVAKKRMSGIGTASS--------HGRLFKVMGDLFLLSGRTEDALIWYNEALQLFKPSLDGIWQASALEGLATISILDSWS-----------------------------------AGHGLQTSTSASREPWSEVTEKLVQATALYYKPTSVEGDSLLSYLYCCCILRHSSLLFAIWSAKGWGPLAFTTMLQPGPTPYLPPTVTQDSIISGISRNAIASVIAQGHGPWL-LHLDARERLSILEAMASLYSCLGYRRKEAYVLREVLGCVLDLVVCGRDDNANGTGLGIQNTAGGTQIAIGHVGIRVSERSDGNQSVLTLLKRVCRVLGVNLDAV-----------------EVVELGATKAPSLTGDPGDREQEPFGWPELQVGVVRESVAVAEALPDFLAVAQYSLSALKTLLDILAPP-------------DQYHLNATAARALSTAKRRGSSK-GVEFWPSRPVVSITLAPLPLIRLPIEKPMSALQPRPSDPNTILSDPFLYNPR-RVNAAQGSQLVIQNETLEFVVLLQNPYVFDLELQKVSLSTSGVPFVTEPVS-IVIPANSYHRVVLEGVAQTTGNLVVRGCIVQAPGGSPREFVLPLATSEEEERDRFKYSGLDALPWEKVLKRQ------SKQLTKATLEKPLRFLECKVVPEQPLLRIRRTSVTHGALMLYDGETSSLQVTFENISHLPIDFLRLVFDDSTITPAQQALAEGNLSVFDTYETEYLLIHKPVFSWNKKDVI----TIPPHHKTTVSISCFGKVGCTEGAIHASYSYVHRDRSGAPDVFHARQLSFPLMVTVYHMLECHGIDVLPCPDYYL--------------------------------------KRPDKDERLTMSDVDDSLGWCLFAVDVRNAYGAPFEVYVERTQEDVSNTKA---------------SVTIPPGLTSRVIVPIKKFILTEEHISQPIPTL-SDRQFVVDKLKMSADEQKTQRELFWYREELFKSIHCGWREANGTRFGDLSLRQQRLTMNMLDTLRTETTILQMSLVDTA-----------SPGTAIPQRMGRYHPPPNRILHLRTRITNMARSSLVCTLDLQ-----------IEPTEHFIHDGALSIPVGRLDKNESREVDTAI 1265
99 0.000e+00UniRef50_A0A0J9XKP1 Similar to Saccharomyces cerevisiae YDR407C TRS120 One of 10 subunits of the transport protein particle (TRAPP) complex of the ci  ali  28  5PYSYVAPSRVRSFLCPLGNLKRSTFLNYAERLVNVKEVCLVDVTPDRRSERATFSPQGFPNGKVVYDFSLSY-DREFSSLHDLEPWRQTYCVFALTTFSYQVSP--------------------------EQLQEKLKKLRKTYPGPLIHKILVFGVPAEDA-LVRTDDIIPILSSKISPITSLGTTMCDITTDFLAELAIFMIARQ-MGSFKSPVVKEFEQPIRPSNRVSVSFKPMHSNTGSGGSGLSSPTGSSFSSTRP------------------------------------------STTKTGSISLALNDKTKIKQRGRMLKFLAGMYLIAGRWQDALRDFTEAATLLKSAHDYLWHGSALEGIGICLVLLSFLETPVAIPAIALSS----SFSTTYVSDTASDTLSPTSSHSSFTVSSAPPPMFEFLPELTGNLLVYFAKSQSNPEDSVPQIVYCETILRLANLLAITRLAGGW-NPASLNAIVRGHSVEKNITKESP------SVPAIASWCNKVYGTDLT-NINVQAQSNILCGIAAIYSNIGLVRKRTFILRELLVHLAPKVVKTRASYAASNAIHTHSATVDKHFSSF------LNTSETKNNIVDMLDSLCNVYGAGDITS---------------------------------------VGYGWDTLRVSFLKVCLALCESLLDFVGIVHYAGLLLSTSTD-------------LISSEDQLRLFTTIVKATESARNLGQGHILASYWDPNILRDIKAVPTNSSILPQFNK-------KVNVNSTGTDVFLHNPYIAKRASKEPTIMVQKERTEFTIKLQNPFAFELHIYELSLLTENDIKVKAMETNIYIPPESVYDLSLPAVPLDVGELKITGCRIHVEGCQPQDFDLIA-----------KTEFLQESKIKQVGVESGVGKGSEERLEASTK----RIIEATVIEAQPVIVLKSLSLNQNWILLLEGEKQVFTFTVVNISDVPVNFVALKFLDSTTQPLQVALTNKDLPLNEIYEVEYFLFNRKALKWKKTE-GDEREIIEPHKAKTFEVRVLGKRGMTDGVIKIEYSH-QPNTEKLGKSHWSRTLSIPINVTVNSSIELGGCDMIPLQHNQHFTDSIENHELAHY--------------------------------LEQLKNKSVLSEYCLLVIDLRNSWTQPIETTLWCSPESSNDPAETNNEHSTHDLPRFSITTLINAGRTARLLVPVKRVKFEELERPIPNL---SKRQFIVD-SNSSPEQQRIVRENFWYRDALLRMLGGTWVTNGVPRSGILELRGIRLSQKMINVLRIESVRVKMAVCDSNSENGKESISNDNDNADSVKETTLFTATTEDYWKLSTVVTNDTAQVLSGVLRIIPTDRYNTNLNQDSIESKILVNGSLQKPIVRLQPGESMTIDTGM 1268
100 0.000e+00UniRef50_A0A238FCL9 BQ2448_1147 protein n=2 Tax=Microbotryum TaxID=34416 RepID=A0A238FCL9_9BASI  ali  22  3PSAFVAPARIGVLLVPLHPIKRSRFQHYADQIRAYDSIELSQVPVDSRGERAIFSSSPTTTGQLLFEYTTYASSHPLAFLAEFQLHRQIHGIIGIFDASEYAAESSS----------------------LNDALVQFHNALRRLPKTFAVKLFGFNPNEHQQDIKESDGLVLIPDTAQ-VSFFLGTVLADFAGHILREFSNLAAQLESRTSIPTPQETPQPNAMRSSSLPSNNINSAATNKNPTASSSKLNNAAGAAKAGGMVLNEAPKVDLTSFGLVAPPQSRTSLGLWGGSSSGNQDGFLYGRSIQSHGSTVVDSKSRKKVAGRERKLMADMWLLAGRTEQAIACYEEAIALLKTWSDNVWYASALEGLTIALVLQAWRPPSSAAATTAANHHAAMKHAATSSISKKATNRTSATTSTLASNAADPSTFLSSIPDRLGQAVGLYEKMLPNDPDRCHPLIYAEACLRIARFLLAVHEAGGKIERAIEKLVVPLNCSAQEAQWRSLSPSNPVPRSMIAQWASMAYSAHL-GQISLPTRLRVTGEIASFFGRIGYRRKEGFVLRELAALCGQGVGKGVEVFSAVHGPTPSSPVSAKEGSNKASIVRTTSDSAGNESIIRIAEKVCQSFGIVVVPRIAKDS---TTKTSSSHHSRQKSLFQGRPLELDPRLSSPGSTFGWSHLQMGVLKDAISVAEALPDYQAAIRFTVTALRAFAETMPPL-------------DQLELSRNIPRIFAAATRRGAPFELEYWGPMQLVMSLEMAPLTPNRLPIEHSIKDVEANATFNNSAKKDPFTNNHDPNDASSRIRPTLITNEVAEVFVTLQNPFGFDLEIQSMHLSTTGVDFVCDSLS-TIVPAGSFHTLRLSGTPQSPGRLTIRGCHIRLAGCTSREFLLPV--WNDQEEEKRQKVALLDTARERIKTTGASRQATRGLPEQSAMDQEFRFLECTVVREMPLLCVRSTSLTHGALMLYDGETSTIRIALENVSTLTVDFVKLTFSDLHTTTTQAYVDENELPPAEAYEIEADNRDRPVFSWTIDQVP----KIEPGQTYFLDVKCLGKVGCGSGTIQIDYATLPPSETDSTTVFHTRQILCDVFMTVHRALLAHTLDILRLQALPEH--------------------VAFAHGRSASVAHLGRRGAALNQRLEQSLRDVDDGEHCLVSIDVMNAYGKPFEVKIERCEEVVTELMSCNFFFGAESG-FFQVRQRLEPGATLRMLARIDRIPAEEAERPIPAL---SERQFVLSKHQVSAAEQRSTRELFWFREELLRRIRATWNEVGSLRTGTISLRSLKLTSNLLDVLKGDEVEVELNL------VENEASRPEAFHFKGRGNRLVYSARPNEFIDVCAYVSNHSPLAVQLALRLDLKPPDANVASSLHLARHIIIEGVSPVAVRTLLPGESETVKVSI 1500
101 0.000e+00UniRef50_A0A0D6EPU8 SPOSA6832_03739-mRNA-1:cds (Fragment) n=6 Tax=Microbotryomycetes TaxID=162481 RepID=A0A0D6EPU8_SPOSA  ali  20  17..AFIQPARIQILLVPVHPIKRSKFERYAQLIRGFGKIPLADVPPDRRGERAIFSSSPTTPGYLLFDYTTYAPSHPLSFLSELQVNRRIQGIIGILDAAEYTDNSLGTAL------------------------AGFQNSLQALPKTFATKVYGFDPSEEGRKFKESEGLVMVP-GAGDVSFFLKTLLADFASEVLWEFSNMVRQLESRTNIPTPQETSGAASPFSFVPHKASARTSISAYAAPSKSSNASPVPVKPQQPVNLASLGIAPPPQSRTALGQWGGSASGNQEGFMYGSSIASNMAVQPSVAPSPPPVDQRARKRVAGREKKLMGDMWLLAGRLNDAIASYNEAISLTKAWQDQVWQASALEGLAVALVIQATLPTTSQNSVPIFLQGRPLHSSLTLRNPQRPPSVPQRTDSPAQSQPTDISTFLSSIPDRLSQAVSLYEKMLTPDPDRAHPLIYSEACLRCAHFLLAVYEARGSMPKALERLVSPSLAASSLARLASLAPSNTVPRSSIAQWISNAYSPHL-ALLSLPIRLRITAEVASLFGRIGYRRKEAFVLRELAALCAEGVAGKPVDGALAPSPIPEEPSIRRVDRAAAPDDALLSNGASRDRTASIVRTMSDSAGNDSIVRIAEKVCEAFGIRVAPQLTKTDRRKSLMQGLTLEIMESGVGTFGWPGLQMGVLKDAIAIAEALPDYQAAIRFTVTALRSLSDTMPP-------------SEQYELSQNIPRIFGAATRRGVPFELEYWGPTQLVMSLEVARLSPNRSPVEHPLQDASTETTAPPAGPRNPFIYDPRKGTKAAKTKPTLVQNEMAEVYVTLQNPFLFELEIQSIDLSTSGVPFAGDPLS-TVVPAGSFHTVRLTGTPREPGTLVIRGCNIRLAGCASREFLLPV--WDDEEEARRQKAALLDTSRDRVKATGLEAFPSRATEASALPTDKPKFLECSVVPEQPLLWMRTTSLTHGALMLYDGEVTTIRISLENTSTSPVDFVNVTFSDSLSASIQAYLAENDLPASDAFELEAESVARPVFSWSGTTAT----TILPGASHVLEVRGYG-------TIQLDYGYLDRPVVRSTKTFHTRQLCCDVFMTVHRTVVAHTLEISRLKTLPELI---------------------STHGRSASVVNLGKRGAALDKRLEDSLRDVGDGEHCLVSVDVMNVYGKPFEVKIERKEEQ---------------NEFYQIRERIEPGATLRILVRLDRITLTAEQLARPIPSLSSERQFVVAKVQRSKEAERLERELFWYREELLQRVQLSWNEVGSLRTGAISLRSLQLDKSMLDVLRGDEVETQLYLVEAG-----------ALELKGRGQRLVYSAEPDEFIDVCAQVTNRSASPLQLTIRLEPESSCASLSALAHLARYVVVEGVSPVTLPLLAPGASHTARISI 1458
102 0.000e+00UniRef50_A0A2P8ABU6 Glyceraldehyde-3-phosphate dehydrogenase n=1 Tax=Elsinoe australis TaxID=40998 RepID=A0A2P8ABU6_9PEZI  ali  31  5............................................MSAQEEVRTFSPSAFPNGRVYLDVSPSIPQSSFAELAPFEPFRNVAVILGTVDAIEYAEGADQEERLVEDGSRNVFYHRAH-----DSFISTMENVQEQYPGVLLTQLIIMDSASSEKKAWIPDGSLHVPPDEETANGAVFKLMGNVVGKLLGEMAEYAEQVRSWATVATPLSLQAQSQRRISDRSHLSRDESPSGSPRPASQAFNSPNPSVMNSPRPESPSLRSEAPSSPDLSNMETPTSTTAPEAMWKARAKYASMQRSLYPATNAAMSADKEKKIGEARVGIVMGSLYLMSGRWADAWRELVESTGKCRSHSDYIWLAAGLERIIICMLLLGSEGFDFQIPSLCYMGQERQSTLYFIDSSRDHNTTISTRDTVAANST--LRKLGGTLGEVVNTLLHYYDRAGTFTGEALPQVAFSEMILRLTKLQSFVATRGTSL---VSDEIFSVGKLDALRRPIGAKDPSDLSRLGISETLFRAYPGPFADISSPS-RSAALAGIATVLASLKMERKRAMVLKDLITLIVPSLQQARTLGAAELGIHPSSSLSYANGDYKSSQ-----NDLDTLSVRQLLQQLLAVYAVG--AVSTERELPSDQDIETSSVE-RGYERLVDEVTQATARMANLDEVGSINLKIDILRFSLDFCESLPDLSGVAQNAALLLRTAGPQASIDPTHSLRHVTLANEEQVRLANHVMTAVHMAREAGIQVVEPHYWDDFLVRSVQMVEDETSGKLVEHSKADI-------SAAKQGPFLHEAWGKRSEKQEENVVVANEHMFLGVVMQNPFDFEIEVDEITISSEGGDIEID-QPNAILGPSRLQEVVCVAKVADPGKLKILGCRVKMAGCREQFFPIYNDEWSAEDPLKIK-------EASRELPLRAGVTV------HSMECPQSSHMSLTVIPSQPRLVLQDLNLTDQSLMLLEGETQSFQLTLHNVSSIDVDFLRPSFDDALTTSLRSAVTSKDLSRADLFEVEASLTKEPLFSCRRVDATDTQ-TIAAGQTATFEISITGRAGVRDAKIIFDFAHLDAEQAEASGRFFTRHLAVPINVTVNAGLQIQHFEVTSLPMDAIVPQPSKRPSRDELDMNGSAVGGVEDNTASS----------------------QTSDHYCLLILDVRNAWTNSASVAFELANSKSAQHTSIKQGKHSQD---------ILPGQSHRFAIPMQKLYVQKAYAQIPWLSTQSRRQFVVSTSGDTPQQEHSVRELFWYREELLKSVHGYWQEAGSARHGNISLRSIRIGHRNIEALKVDDIDIRMEVCSAETDTSHS--------HATATGKMSFDVENGSFLTLRTTLHNQSDKAIHGILRLQPVLSGLSQGISMEMSRRFIWSGLLQKPLAPLHPGMTKTVELG. 1340
103 0.000e+00UniRef50_A0A0S6XEB5 Uncharacterized protein n=1 Tax=fungal sp. No.11243 TaxID=1603295 RepID=A0A0S6XEB5_9FUNG  ali  29  5PFSPLAPARVRVLVLPFGKITHRRFKAFTARLQQVSAVRLGDITPDSRPGRGTFSPLAFPDGHVHLDVCNVAPPATNGDLAAYEPFRSTMVVLGTIDACEYSLSLAQDDHQLVEDGS----RAVFYQRAHDSFISAMETVQEQFIGVVLTQFVIMDSSGQDAKPWIPEGSLHLPPEEQSNSTTTSTLMCDVVGRFLGELAGRAEQMKTWASVATPLGINQLPRFESESRSNFHRRLSGLGPLSREGSPAGDGIARPPSRPASQAFRSPSPSVADSPRPDSPSGRSDTTSSPKTRPKYASMNIDSKSFPNVLNGSSPEKERNIGRARVGITLGTLYMMAGRWTDAWRELIEHTTRARSLNDYIWLATGVERLTICMLLLGSAGFPFQIPSLCLLGGGERQSALSFMDSNRDSAITIGPRD-PAAANSALRKLGSSLSDIATTIMTYHDRAGMFAGEYLALVPFSELILRLAKLQAFVIAASGT---ATNDEVFCHGRLDALTRPAGAKGPPEVSRLVLCETLFRAFPGP-FADLSTASRTSILAGMAAVLSSLNMERKRAIVLKELVTVVVPSLQQARKLGAAELGIHPSSSVSYANGMFLLSNQ-----DVNTLSVQNLLLQLQAAYAVRESTSSIDDLNNEREREHVDFE------SVVDDIVSVITRAASLNDLGSFQLKYDILRASLEFCEALPDPSGVAQTAALLLKIAGPYSAVNPTRRENYVTLGNDEQIRLANLIMTVIGSAGERGVQIAEPSYWDRFLVRSVQLIEDDMTGKLIEHRNTDL------SNGVQSGLFLHDAFAKKVEKQQQNIVVAQEPALVAVVLQNPYDFDIEVESIDFVLDEGQLDVDQAQVM-LGARRLQEVICLATAPNPGSLKIRGCKVKIAGCRPEVFPIYNDEWQSEQHVKVKEA---------VKASTVPRAIDRATASQVQKMPKSSEMAMMVIPAQPVVVVEKVGLKNQSLMLLEGERTSFNITLRNVSSIDVDFLYVSFEDSLTNALRTSLASKSVSRMDLYEIELEMAQNPIFTWKRVDDGDGDV-IKADSCATFEISVLGRAGIRDAKVLFDFANLGDNRD--ATTFYTRQLAVNINLSINMCIELQHFEIMRIGRADETTPDHEGKQNYGKET-------------------------------------------CLLVFDVRNAWPHPIQVDLEVEKAMT---------PMKGTGKYDVQSKTILSNQSARFALPIYRLFVGAPHAQVPWITAQSRRQFVVSTTGETPSQQRNLRELFWYREELLKHLQGSWREASTGRYGAIDLRVINLNHQHLEALRLDILDIQCNI--------KALNDNEDKTLTKRVGRSSFEVEPRQFLTFQINLTNRSDAGIHTMLRLLPMVANQGAESGPDMSRKLVWSGILQRPVPMMAPGESRTVELG. 1371
104 0.000e+00UniRef50_A0A197K2T1 Trs120-domain-containing protein n=1 Tax=Mortierella elongata AG-77 TaxID=1314771 RepID=A0A197K2T1_9FUNG  ali  22  6...FIAAARIRVLLVPVGPIKKATFERHVKMLRQHNSVKLEEVWMGPRTENSFFSQNVPHEGQLYFQFVTSYN-GEHQYLEEFQMHRRVFGVIGIMDCQEWPD------------------------GNMTAGYQHFQQLLTKYPSAVANQCFAFDPSEQHPDDLRGGGVIMIPNV-GNTSSYLRVLICDLTRTILAEFENIAGAIGKRQDIESP---------------------SPAISLYARNGPNSGPMPSAASVSSMPDMSVNGMKPLTAPPSAMTTSGTSTHQRSMSSAGFATVNSGNQYLQ--TAVVTDQRLRKRTAARAQKLYGDLYLMAGRLSDAVTSYQAVIEVTKSNSDFMWNASAMEGLYCAVVLLAFIQADISQIS-----------QQQIQQVMSSPTSPTTNEPTKIQTAPAIKPLIIDIPEKYQTILTLYNKV---PNNAAPAILYVEACMRVTKFIATCFACGGILDDRALAAVVSGNILMQQPMTQSPSSSLGVTRTDIMKWVTKAWTGRMDELW-ILDQIHFTTSIASILGAVQFRRKQSLFLRYAVRMIAPLLHQTRLAQAAAAQSNGTPPRKAAN---------------SDHGVLECLTQICNVFGVGDSFTSNTNL---------------------------------YMDHGWPELQIDILYECIRTAEAVPDYKSMMYFSTTLLRQLH-------------AYLTREEQAGLYASLPRILAAAKKSNSTDLDIHYWTKSIVVDIEVCSPSARKLPFTRSKDTLKSILPETKAGEVDPFIYNPFHRKVNNVAKMDLVADETAYFIVTLTNPHGIDIEVQEIRLSTTGVEFEAIPTSTMI-PAQTTVSIKVAGIPKAPGELVIRGCWVQILHCSEEEFFVTNPRTGSVATNDSKTAQAASDAMLRVKKRGLESFTLKKSDDATL---EPKFATVTVIPPQPLLKISSTSLQHGSVMLFEGERTVVRLTLENIGAVPVDFVTLTFSDTTSQMAGQGNNPGELSAEDAYELELFLKKTNVFSWNRE----VECHIPVGGTREIKVELLGKRGCSSGMVQIDYAYLKRPEQEGSKVFVTRQLFTQVLTTVYKTVESLNLDILYLQSPATEPNTPVIGTNGGIFDSADVSAQPPRIDFSSDGFLAPPGADSPEVNLKPKSVQIQEQGNNKYLSAGRRG-SRTINKRLSSNFSKVDKRQSVEQLLSKARGDAVLPGEQIEAAISRRVALGNKNLDVSRLIKSTTVIQPGSTQRIILPVRRMVLSTEQLERALFWFREELLKRVVARWTCDTSGRFGKFDLRTLRLTKPMLNVLKIEDISFLVTMEPTATMDGDQDNSNKDEEDLEQIGSNRWRCPVEKFAQIRFTVVNRSHQDVKLCLRMQPVQVHGDGTMEYDMGDRMVWHGVLQAPLAKMQPDSTTNHVLPV 1440
105 0.000e+00UniRef50_A0A094GFE5 Uncharacterized protein (Fragment) n=1 Tax=Pseudogymnoascus sp. VKM F-4517 (FW-2822) TaxID=1420911 RepID=A0A094GFE5_9PEZI  ali  41  5PLSPIAPARVKALILPLGQVKRAHFETFVQRLYPENVVRLGDISPDRRPDRNMFSPLAFPAGMIVYDLTTSLPPISHLALAPFELYRAPLVILAIADGSELDHVSCKDKDGNETNG----YDXXXXXXXXXXXXXXXXXXXXXYPKALVHQALLFDYHHQKESPELPDGLIPVPSVKGSTITTMKTIMCDLSSVLLAELTTMAKSLQGMAMIESPSVVLDGRQGPGYSWSNGDNTISRRASQYGTPDTESRSTSSTPKVDRSQVRMSMPVRFGSQQGEHLRSASVSRPTTPSAGPHTPSQSRDRISTQGFGSGSLSERSRNKGKGRISIAIGGLYLQAGRWQDAMKELVEGAYIAKTNNDHLWHAKALEGLVVAMIMLAWIGLDFQIPQLCYVVPEKSSTPTAGTAAEQHT-------PETINRLAALQNLSVLLPELLDRILSLYERASNFTGESLPQLPFSESAIRFSKLLSAVHLAGGRLDDGSLQLVVLGTPFFAKPNTRAPRLNIHPARSVIVTTLFRAFPSSAAAKESLIDRTVILAGIASVLGFLGYDRKKAMVMRELVSILIPGLVSARIAGAAEMGIHPAAGLAALSHINGAAGALDLGEGDVESGMDALLGLVGKTYGVVGFPSSPSDGTKNGA---------KTCDDSDEAVVARIMENTAARQFGGKSMKMNVLRACIGFSEALPDFQGVLRFSADLLRTAGTGIAPGPRTENASPMMSRDEQVRLSINISRTVDAAAKIGLRDIEAEYWDEFLVRGVDLEALPASRTPNPHRSSDLGGTAKAVQAGGKNPFIYNPFLKRPNAEAERLLVCGESATFKVTLQNPYEFEIVIDRIRLEAKGGDFES-TIQETVVGPYRTQILNVSGTPRAAGSFKIIGCIVKLRGCRERRFPIFLEPWSPLSDIKVKAFGLAVQRKREERPVSDSSL--SKRPAIDPRLPKPSSLSLTAIAPQPIVVITSTSLSQAAAMVLEGERQTFSVTLKNLSTTPVDLLLFSFQDSTQGPLQTALSKRDASPAELYEYELILS..................................................................................................................................................................................................................................................................................................................................................................................................................... 1070
106 0.000e+00UniRef50_A0A0D1ZYJ6 Uncharacterized protein n=1 Tax=Verruconis gallopava TaxID=253628 RepID=A0A0D1ZYJ6_9PEZI  ali  33  4.FLPSAPARVRALVLPVGRIRKERFYMFFELIAHDCTVRLREVTPDPRPDRALFSPLEVPDGYVLYDFMTSAPSNVQLSLSPFELFREPLLVLGIVDAREYDSLEKIQNLTMAT----------------------LKIFEEDYPRILVCKLLVFHSMPMPDITTSHADAIHIQLHGNPQDMSMRRFMCDITSNLLAEMTTLAVSLKALPSMASPSVTSSGAGMVLGDAMRSFISYQPSVSNGDPTTFLNASYSHRMSMPVLPSNNESDAQSGSPESGTRSPPPRTDNRRNIISSKSRDNCQDRVSISGFGPGSLDERKRDQGKCRISIVISSLYMLAGRWNDALHGFAESAALARSFGDHIWHAKAFENMITCLILLSWAQIPFKIPPICYPSLDRTSSKLAQITSPTSTSSDSPSAD----ISPARKELAFMIPDLIKMVINLYNRSAGNSSECLPQLAYSECIIRLSRIQAGLLLGQGILSSDVLAYLVKGTSFD-----NRTKPFLDVGKTKIADMVMKAMPLPEASGLSATDEATILAGIASVLSILGLQRKKAMLLKEYIRALVRAIHEEKRSGAAEAGVHPSASGFA------QSALFAPGNSTSVYGLDNFLNMLCQVYGIPETRSYLFDSH------ILLHDADGEDTNQLGPLLDRLVDDLTLRSFGSVNLKLDVLRACISLWEALPDPYGTLSWTTALLRVANPGSSPSSDVNDVSNPLSREEQLLLSGTMVKTITDAKLIGLRNIDVDYWDEFLVRGVLLIDASPSLTMHSRRKSDL-FASETKQTAKQGPFIHNPFLKKPPNAVQNLLVANEDREFIVTLQNLYEFEIYIESISLLVSGL--KCGLSNNQLLRPYRTQSFSILVAIPSPGQYELTSCVVKIRGCREKAFPIFSHIWRPEYSLKLKSIGFLKLHPEDDQTSRNASIASPPIS--VKDFPKPKTVLLTVLPSQAVLEVISISLPQSSAMLLEGESLTFNVTVQNVSEVSIDFLHVSFNDSTTAAMEDAISKKNLNSAELYELEYQLAHRPAIRL----VGGTPHVIAPNQCCELSFELLGKPGLTQAFIVIDYATLHRPILDARDILYTRQVVQPVSITVNSSVQLQRFDVLPISDAAVLGHARA--------------------------------------------MTDHQQDHCLLLLDVRNTWPSPLEITIHQEKSNSPELTN----------TFQNTQELIKPGHIARMTIFIPKLYISNPHARI---RSANERQFVLSANSISPETERITRELFWYREALLNMLSVTWKQLDSSKHGVVDLRTLRLTPRMVDALRLDDLHIQLSIVGGEG--------------VLTDSSGAFKVHVDDYLVLETRVRNRSNVTISPILRLLPSLPHQPPELALDLSKRLAWSGLMQKILQPIAPGET....... 1330
107 0.000e+00UniRef50_A0A1C7NQK6 Uncharacterized protein n=1 Tax=Choanephora cucurbitarum TaxID=101091 RepID=A0A1C7NQK6_9FUNG  ali  25  6..SLTSNCKVRVLLVPVSPIKRTTFSKYVELVKTFEVVRLGDVTPDKKGASAMFTSQAFQEGQMHFEFLDHY-SREHQELEEFQPYRRIFGIIGIMDCQEWE------------------------KKGLKEGHHQFVRSLDHYPSSVVTRCFAFEPSETQEDD--TKGLIMMPNV-GNMSFYMSTMMCDFASEILELFSVLATSIQSTGVIESP-----------------------------------------------LALNTPIKNRAQQRLSQPPLATPSRTSYISSKRASLPMPSTRVS-------EEENRSRKRTPGRIQKLLGDFYLLAGRLPDAIHYYDQAIESNKTMSDFLWLTSAMEGWLCATFLLDHLQIDIGHIVSRM----------VIPSQPSYTSPEQVELPPTPTTPKAPRSMLDLLIEQYSLIHTYYSRVTLTASFPAPDIVFAESCLRIARVLTTAYLNGGWNDTTVQCIMQGELSQGKIKGVQKQS---GIKQCQIGDWVTKIWKIR-MDQLSLLDQISLLNGMSLIYSCIGYHRKAAWTRHQSVKSMLPLIVQHRRSNLSK-------------------------DKPSDQGVLDMLKQVCEIYGVGEKSIRLADQGPSKSHDL----------------------------FGWPALQIEVLKQCISISEALIDNNLRLYYTNVLLRSLYQYIPKAEQIKLATTIQSI------------IVHSNRDKQAMSSSMNYWGVNLVSSIELKKLISRKAV--YAHSAKQEPVKEDKEVSDDPFIYNPFAKKQVVHQKAVLVKNELSEFQVSLLNPFGFDLELQNIVLSTSGVEFEAVPT-GTTIPANATSQIQLMGTPKEAGVLIIRGCLIRIIGFAEQEFTVDSKSTKPDRQTKLKSSGL-------------KTLDLQKDKEQVNASEEEQFVTMDVIDDQPLLKIKRSSLLHGAIMLFEGEVAHMTMDLENIGTIPIDFIALSFVDSTTS--NPILINPELLPEEKYEIELYTKDTRVFSCRYNQLNGRKIWLPPGEITTIKVNIYGKKDCHHGTIQVDYGFLERSSETVLSLFYTRQLYYNVLVTVYQNLECSSWDVAHLRHSLPPSKDSLVPTGNHPLSSIE------------------------DLLMMTRNVEMENQDFCLVTLDVQNTWSTLFDVEFMIYND-----------DPSKDNGQVIFHLPVQPGSTARAILPIKRLFLPLDVCQQTIPSLDVNRQFVVSQPKLSKEQQQARLQIFWYREELLSRIKASWRCRVSQRTGDLNLRSLRFSQTQLAIFKKEDIEFSVDMKGQ---------------SVTKLSGRRFICECNDPTIMTITVKNRFPYPIKVILRLQPVQSYNDGAKEYDLSEKLLVEGIEQVVLPEIPAHGQVAHSFP. 1227
108 0.000e+00UniRef50_T5A7D2 Hypercellular protein HypA n=1 Tax=Ophiocordyceps sinensis (strain Co18 / CGMCC 3.14243) TaxID=911162 RepID=T5A7D2_OPHSC  ali  36  1.............................................................................................................................................................................................................................................MPPMASRPPLNSSSSMPARPSTPVKSGLSSIAMSPDDGHSVSGSVHSS---PEHKNVRSDAEKSRDRVTVQGFGPGGANDRWRLKGKGRTSIVIGSMYLLAGRWSDSLKELAEAAATARSVNDHMWHGKALELILVNLFLLAWSKLEFQVPAILMPSRER---------STSLPTLRSEPDTAGPVQPKCHRDVQNLIPELLDRIAGLYSR---ISAEHLPPLPMSETTIRFSKILTAMHICEGRLDQRALDMIVCNTRPPGY-LTTSPRLDVSPPRQHIVNFLFRAFPSSAAELLTPADRASVLSG---------------------------GLVEARTRGAAEAGVHPAAGLVSLTPGGDGNSALDLGEGDIEHGLEAFLELLCKSYGIIGFETHEKK----------AGTLPGPSDDSDEAAVARILGQSSARFFGFTSIKLNILRACINFSEALPDFNGVLKFSSDLLRTGGSGVAPGPRREDAAPIIHRDEQVRLATNVSRTASLAQRIGMGHLTAEYWDEFLVRSVVLEALPNARTPIPHARSVLPGATAGRASQDVNPFIYNPFLKEPDEVAAQDLVAGELATFRVTLQNTYDIEVEIESIRLCTEGVDLEALTES-VLLGPYRSQLLRLKGRPREAGSITVTGAMVKIRGCRERRFPIFTKAWTPSMHEKIKAKGMIALEDGDGAA------------KPTDGAFAPKKLSLNVIQAQPLVVVKSTTLLQSSVMILEGERQVFSVTMQNTSATPVDLMLFSFKDSTQAPLQEALGKRDATPAELYEYELILTRRQALRLARSD---QGRNIAPGGEASFEFEILGKPGLTHATIQVDYTYLGVPRDEVTEQFYTRQVCLDLTVTVNASVELTRVDALPMHGQIPQPLWERLGGST----------------------------------------PGKEDEYCLVCMDLRNAWPSHMAIRLESEDGL-------------------AVDEFVLPGKTRRVAIPVKRIYLEEAHDSIPSLNPSRNRQFVVSTSKISPEMERANREAFWYREKILDHVKATWRTTSPKRSGAVELRNIRLTSRMIEAIKVDEVDIDVAVEDP----------------SEPDGGARNVAYVDDFMALRVDIRNRTTKSIFPLVRLMPALCHRPTNVALDHTRKFAWNGTLQQQLPELPGNSATSFRMGV 1066
109 0.000e+00UniRef50_A0A0B7NAR9 Uncharacterized protein n=4 Tax=Mucoraceae TaxID=34489 RepID=A0A0B7NAR9_9FUNG  ali  24  8....TSSCKVRVLLVPVAPIKKATFNKYVELVKTFNLVRLGDVTPMKKGANAMFSSQAFQEGQMHFQFITHWT-RDHAELEDFQPHRRIFGVIGIMDCQEWKS------------------------RDLNEGYKQFSRGLDQYPTAVATRCFAFDPSESQEDD--TKGLIMIPNV-GNMSFYMSTMICDFASEILEQFAILATRIQKMDTLESPA---------PTNVHIPSRRDQQRFSQPPLAISPSSSSNATNKRSSLQPHHQQPSQP----------------------SSTKHHRYSTSTLSSLGSTGESARTRKRTPGRTRKLLGDFYLLAGRLPDAVAHYDQAIEMAKITSDFLWLASAMEGSVCASILLEYLQADTGHIVSRNPASPDPSTPGTTPQASSGSSSPSFHSDIAGG----PQSTLTTVTDQYTAIIKNYQHTSLTANFSVPDLVYAEACLKIARLLTTAFLNQGWNDQTALRKRKSESFVLLSSSDMVRFKGSGIPRYRIAEWVTKIRRIHINGLG-LLDQIYVTTAMSSVYSFIGHHRKAAWLMHEGVDRMMPLLIQHRR--------------------SGLSKDAGRLSTAHDNGVLEILKRVCEIYGIGERNVHDGGALEAMR------QEEQELFSSQTPLRSKGNIRPKENRFGWPDLQIVILKQCISVSEALIDNGSRLYYTTVLLKNLYQYIPKAEQIRLATTIQGMVANSSRDKKQSSLVC-------GSESINYWGVNIVSCIEAKKPISRKAVYSNPIKNEAVANAPESADASDPFIYNPFAKKTEMASKVVLVKDEISEFMVTLVNPFGFDLELQSISLPSTSGIAFSAVSTAVSIPANATAQVHLAGTPKETGVLVIRGCLIQIIGFAEQEFLVDNQAKTSQQENKIKHSGLGAIKTNRKRETYG-------------DASPISFYQLNVIDDQPLLKIKSTSLLHGAVMLFEGEVTHIVIELENIGNIAVDFITLSFTDSTTV---NTLRNPELPPEDQYEIELYTKGTRVFSWEGNDFIGKKIWLPQGASTTIKVNVYGKRECHGGTIQVDYGYLDRSAQAAPTIFYTRQLYLNVLITVYQNVEPFNWDIVYLRHSTPASKEALDRALNDLRKLKITEAAESSTSNAAVISQQQPIQDLLLVTRNIGLESQESNDYCLITLDVRNRWTTPFDVDFVVNN--------RTREVKTGDMNELATHITVQPGSTSRIVLPLQRLFLPPDICRQEIPSFDPNKQFVVSQPKISEEQQKVRLQMFWYREELLNRIKGTWRCGSTGRRGELSLRSSLRLSFMLGILKKEDVEFVVELKGD-------------------------------------------TRPVKLILRIQPVQSYNDGVKEYDLSDKLLLEGIRQVVLPEIPSNGIISHSFPM 1327
110 0.000e+00UniRef50_Q0URM8 Uncharacterized protein n=1 Tax=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) TaxID=321614 RepID=Q0URM8_PHANO  ali  38  4...............................................................................FADLGMFREPLLIIGIGDASEYPWLDSSRAGNDSLQTKSSNGTSQ--EEDVDELQGAIEDIREQYSRAYLHSLMLFDSETQAQHPRLPAETIFIPPTSRLKTTTMKTVMCDLTATLLAEMTTLARSIQALPTVASPASQTGPSASRPASPLSGAQKDAHRMSMPVLPSGTGGALTAEDPRAGSQGSRTPPTTFDEISGNAANALQQVNSNTSKASTSTKETASDRVSIHGFGSGGVGERARNKGRGRVGIVVGTLYMCAGQWNDAIRELTEGATKARALSDHLWHAKALENIMVCLLLFAWSGMDFQIPPLCYPMADKGAGSKSPQHTPANS--VADNSGQVTNHEAALEKLNSLLPDLINMILNLYTRAANFAGESLPPLA--------------------------------------------------FSENDVASMLFRALPGPVNSGISPTDRVVVLAGIASVLSSLGLQRKKAIVMKEFILSLIPGLVQARKLGAAEMGVHPAAGLAALNGGASSAGALNLGEGEIETGIDEFLGLLGRIYGIPASKESTPRSERSTAERYGL-----SVGETSESVIADILKTSSLRAFGSVGIKLEVLRMCLNFSEALPDFNGVLHFTALLLRMAGPGTAPRPNSTDVFVSLPRDEQVKLFSNISRTVAAANKLGLQHQETEYWDDFLVRGLLILEEPTPLRLTHHRPAELKLTRKE------GPFLHNPWLKKTSIAAETILVANEEYRFVIALQNPYDFELEVDSLKIAVEGVEF-TAVEKHFFLGPYRTQKFQIVGVAKSPGTIKIIGCWVKVIGCRERLFPIFPEPWKPSRETKMKKTGLKACLGAPMSRPSSAIAATSDPAKGAE--PKPESLTFNVIPDQPVVVITDVSLPQASLMVLEGEKKRFTVTVKNTSTTAVDFVHITFQDSATAAIQAATTNKDLSPAELHELEVQLAHYPALRWCK-DTDEESISIKPGETLDFTIEVVGRTRLQDAVIQIDYANLGKRRSEVDDRFFTRQVSVPISITVNASVQLQRPDIVPLCADFALPPA-----------------------------------------LNQHIQDPENNEYCMLLLDLRNSWPNPLSISLHLDSS--------------------SVTETIQPGHINRIAMILPKLYLSDAHAAIPSLNPATQRQFVVSASKISPEAERATREAFWYRDALLQRVRGTWTEPSTARHGALELRSIRLSARMVDAIKLDDVAITMSLTPDSPSSA----------HVTRLGKKKFQIEVDAFYTLTTTLRNRSARAVSPILRLLPHLADLPHGVALDLDKRFSWTGALQAKLPVLKPGAEGRYEVGV 1261
111 0.000e+00UniRef50_I1BWV4 Uncharacterized protein n=1 Tax=Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) TaxID=246409 RepID=I1BWV  ali  24  6..DITSSCRVRVLLVPVSPIKKSSFWRHVELVRKFNTVRLGDVTPDHKGANAKFSSQVFQEGQMHFQFVTKYN-RDHSHLEDFQPHRRIFGVIGIMDCQEWKDK------------------------DLSEGYKEFVDMLVQYPTAVATRCFAFDPTENQPDD--TKGLIMIPNV-GNMSFYMSTMICDFASEILDQFATIAGRIENLKGLESPIPLGAFPRR---------YEVPNNVVIPQPSTSSPNIKTQQQANNRASQPVPTPSVSSSFLKRASSAAGSSRPTTIASPPSPRPSLSRSTTFSNLVHGGEGNKTIQRTPGRIKKLLADFYLLAGRLPDAIQFYNEAIDMTKSHSDYLWLASAKEGLACTMLLMSFLQVDVGHIISRN-------TAPNDSAAITSTHTSKPPPNSDKIGLDNQKSILSEITEMYEDVVQTYAKVGTTTNIPMPSLVFAEACLKLSRFLVLVFLNNGWND-TVLAKVVHADMGDLSQRKEKFLTMSGITRYSIAKYVTKVWTVDVDEL-SMMDQINIMTHMSSLLSVIGYHRKSAWFMYE---------------------MLNRMIPLLIQGRAAVASSLNKSNVHDGGALKILQDKFDETY---------------------------------QKQQGNAAKKTNTLGFGWPALQIDILRECIVISEAIQDHASMLYYTTVLLKNLYQY-------------ISKDEQIRLASSIQRIVNISKRSGQSENNVNYWGFNIVRSIEPIHPIPRKAIYQHPIAKALAASKEGRLNSGDPFIYNPFAKKKNDKPQINLIKDEVCEFKVSLSNPFGFDLELSNIILSTSGVEFSPVPA-AATIPANDTLTIRLMGTPLETGALTIRGCIIKITGFAEQEFLNEKQKTEQVKEKENKVMSLVESKRHKYSGLQALYKAPTLDLDMRHDNAQESYEQINVIEDQPLLKIKSSSLLHGAVMLFEGEMTRIHIQIENIGHIPVDFITLSFTDSTTN--HPKLINPDLPPEEQYEIELYTKGTPVFSWEGSKADNNQISLGPKESTDIVVNIYGKQGCTGGAVYIDYGYLDRQSNELPTTLYTRQLYFPVMITVYQHLEPLNWDVLYLRDNMTISKEAVDKAFEAVSKTKDQQGNSSDQRVEDLLLITQ-----------RSSDDNDKNPYCLLTLDVRNTWTVPYEVEFMIDNTET-----------ASENEILKYQVTIQPALTKRIVLPLKKLFLTSEQRLQPIPSFEPNKQFVVSQPKMAPEQERAKLQMFWYRELLLDRVKSSWRCKTTGREGIIDLRSLRLTPVQLNILKKQDIEFIVSMSDNQYTT----------------GHRQFECPVNNFVAMNVTILNRQD..................................................... 1267
112 0.000e+00UniRef50_A0A0G2ERR6 Putative deah-box rna helicase n=1 Tax=Phaeomoniella chlamydospora TaxID=158046 RepID=A0A0G2ERR6_9EURO  ali  39  16.LSPVAPAQINALLIPAGNITKSRYEGFVSRLRSASKVRLGDLSPSKNSSENHFNPAAFPSGQIVFNLSDAPPGVNNVEAFPFEVNREPQILLAIADG-------RRLGQGNQGVSTDISEGVNNASSYLEWLQEQLHAAHNDYPRVLLSRLIVFESDKEDLSAQL-QGMTFVPSPEKSTSSTMKTTMCDIASLLLPIVHNLAKEIQDLPAIESPWKKRLSATTKGGMDSI--ARVQQRMTMPTLSRSASDSQDPGVASLPSLANARSLGESRSATPTG-------------------------------GTSNSTEKKQNRTAGRVAVVLGALYLQAGQWPDALRELERGFLTCRGMSDYIWHGRAIELTIACLIMYGSVGLGFAIPLTCYPATDKRASIALNGTGQQSKDAT-----------ESLQELSQILPELFSTVLTLYARAANFTQEQLPQVLHFEATMRMVNLLSVPHKRDGILDEAALQHLVDGHQIECVLRDQR-VANPSLRRHDISAMLNQAMTLKV-EQLTVDEAIYILSGLASRSSTLGLQRKQAFLVRELIEIIIPSLIRARKVGAAEMGIHPAAGLSALINGKVNEGMT---HESDANGLRPLLKTMMDIYGIC-----------------------QGDKEDIHNGMTAVMSKGHLHDVGDIALKIDILRACANICEALPDMKGIVEFNTRLLQATKGTPFMPVPHSVGGPLITQEEQTRLINVIKRTVEAASKFGLNDLQAEYWDDFMIRGIEPLEHNPNMRLRPHTKRDLDVVGMRNEKKPKDPFIFNPFAKSTLTKDEITLVAGDPAYFRVTFQNPFDFDIEIESLCLHTEGCDFEP-VRQPLLIGPYCLQRIVMTGTPTTAGKLSIKGIIAKIRGCREKSFRIFTSPPKLNQNLKLKAIGLSSKD---SKAVVRPLSSESTKSAKRISGVSDSDLHLHVIDPQPIVSVKSTSLPQLAIMVIEGESKTFEIVLQNSSTTWVDFLLFSFQDSATRQVHNALSNKELPAADLHDLQLMLIEQPAIRLKTEHSP-SETKIAPEASAKFLIEVTGRPGLLDGTIQVDYAYLGTESSNASGKFYTRQLSIPVSMTVNAGLDLVRCNILPFCGDFAWANQQASQRHTPAPEKANNLSPQSRGSRSRTVSQSAVRKSHFTSLLSRLGLGNHGDDHCLLLLDIRNGWPNPLTVTIQVRE------QTPEVSASESWNRAYGVHEIVQPGHTARSVLLVPRISLINPHEQIPTI--GNARQFVVSSLKISPEVERANRQAFWFREELLKHLRGSWVEESTGRRGFIDLRALRLNSRMIDALRIQDVEIYMVIVPIEDNATA---------TVEQTGRSRFKVRTNEFATLRVTIHNRRQRPLSVLLRLQPSLREQPHTVALDLVKRLTWTGMLQQTLPAIDAGERREVELGI 1361
113 0.000e+00UniRef50_E9EA26 Hypercellular protein HypA n=1 Tax=Metarhizium acridum (strain CQMa 102) TaxID=655827 RepID=E9EA26_METAQ  ali  37  1....................................................MFSPLAYPDGAMLYDLITYVPPVSHLALSPFDLYREPLVLIALADGEELQDKTFSKRYSASRAXXXXXXXXXXXXXXXXXXXXXF-------PKVLVHQVVIFDYSPEGVNVHMPEGILSVPPKDMRKRTTMKTVMCDISSLVLAEMTTLAKSFEAMSTIESPGSLASLSRRNSQFSLPQQDKTQARLSMPPTTSRSPSNAAGRPSTPPRSGLSATPMSPDGQSGSSTGPSSPDQKTQRSDVNSSRDLSRDRVSVQGFGPGGANDRWRLRGKGRTSVLIGSMYLLAGRWSDSLRELSEGATAARSLNDHIWHGKALELIIMNLVLLGWSKLEFQVPTVCLPNHERSTSM--------SEVLKSEPDSANHSQPKHIRHLQNLLPELLDRILGLFSR---ISSENLPPLPLAETTVRFCKLQSAMHFSGGKLDQKAFNAIVTGE-LPTQTLTTSPRFTVTPSRQQIVNMLFKAFPSSGTELLTTADRTSILSGIANVLGALGYHRKKAMVIRELVSVLIAGLVEARTRGAAEAGIHPAAGLVSLVPGSDRTSALDLGEGDIEHGIEPFLELLCRSYGVVGFDMRKERDR---------------ADDSDNTTVARVLIQSSTRFFGFTEIKLNILRACINFSEALPDFDGVLKFSSDLMRTAGSGIAPGPKREDAAPHIHKEEQVRLVTNIVRTAALTERIGLEGLAAEYWDEFLVRGIALEPLPSARTPIPHAKSVLPGANTSRASQDVNPFIYNPFLKEPDEVAAENLVAGELATFKVTLQNTYDVEVDIESMRLDTDGVDFEPVP-ENVILGPYRTQLVRLKGRPKASGSIKITGAVIKIRGCRERRFPIFARHWTPSRAGKIKTKGPPALESSSG---------------AAPVKPETKVLNLNVVQPQPLVVVKSTSLAQSSIMILEGEKQVFTVTLRNTSTTPVDFLLFSFKDSTQGPLQAALENRDATPAELYEYELVLMKRQALRLPRNN---QNRYIPPGGEATFEFEILGKPGLTHAAIQADYTCLGVPRDEVTEQFYTRQVLLDLTVTVNASVELSRIDAVPVQGRVPPALLKRVGADE---------------------------------------RTASPDKYFLLAVDLRNAWPSQMLVQLEGEDGM-------------------MVGDSILPGKTSRIVIPIKRVYLEDPHESVPTLNPSRNRQFVVSTSKISPDMERANREAFWYREKLLENLKATWQTTSPKRNGVVELRNIRLTPRMIEAIKCDEVDIAISIDGAPDN----------------------IAYVDEFMQMRVQIANRAAKPILPLIRLMPALCHRPLNVALDYTRKFAWNGALQQQLPELKGHQATEFVIGV 1295
114 0.000e+00UniRef50_A0A1X2GHG5 Trs120-domain-containing protein n=1 Tax=Hesseltinella vesiculosa TaxID=101127 RepID=A0A1X2GHG5_9FUNG  ali  23  5.LNLTSSCRVRVLLVPVTPIKKSTFLRHVELVKQFSVVRLGDVTPDLQKGNAKFSSQVFQEGQMHFQFLTSY-RRDHAHLEDFQPHRRIFGVIGIMDCQEWKDK------------------------NLSEGYHHFVNTLSNYPTAVATRCFAFDPTENQPDD--TKGLIMIPNV-GNLSFYMSTMICDFASEILSQFDNIASRIENLPMLESPLPRAHANAGYFDQAHTAPNPMPSSIKSPLQSPMAQQQPPSRMSQPPTPMPTQSTSSFLRRASTMTANSLSTSPPPMSKNGPLPPIPTPSLSRTN-SMPLDTSKTKRRTPGRIKKLFADFYLLAGRLPDAVSYYQMAIEMTKSTSDFLWLASAMEGLACANLLLEYLQGDVGHIVSRKMEANANSADVPLSPTQSMEDISLKPAPSTFT----------DLLDQYTALIQYYGKVHTSATVPIPSLVYAEACIKVARLLLATWIHGGWTDQ-VLNLVVQGKLKNEKAPPPKPVNYPMP-RFEIAEWVMRVWSVSLDPL-PLLDQINVMTQMSTVLSTIGYQRKAAWCMHESIHSILPLLIQSRANVS-------------------NAKDLAAGLDQNGHGILQVLKHICDAYGIGEQHVQDGGALDAIDTPARDRDSSPNQTQTHHQATEQRR-------MGWALLQIDVLRQCIAISEALPDYGSMLYYTTVLLKNLY-------------EYIPKDEQIRLASSIQRIVAMGKRSGRVESNVNYWGVNIVSHIEASQAIPRKAVYELPM---LDPASVSARANGDPFIYNPFAQKKNDKDRVLLVKSELCDFKVTLTNPFGFDLELQHVILSTTGVSFTPVATS-ATIPAHGTVSLRLTGTPQESGQLTVRGCIIRIVGFAEQEFLYDEGQKKQQDQPSISSRHRDVVK-YKYSGLQAIEHASKKQVSDDAQTDPVAFYNVQVIDDQPLLKMTTTSLLHGAVMLYEGEMTQIKMVVENIGHILVDFVTLSFTDSTC----NEPINPELPMEQQYEMELFRQGMPVFSWEGTDSVGKKVQLAPGAKMDIIVKVYGKRGCSGGTIQIDYGYLDRQST--AQSLYTRQLYLPVLVSVYQNLEPLNWDVLYLRPHCQSSTAAVEERTNNDATLMASTEPQEDKDLVQLTQSLL-------------DLGVDKQDYCLVTMDIRNTWTLPFDVTFKVNDQDSDDHLSL----------------SIQPGWTKRVVLPVKRMFLSEQECQEPIPSLQPNKQYVVSQSLGHPEQERSRLQMFWYREKILEKLQAHWSCPSTKRHGLLHLR--------------PSLRLSSSQLSILKKQDIAIIVNLQGPSVKSLTHRHFQCPSETFVSMQVTIHNRQPRPVKLILRVQPVQSYNNGAKEYDLSSKLLMQGLHQITMPEATADGKVTHVLP. 1337
115 0.000e+00UniRef50_U1HK52 Uncharacterized protein n=1 Tax=Endocarpon pusillum (strain Z07020 / HMAS-L-300199) TaxID=1263415 RepID=U1HK52_ENDPU  ali  40  5PMSPLAPARINTLLIPAGRIKRTRFANFVSRLDHENVVRLGDVSPDGQSKRSMFSPLAFPEGRIIYNFSLSESPALSIDCFPFELNREAQVILYLADGSEVVTSESQTQLAQEGNIERSPGETHPLASMFASLEDEVRANRHQYRRAILHQLLVFESTLAPEALPAPTDVILVPAPQNSRTTTIKTVMCDISGRLLRSMDNLASEIQALSTIESPSLVPGSAYRATDLAARVHARMS-MPAQPIQGPLDPVGSRISATTGSKSRSTTPAGARSASRHSVGSPSRSDRFSEVSSALGSRDASQDRNSMVPSTVTNPRERKKNCSVGRSRIVVGALLLQAGLWPDAVKELSEGTATARGNNDYVWHAKGLEYIITCLLMFGWAKMYFQIPHICYPIAEKPTKSSSVTPNPKNAELTPYGRSSSDSRTVSLHYLTKLLPDLLSSVNTLYARASNFTEEALPQLLMSESVLRCGYLLSAMYLRNMVIDDNMLQALLSSENIPRADPIPRSADTITLKKSDIATMLLHAIPA-IPGAVPFNELLQILIGLASILSMVGMERKQAFILKELLQRITPTLIEARKVGAAEMGIHPAAGLLAL------SNTSHSGFLRVEDGMKSLLTLVGEMYGALDHNEDMGSLINSQDSTKSSLASSR---------------RAKLHAYGNFDLKVDILKSCIAICEVLPDFEGVLKYTVDLLQLSRRTTTLPFRHPTGTPAISQEEQIKLMDSIKRTVGAAAKVGLKSVQANYWDDFMVRGIEAMSPPATFRVAPHSKNDLQSVSESKQTTEKDPFIYNPFSKPTSSATDQPLVAEELAYFSVYLQNPYEVDIEIEEITLVTEGCRFQPL-THSIVLGHFCCQKFTMAGTPRTSGTLKIIGCRAKIRDCKERDFLIYTADWSPRTESKIKKIGSAPRDSVRRGPPSAVGEAAPKEAEGSNTGPQSDTISLTVISPQPVISIQSTTLSQPALMVLEGEKKCFNIVLRNSSTTAVDMLLFTFEDSATIQLRTAVMNKELSPSEAYEHQLQLAGSHPFKYIPSDEKEGPV-LPAGGSADFIIEVLGIPGLLNGIVQIDYGHLDISSSDVTDKFYTRQLSFPVAVTVNAGIEVPRCNMLPFSSDFAWWNKQQACASSPQALDPPGVLTNELRSRSISYPPLQTDGGQFTSLLARLGLGSHGDDHCLLLLDLRNVWPFPLSVSVQVRQ-----NKNASSSPTDPWRRAYTVHESVQPGHISRAILPIPRVYVSDPHKAIPLI--GNQRQFVVSASKLSVEAEQANREAFWYREEVLKHVRGTWREDSTGREGSIDLRGIRLNTKMIDVLKIEDIELSLSIRPSRP-------PDAQPSPVLQRGGSRFCLQVNSFTTLTIK----------------PSLRDQPHNIALDLSKRFAWTGMLQRVLPPLTANEVREASLEI 1404
116 0.000e+00UniRef50_UPI0008679AB3 Trs120-domain-containing protein n=1 Tax=Saitoella complicata NRRL Y-17804 TaxID=698492 RepID=UPI0008679AB3  ali  35  11.LSYVAPSRIRVLCVPIGRIKRSTFDNCVTRLQACRMVRLGDVSADTRKERATCSPQGFPDGRVVYDVGTSF-DQDHEYLEEFQMWRRTMGIIAIADGAEEND--------------------------LEALNEGMGMLKMRYPRALVQQCFVFHCEVAAEGKYPEHSAFIYSKRASKASSFLRTVMCDFTATMLSEFAPLAQRLQSLTTLDSPHTATRLSYPSSENLVTNSPRYS------------------------------------------LPPAAPNGELKRSSSMSSKDMKRYTMSGLGSSAGSMTERAKSKGKGRVSKTLGDLYLLAGRLPDAMREYAEAVAIAKANSDHLWHAAALDGIGIALVLMAYLHLDYQIPAVALVAAAPVPDKASLKAASSTLKLKSSAKTSSSRASSPNPHLMDFIPDLQNAIAALHQRSTNFREDSVPPLIYSETILRCCKFLCAVHVAGGWND-AALDNIVTDAAIPPS------TKSGYPPRAEIAARAIGARGIHL-DDMFVMDRIHVLGGLASVLGAIGLERKRALFLREIVQTIVPELIQARVVGAAEQGMHPA----ARMLNNNATAAPALGPMDLERGVLGMLEDMCAAYGIAVSAGDDDAF----------------------------EKEVVAGQFGWSQLKLSVLRDCISLCEALPDFPGVLRFTTKLL-------------AIAVPYLTKEEQGRLATNLARTVGAAKRIGMKDVEAVYWDPFVVRDVQVVKSQVYQTPTALPMSTLLPPVEEGEKKADNPFLYNPFEKKVAVKAENLLVEGELAEFEVVLQNPFGIDLDVQSLALEVTGVDMETQPI-AVVIPPNSVQPVVLKAKLLSTGTMIVTGCKIRILGCQEQSFPIREPP--DAEELDKWVTLKDVGEKTKKMGLSARKNCATAQANGSGPLAPPRDVSITVVPPQPLATVSATTLTNGATMLLEGERRVVEVTLTNVSSTPIDLVLLSFSDSTTGPLEQALANKSIPPDEAYELEVYLYNRRAFSWDV--ATEGKVNIAPGAEETFKVDILGKRGLTDGRI---------------------QLTVPLLVTVNASIDMIGCDVFPFAGEVSQDSDLASRSTAAKAFAEAASGEG-----------------------------------CLLLIDLRNVWPNSMHVELSISNGPGDE------------SEQFTASDLIQPGRTSRLALPLRRIDLDDFTRGIPSLSP---KQFVVSAGKYSPEQERQAREAFWYREELLKRIGGKWKDLESDREGAIEMRGLRLSARMVDLLRVPLVEVEIE--------------RIEGEGVTSIGKRRWRVEMDEFVQIRTVVRNRKPEATRFFLRLQPSMQHQPLPTALDLARRVAWNGCLQTSIGVIQPGGEVEHVIDM 1264
117 0.000e+00UniRef50_U9UMQ9 Trapp complex subunit trs120 n=7 Tax=Rhizophagus irregularis TaxID=588596 RepID=U9UMQ9_RHIID  ali  25  3PLLFTAPARIRVLLVPVHPIKAPTFHRHVQLVKNFNVVRLGDVTPDMRGQSAMFSSQLFHEGQLHFNFVTSYEP-EHAYLEEFQMHRRIFGVIGIMDCCEWSD--------------------------LKEGYNKFSEIIKNYRTAVAHRCFAFDPSEDQPDD--TKGLIMIPNV-GEMNFYMSTMISDFANNILTEFGNLATDIEKRQIIYSPKIPTPNS---------PQLQNGSNNQQSNGRYSAPLQSFSSPELKSSQAFSLTPPVQAMTTAGVGGAAAGVAPKESYHSRSFSSSTLVNIAAQAANVPTDM-RLKKRAPGRILKLIADLYLMAGILPNALQNYMLAIEATKANSDYLWHGSALEGLCVVLLLAAYLHAEIGPPII-----------------QSQPLASPTATDQPPSSPESPKVLWVETTEKYVQVLTLYAKTSSSSNDQVPPLIYTEACLKVAKLLACIWVAGGWGDDALKLIVHGGTPEKGLNEKWGLSSVCGVSKIEVTQWAMKGYGSYV-EDMSITEQIHITTTLSTIFSIINFRRKHAFFLRQTALLILPLIAKPRN----------------------SSPQTNKPPTGSESGLLTCLKKVTETYGIG--------------------------DDVDQTDYSVMAEDARPLTFGWPDIQIDVLKDALTISDSLPDYPSMVKYTTRLLRK-------------LFMYLHRDEQIRLSASIPRIVSAGKKQGL-DMEFKYWGLNVVKGIQVCRPTSRRIPYPHAGKKLSLKN-EEKKEGVSPFIYQSFNKKKADNTQIHLVANETSYFLVTLANPFAFDLDIQSISISTDGVAFTPNTMSITIL-ANTSITLRLLGTPTEPGELIVRGCKIKVHGCLEQEFCVYLPPSDEEISKRIKKCGLAVLDNLSHTTNNQKDNAQPNDHENSQSPTKPGFLKVSVISEQPLIKIKSTSLMHGAIMLFEGEQAEMTIKLENVGKIPVDFLSLSFSDSTIANTQALLNSSDMPAEEAYEMELYALRQSVFSWNQKD----NVKILPGSEWIVNINVFGKRGCVNGTIQIDYGYLNRPNTSDDEPFYTRQVHYPVLLTIHQNLETISMDILNFKPLCEGENDGVVNSCSDNNKLIEDLLKVMKWNNKG---------------TKEDFMEKMENDYCLLTFDIRNVWHVGFDVTIEADEGEEI--------------DPLSITTTIQPTSTARIILPIKRISLSEKEYTQPIPSL-SEKQFVVSKPKGTVEQERLALALFWYREKLLQKIKAIWESQLTNQKGVVDIRSLRLNKSMLNVLKINEISFGIDIEDGSK--------------VTKLSCNQFKCPVNEFVKMKFIIYNHQEKPSKLCIRIQPVQSYSDGIMEWDLSKRMVWNGLLQTPLPKIEPKSSVTYTLPI 1290
118 0.000e+00UniRef50_A0A0C7B2I1 Uncharacterized protein n=3 Tax=Rhizopus microsporus TaxID=58291 RepID=A0A0C7B2I1_9FUNG  ali  23  1...............................................................MHFQFVTKYN-RDHSHLEDFQPHRRIFGVIGIMDCQEWKDK------------------------DLSEGYQKFVDMLVQYPTAIATRCFAFDPTENQPDD--TKGLIMIPNV-GNMSFYMSTMICDFASEILNQFANIAERIESLKALESPIPMGSFS---------KKYDMPNGRIHPQPSTSTPSGKSQGQQNNRASQPVPTSSISSSFLKRASSAAGTGRQNTSASPPSPRPSLSRSTTFSNLVLGGESGKTVQRTPGRIKKLLADFYLLAGRLPDAIQFYNEAIEMTKDHSDYLWLASAKEGLACTMLLMAFLQADVGHIISRN---------GTATDLNTSQDINRPPPISDKTGVENQKSVFSEITEMYEDAVQTYLRVNSSTNIPIPSLVFAEACLKISRFLTLVFLNNGWSD-AVLAKVVYADMTDLKNQRNDRFKNSGIARYSIAKYVTKIWLVDIDEL-SMMDQVNIMTHMTSILSVIGYHRKSAWFMYEMLNRMVPLLIQGRAAAAS------------------TVNGNKKHLDKNDDGILEVLKRICEVYGIGESNVHDGGALEILQN---------KINETYQRQQETSTKKVNTLGFGWPALQIDILRECIVISEAIQDHASMLYYTTVLLKNLYQY-------------ISKDEQIRLASSIQRIVNISKRSGQMDNNVNYWGFNIVKSIEPIQPIPRKAIYQHPIAKALAASKEGRINSGDPFIYNPFAKKKDDKPQINLIKDEVCEFKVTLSNPFGFDLELSNIVLSTSGVDFSPVPA-AATIPANDTLTIRLMGTPVETGLLTIKGCVIKITGFAEQEFLYEKQKVEQVKQREYKTLRPAESKGYKYSGLQALYKTLTPELDLNHDTPQEEYQQINVIEDQPLLKIKSSSLLHGAVMLFEGEMTRICIQIENIGHIPVDFITLSFTDSTTT--HPKLVNPELPPEEQYEIELYTKGTPVFSWEGSKGENNQISLLPKETTDIVVNVYGKQGCTGGAVYIDYGYLDRQSKELPTTLYTRQLYFPVMITVYQHLEPLNWDVLYLRDSMAVNEDAVEQALKKINTLDSTDSGSHNQPVEELVLITQ-----------KASDKNDKNPYCLLTLDVRNAWTVPFDVEFTIDNSELG-------SEDVSEGEILKSRITIQPALTKRIVLPLKKLYLTSEQRLQPIPSFEPNKQFVVSQRKMAPEQERAKLQMFWYRELLLDRVKATWRCKTTGREGVINLRSLRLIPLQLNILKKQDIEFIITMSGEEQ---------------HCTGHRQFECPVNTFVTMNVTILNRQVRPVKLILRTQAVQSYNDGAKEYDLTEKMLMQGVSQLVLPEIPSNEEIVHNIP. 1282
119 0.000e+00UniRef50_A0A1X2I430 TRAPP II complex n=2 Tax=Absidia repens TaxID=90262 RepID=A0A1X2I430_9FUNG  ali  24  7...ITSTCRVKVLLVPVAPIKKSTFWKHVELVKQFDVVRLGDVTPDQNGASAKFSSQVFQEGQMHFQFVTSY-RRDHAHLEDFQPHRRIFGVIGIMDCQEWKN------------------------RDLSEGYTHFVNSLNKYPTAIATRCFAFDPTENQPDD--TKGLIMIPNV-GNLSFYMSTMVCDFASEVLCQFSKIATRIEQLPSLESPIKIQYQAQPKRTPYYQSXXXXXXXXXXXXXXXXXXXXXXDQFTSTSPPNVSPQPSASSMASGNINDNNNRPSPTYNKMAALPPMPAPSMSRASSAQGTADSTKTKRRTPGRIKKLFADFYLLAGRLPDAVSTYQQAIETTKSTSDFLWLASAMEGLACATLLLEYLQDDIGHIVSRNVDPP------SPTESPMSPTTNGKDHGMEDISLKPAPSSFTEVIDQYTALIQYYNKVHTTSTIPLPGLVYAEACVKIARLLLTVYVNKGWNDQVLALVVQGKISTSAESSTNKPSTPVSISRFEIAEWVMRIWSIQLN-HLPLLDQINFMTQMSTVLSSIGYHRKAAWCMHESVHCMLPLLVQGR---------------GALSNSQDLDN---KGSGTDKHGVLQLLKRICEVYGIGERNVLDGGALNAMQQQNNQDKRSQRSHGGGYYKENTRL--------GWATLQIDILRQCIAISEALPDYGSMLYYTTVLLKNLYQY-------------IPKDEQIRLASFIQRTVSIGKRSGLVESNVNYWGVNIVTCIEAVQPIPRKAVYEHPIIN---KSVVTNKVSGDPFIYNPFARKTYEKDRVNLVKNELAEFKVTMTNPFGFDLELQNATLSTSGIHFIPVSISASI-PPYGTLSLRLAGTPEESGTLVVRGCTIKIVGFAEQEFIYNSSLKKTDPGT--KTLANDGFVKFKYSGLNAIQNSIKKHEDPNEEQNNPEYYSVQVIDDQPLLKMTSTSLLHGAVMLYEGEMTHIKMEIENIGNIPVDFITLSFTDST--SSNSLPINPELPIEQQYEIELFIKGIPVFSWEGSQSIGKKVYLASGTKTEIVVNVYGKRGCSGGTIQLDYGYLDRLSKDPTTRFFTRQLYLPVLVTVYQNLEPMNWDVLYLRQSSAHNTENDSHLSHHPNHQSTICNTEGPQNHPTEDLILLAQQVR--------DLHQDKNDYCLVTMDIRNIWTVPFDLSFTVADDLDCDDNDNATEP-------VQTTFSIQPGWTRRLVLPVKRMFLSAETCNQPIPSFEPNKQFVVSQPKMAPEQERERSHMFWYREKLLDRVQASWKCQSTGRHGIFNLRSLRLNSQQLAILKKEDIEFLVDLNG---------------HTVKKAAHRQFQCECNDFVTMPVSIRNRQVRPVKLILRVQPVQSYNNGAKEYDLSGKLLVQGLQQIVLPEIPAGAMTTHVIPI 1423
120 0.000e+00UniRef50_A0A168MZT2 Uncharacterized protein n=1 Tax=Absidia glauca TaxID=4829 RepID=A0A168MZT2_ABSGL  ali  22  7...ITSSCRVKVLLVPVAPIKKSTFWKHVELVKQFGVVRLGDVTPDHKGASATFSSQVFQEGQMHFQFVTSY-RRDHAHLEDFQPHRRIFGVIGIMDCQEWKD------------------------RDLSEGYKHFVNTLNKYPTAVATRCFAFDPTENQPDD--TKGLIMIPNV-GNLSFYMSTMVCDFASEILSQFANIATRIEQLPSLESPIQMQYQIPTHKSXXXXXXXXXXXXXXXXXXXXLQQHDQMIASTVPPSISPQPSASTPSMASGSNNHASTGSSFNKMAALPPIPSQSMTISRSNSAQGASDLTKTKRRTPGRIKKLFADFYLLAGRLPDAVSHYQQAIEMTKSSSDFLWLASAMEGLACATLLLEYLQGDVGHIVSR-----KVDPPSPAESPMSPTVSNNKDHGMEDISLKPAPSSFTEVIDQYTALIQYYNKVHTTSAIPLPGLVYAEACVKVSRLLLTVYINKGWNDQ-VLALVVQGKLSASTELKPKQSTSVSISRYEIAEWVMRIWSIQL-DQLPLLDQINFMTQMTTILSSIEYHRKAAWCMHESIHCMLPLLIQSR---ATLSSTRDHGG---------------KGSDKDSQGILQILKRICEVYGIGEHNVLDGGALNAIQQQ-----------DQEQSIRHGGGYFKENARLGWATLQIDVLRQCIAISEALPDYGSMLYYTTVLLKNLYQY-------------IPKDEQIRLASSIQRIVSMGKRSGHMESNVNYWGVNIVSDIKVVQAIPRKAVYEHPIINKPAVAA---KAAGDPFIYNPFAQKKNEKYRVNLVKNELCEFKVTLTNPFGFDLELQNVLLSTSGVPFAPVPMS-TTIPAYGTHSLRLTGTPEDSGTLVIRGCSIRIVGFAEQEFLYDLSSKKVDHNRYSKDEPTDSKFVKFKYSGLRAIQNASKRQETTDEPNPIEYYNVQVIDDQPLLKITSTSLLHGAVMLYEGEMTRIKMEIENIGNIPVDFISLSFTDST--SSNPLPINPELPMEQQYEIELFIKGMHVFSWEGSQSIGKKIYLTPGAKTEIVVNVFGKRGCSGGTIQMDYGYLDRXXXGETSSFYTRQLYLPVLVTVYQNLEPLNWDILYLRQGGASSTNNTNELLAGAVDDQQSLS-------RTKSDQNQAVEDLIYLTQKVFDRHQDKNDYCLVTMDIRNTWTVPFDVTFEVCDSTDHHVDTTTS------CAPIKTTLCIQPGWTRRLVLPVHRMFLSAETCNQPIPSFEPNKQFVISQPKMAPEQERTRSHMFWYREKLLERVKATWECPATGRHGIVNLRSLRLSTQQLAILKKEDIEFLVDLDGA---------------SVHKDAHRQFQCECNDFISMGVTIRNRQVRPVKLILRVQPVQSYNSGAKEYDLSGKLLMQGLHQIVLPEIPANDMVTHSIP. 1433
121 0.000e+00UniRef50_A0A1X0RYA7 Trs120-domain-containing protein n=2 Tax=Rhizopus microsporus TaxID=58291 RepID=A0A1X0RYA7_9FUNG  ali  23  6..DITSCCRVRVLLVPVSPIKKSSFWRHVELVKKFSLVRLGDVTPDLQKGNAKFSSQVFQEGHMHFQFVTKYN-REHSHLEDFQPHRRIFGVIGIMDCQEWKDK------------------------DLSEGYQKFVDMLVQYPTAIATRCFAFDPTENQPDD--TKGLIMIPNV-GNMSFYMSTMICDFASEILNQFANIAERIESLKALESPIPMGSFS---------KKYDMPNGRIHPQPSTSTPSGKSQGQQSNRASQPVPTSSISSSFLKRASSAAGTGRQNISASPPSPRPSLSRSTTFSNLVLGSESGKTVQRTPGRIKKLLADFYLLAGRLPDAIQFYNEAIEMTKDHSDYLWLASAKEGLACTMLLMAFLQADVGVTKKKNK--ETKLGNGTATDLNTPQDTNRPPPISDKTGVENQKSVFSEITEMYEDVVQTYLKVNSSTNIPIPSLVFAEACLKISRFLTLVFLNNGWSD-AVLAKAVYADMTDLKNQRNDRFKNSGIARYSIAKYVTKIWLVDIDEL-SMMDQVNIMTHMTSILSVIGYH-------RKSAWFMYEMLNR-------------MVPLLIQGRAAAASAS-----NVHDGGALEIL--------------------------------QNKVNEAYQRQQETSTKKVNTLGFGWPALQIDILRECIVISEAIQDHASMLYYTTVLLKNLYQY-------------ISKDEQIRLASSIQRIVNISKRSGQMDNNVNYWGFNIVKSIEPIQPIPRKAIYQHPIAKALAASKEGRINSGDPFIYNPFAKKKDDKPQINLIKDEVCEFKVTLSNPFGFDLELSNIVLSTSGVGFSPVPA-AATIPANDTLTIRLMGTPVETGLLTIKGCVIKITGFAEQEFLYEKQKVEQVKQREYKTLRPAESKGYKYSGLQALYKTLTPELDLNHDTPQEEYQQINVIEDQPLLKIKSSSLLHGAVMLFEGEMTRICIQIENIGHIPVDFITLSFTDSTTT--HPKLVNPELPPEEQYEIELYTKGTPVFSWEGSKGENNQISLLPKETTDIVVNVYGKQGCTGGAVYIDYGYLDRQSKELPTTLYTRQLYFPVMITVYQHLEPLNWDVLYLRDSMAVNEDAIEQALKKINTLDSTDSGSHNQPVEELVLITQ-----------KASDKNDKNPYCLLTLDVRNVWTVPFDVEFTIDNSELG-------SEDMSEGEILKSRITIQPALTKRIVLPLKKLYLTSEQRFQPIPSFEPNKQFVVSQRKMAPEQERAKLQMFWYRELLLDRVKATWRCKTTGREGVINLRSLRLIPLQLNILKKQDIEFIITMSGEEQ---------------HCTGHRQFECPVNTFVTMNVTILNRQVRPVKLILRTQAVQSYNDGAKEYDLTEKMLMQGVSQLVLPEIPSNEEIVHNIP. 1326
122 0.000e+00UniRef50_A0A0E9NG87 Uncharacterized protein n=1 Tax=Saitoella complicata NRRL Y-17804 TaxID=698492 RepID=A0A0E9NG87_9ASCO  ali  35  11.LSYVAPSRIRVLCVPIGRIKRSTFDNCVTRLQACRMVRLGDVSADTRKERATCSPQGFPDGRVVYDVGTSF-DQDHEYLEEFQMWRRTMGIIAIADGAEEND--------------------------LEALNEGMGMLKMRYPRALVQQCFVFHCEVAAEGKYPEHSAFIYSKRASKASSFLRTVMCDFTATMLSEFAPLAQRLQSLTTLDSPHTATRLSYPSSENLVTNSPRYS------------------------------------------LPPAAPNGELKRSSSMSSKDMKRYTMSGLGSSAGSMTERAKSKGKGRVSKTLGDLYLLAGRLPDAMREYAEAVAIAKANSDHLWHAAALDGIGIALVLMAYLHLDYQIPAVALVAAAPVPDKASLKAASSTLKLKSSAKTSSSRASSPNPHLMDFIPDLQNAIAALHQRSTNFREDSVPPLIYSETILRCCKFLCAVHVAGGWND-AALDNIVTDAAIPPS------TKSGYPPRAEIAARAIGARGIHL-DDMFVMDRIHVLGGLASVLGAIGLERKRALFLREIVQTIVPELIQARVVGAAEQGMHPA----ARMLNNNATAAPALGPMDLERGVLGMLEDMCAAYGIAVSAGDDDAF----------------------------EKEVVAGQFGWSQLKLSVLRDCISLCEALPDFPGVLRFTTKLL-------------AIAVPYLTKEEQGRLATNLARTVGAAKRIGMKDVEAVYWDPFVVRDVQVVKSQVYQTPTALPMSTLLPPVEEGEKKADNPFLYNPFEKKVAVKAENLLVEGELAEFEVVLQNPFGIDLDVQSLALEVTGVDMETQPI-AVVIPPNSVQPVVLKAKLLSTGTMIVTGCKIRILGCQEQSFPIREPP--DAEELDKWVTLKDVGEKTKKMGLSARKNCATAQANGSGPLAPPRDVSITVVPPQPLATVSATTLTNGATMLLEGERRVVEVTLTNVSSTPIDLVLLSFSDSTTGPLEQALANKSIPPDEAYELEVYLYNRRAFSWDV--ATEGKVNIAPGAEETFKVDILGKRGLTDGRIQVNYGYLGDDRESLT-RFFTRQLTVPLLVTVNASIDMIGCDVFPFAGEVSQDSDLASRSTAAKAFAEAASGEG-----------------------------------CLLLIDLRNVWPNSMHVELSISNGPGDE------------SEQFTASDLIQPGRTSRLALPLRRIDLDDFTRGIPSLSP---KQFVVSAGKYSPEQERQAREAFWYREELLKRIGGKWKDLESDREGAIEMRGLRLSARMVDLLRVPLVEVEIE--------------RIEGEGVTSIGKRRWRVEMDEFVQIRTVVRNRKPEATRFFLRLQPSMQHQPLPTALDLARRVAWNGCLQTSIGVIQPGGEVEHVIDM 1284
123 0.000e+00UniRef50_A0A074YMW8 Uncharacterized protein n=4 Tax=Aureobasidium TaxID=5579 RepID=A0A074YMW8_9PEZI  ali  37  5PLSPIAPARVRVLVLPAGRIKKHRFMSFLERLQQHDRVRLGDISPDTKSNNSLFSPLAFPNGSLLYNFSTSMAPPSHAQLAPFDLFRESMMVLGIADALEYESSPK------------------------DELQHVVKRLAEQHPKMLLSQLLVMDCTPEQQNNWSLDDAICVPPSHASKTTTMNTIMCDISAKLLSEMATYATAVQALPSVQSPGASTRPTDSRPYLDRSLSLRTDASRPESPAESSAVLSP------SETPPSKAPPTNFDDMGAHT------------RSDSGSKIANRDRMSVQTFGSTSAQERAKNKGKARVGIVIGNLYMLAGRWNDAWRELVEHTNKARSASDYLWYAKGLESIVVCMLLLIWSGFDFPIPAICNSGPDRSSSIISSA--ITRDGVPPIGQQDPTAAKNAAVRASRLLPDLVPMIISVYERTTVLAGEPMSPVAYSESVLRLSKLLAFLQNAGGELDSTILQKIASTSSRSLYQPRINASLSGGILKHAIADMALRAYPPPS-AGVPLADVVAFQSGIVSVLSMLGLERKKAVIVKEMITSLVPALVQARKVGAAEMGIHPAASLSA----AFSTGLTPSVTNDDQVGLGDLLRDLHYTYG------ARDRSHHDSTNVASGTGLENALDMMMDATIAMATQSASTKSFGSVNLKIDILRACIDFCEALPDLPGVVHFSALLLRVVGPQGTMTAHEHNRRVTLVTEEQLRLISNMARTINAASKIGLPNIQAAYWDDFIVRDVQWVDDTNNEKLRERHKSDLLFD--QSNKPGKSPFLYNPFAKETHKTEEKIVVVGEPVELVVTLQNPYDFEIKIEHLSLVTDGPAIDVD-QQPVILGSARLQNVMITARARKGGQIRIIGCSIRISGCKDQVFPIYQSYWKPDFPVKIKDLGLTARDATSITTQS----KNSKGRASKPVQPKPTEVSATAIQAQPHIVFDSLSISESALMVLEGQKKSFRVTLRNTSDIAVDFLHVSFDDSLTSSIHTALAAKELTKPDMHGLELELSGNPTFRWTRLG-GGQDMVIRPGDKATFEITVLGKPGLTAAKIMFDYAHLGQPFSEVEGRAFTRQVIVSVDITVNASIQLHRMDFTEFSPDFAWANRGLQKQGQRPKSPRSPSHSVEKGSNR------------FRTLLDRVGLESSNEEHCLLLLDLRNSWPNPLTVSFQVRSSSSDET----------WDRAYTVHEVIHPGHVARLVLLLPRLHVVNPFAPIPILSQQNQRQFVVSADGPVSADERATREQFWFREEVLKYLRGTWEEKGSDRNGNIDLRGLRLSPKMINTIRLQDVDVRMSVIASEGED------------VQQSGRSRFIVPAASLLTLRTTIHNKSHGTIKALLRLQPILADQNSEASLDISRRLLISGTLQQGLPVLLPHSSATIELGI 1353
124 0.000e+00UniRef50_F0XD02 Hypercellular protein n=2 Tax=Ophiostomataceae TaxID=5152 RepID=F0XD02_GROCL  ali  36  373PFLPISPARVKALVLPVGPIHQDRFASFLQRLIGESSVQLRDISADGRPNRNMFNPLAFPVGFIFYDLITHVPQPSHLALTPFDQYREPLVVLALADGAAIKSVLFGSRRQSAA-------GRSIEERNIRTLYQELEALRDTYPRVLVHRVLIFDYSSPETPIPIPEGMATVSSPAQSKRTTMRMVMCDVSSLLLAEMNTLAKSFEAMSYIESPAQAMRSSSLKGNDHSSAADRSQVRMSMPPARDSSSTSVTGRPSTPVRSGLSGPATTFDEIGKTIPSPERNASPAISDSADSFRSMSDHRVSVQGFGSGGLNERWRNKGKSRVTIVVASLYLQAGRWTDALKELIDGATVSRSNNDHVWHGKALELIVVCLFLLGWADIEFQVPTICLPPPEKGAAAAATAHALEAAER------AHPNQPRWLRNLQQILPDLLERILGLYGR---ISAERLPPLAMAETTIRFCNILTALHTADGVLGRAFLDIVVVGRSKAEEARTMSPRPGVVPGRPQILTSVLRAFPAATAADLSTVDRIVILSGIASVLGRLNYRRKRALVVRELLSVLTDGLVEARTRGAAELGIHPAAGLVSGGQGSGSGVALDLAEGDLETGVEAFLGLLLRTYGVVELQP---------GRQTDNETAKSVIADTDEAVFSRIGGQAAARQFGVPSLKMDILRACINFSEALPDFGGVAKFSSDLLRTAGSGVAPGPRREDAAAMITRDEQVRLATNIAKATGLARRLGLADVAAEYWDEFLVRGVRLELPPALCVPVAHSESELPVVTTVRTSQDVDPFIHNPFLKAVDKEVEQTLVAMEPATFRLTLQNPFDMEVVIDSIRLETTGVAFEAF-EEGVVVGPYRTQIVRVGGIPQAPGSLNVTGAIVRVHGCRERRFPILRQPWMRERADKIKAIGVAPFEEGGSGNMMGSSGVL-----------AAEKLSLQVIPAQPLVVVQSTTLAQSSAMILEGERQAFSVTLQNLSTTAVDFLIFSFQDSTQATMQAALESRDASPAELYEYELMLAKRPALRLRVDEKTSQNRYIGPGETATFDFELLGKPGLTDGTIQMDYAYLGVTAEGAGGQFHTRQVSLHLTVTVNASVEVVRMDVLPLHGQIPGPLWERCGGER---------------------------------------RKPDPDSFCLLLMDLRNAWPSDMRVRLW----------TGGSSGGDGSDADATAIEHILPGNTCRVLVPMRRIYLEDPHASIPALNPARQRQFVVSTSKISPDMERATRETFWYRERMLDLLRGEWTTGGEERKGAIELRSIRLTMRMIEAVKVEEV--------------------------------------DDFMQLRVRITNRTARPIHPLLRLMPSLCHRPHNVALDFTRKFAWNGTLQQGLALLGPRASTIVRIG. 1782
125 0.000e+00UniRef50_A0A1X2HSY5 TRAPP II complex n=1 Tax=Syncephalastrum racemosum TaxID=13706 RepID=A0A1X2HSY5_SYNRA  ali  24  7...ITSSCRVRVLLVPVQPIRKSTFWKHVELVKKFSVVRLGDVTPDLQKGAAMFSSQVFQEGQMHFQFTTSY-SRDHAHLEDFQPHRRIFGVIGIMDCQEWKDK------------------------DLSEGYRRFVDTLHKYPTAIATRCFAFDPTETQPDD--TKGLIMIPNV-GNMSFYMSTMICDFASEILSQFATLASRIENLPSLESPLPRGYYVQ---------QFDPTGIVPQPSVSTPGSPGMNGRLSQTPKPTQSSSSSLLKRASTPNQPSKFQLNRSPMSPTLPPQPSMTRSTSTGGLTTTSESSKTRRRTPGRIKKLLADFYLLAGRLPDAVNFYTQAIEMTKSSSDFLWLGSAMEGLTCATLLLEYLHADVGHIVSRPPPVPESAPTS---------------PTSESPPLLQPKSTVQQVIERYVDLAQHYTKVSTTSNVPMPSLIYAETCIKMARFLLTVYVNGGWSDKVLSLLIQGRKSRFLTLEEMNTYKESGIARHEIAEWVTKVWAVPLDE-MPLLDQINLLTYMASTLNTIGYHRKSAWIMYESVNRMFPLLIQGRANLA-------------------GTRDTKKDPGRSDSGILDVLKRVCEIYGLGEQNVHDGGALEVLQDREKEHKEESGVRGAVAKERL---------RFGWPELQIDILRQCIAITEALPDYGAVLYYTTVLLKNLYQY-------------IPKEEQIRLASSIQRIVAMGKRVGQMESSVNYWGVNIVSSIEALRPIPRKAVYQHPLPNAVAAAAKEEPSSADPFIYNPFARKRDEKQQVILVKDELSEFKVVLSNPFGFDLELQQVTLSTTGVPFNAVPAT-ATIPANGTMTLRLTGTAEREGPLVVRGCVIKIVGFAEQEFLVDQSQTSTTREKEDKTEIRLKQSGLGLIQASRKR-------ETSGEMKPVKFYEVNVIDDQPLLKVKSTSLLHDAVMLYEGEMTHISITLENIGNIPVDFVTLSFTDSTT--VHPLPMNPELPVEEQYEIELYTRGMHVFSWEGSKIIGKKILLPPGGEWEIIVNAYGKRGCTGGTIQVDYGYLDRATKEDTNVFYTRQLYLPILVTVYQNLEPLNWDILYLRHNRPISPDDAAGALERVQHLSLENG------------SAFHQPVEDLLTLTQISDDSAKNDYCLVTLDVRNIWTVPFDTEVTIDN-----------SPDLDGSAPVKSLVTIHPGSTKRLVLPVKRLFLPHDTCIQPVPSLEPNKQFVVSQPKMPPGQERLRLQLFWYREHLLKRIKALWRCGSTGRHGLLNLRSLRLMPTQLNVLKKENIEFVVDMEGA-----------------KSTAHRRFTCKVNDFATMYVRIRNHNVHPVKLILRVQAVQSYNDGAKEYDLSDKLLIQGLQQVVLHEIPPNEEITHRLP. 1330
126 0.000e+00UniRef50_N1JFG9 Hypercellular protein A n=28 Tax=cellular organisms TaxID=131567 RepID=N1JFG9_BLUG1  ali  38  46.FSPTAPAKVRVVLLPIGQIKRSRFLSFVKRLQPEHAVYLADVSPNGQPNKNMFSPLAFQNGIIVYDLMNFHPSDLRTILSPFELYREPLVILSLADGAGLC----QTRNNESEQGGFHEKENLQVHNVMQELKQDLMNIKERYVKALVHQILIFDYVSNNSASHLPEDIVAVPPPEKCNRTTMKTIMCDVSSKLLANMTDLAKSIQELTTLDFSSSSFSNQDSNQAITLSTKVKASTRRNSELTASEKTSTSPTRIVDRNQSRMSMPVGTLDSKISSKLASQTKPPTKRTSSDSSSRLFSPDEASDKSTDPGIQSERSKSKEKGRKRIAIGSLYMQAGRWSDALKELVEGATIAKNILDHLWHAKALDHIMVSLMMLAWRGLDFQIPQICYNSGEKLFSSSSHEESNSASR-----------RAARLRSLALLFPELTDRILNLYNRASTNTGESLPQFSFSESVIRFSKILTAIYLNGGLLNNDILQQAVLGTPPGSTPNVMTPRLNIRPARSEIATLLFRAFPAASSDNFSVVDRSIILSGIAAVLSSLGYRRKKALVIRELVSYLIHGLIQVRIKGAAEMGVHPAASLAALSSINSTEGFLDLNGDDLEVGVDAFLGLLGQSYGVVSF--------------LASYEPNGQIDDSNEAIISRILQNSSVRSYGNYKMKMDVLRSCLNISEALPDFRGILKFTADLLRTAGSGVAPGPRCRDASPSISCEEQVRLATNISRTLTSARNLGIDNLEAEYWDEFLLRGVEVEALPKSRLPISHTPSELPGGTTDVTSQEINPFIYNPFLKVPDAAADCLLIAGETATFKITLQNPFEFEVEIESMRLQSIGIECDS-TSQKMVIGPYRTQILSITGRAKEPGQLKIVGCFIKIHGCRERRFPIFEDPWSPQREVKIRTIGISSLFKTEEKN-SISTSQSSLDSFSNVIPPKPKIVSLNVINKQPVVIVKHTTLTQSAIMVLEGEQQVFSVTLQNISDTPVNLLLFSFKDSTQEPLQAILNDRNSEVTELYECELILTRKQSLRWKRKD--DAMPFIAPGAMATFEIEVYGKPGLTSAVVQIDYAYLEAPVVEIQEKFYTRQVSVPLSVTVNSSIELVGVDVIPFSSSIPRSLYANFGLQQKGESSFKSE------------------------------------DYFLLLLDFKNTWSNQLTVCIEIANQGSIEEQ-------------------ILTGKTSRIMIPVRRMFVDHISAPIPSLNPSRQRQFVVGIGNSWAGSERAKRKAFWYREELLTSINGTWSKSSPHRNGVIDLRSMKLTTRMIEAIKFDDLDIHLSIGSNLQDS-------------------KVELSTGNFSELKIQIINKTPQSISSILRLQPSMRNQAQNYPQDISKRFVVNGLLQQCIPKIPGGGSIELHVG. 1407
127 0.000e+00UniRef50_A0A165FTT6 Trs120-domain-containing protein n=1 Tax=Xylona heveae TC161 TaxID=1328760 RepID=A0A165FTT6_9PEZI  ali  41  5PLSPVAPARVRALLLPIGRISRSRFASFVERLAPHNVVRLGDVSPDNRPNRTMFSPLAFPTGSVLYEITTSISPPSYSALSPFELFRESLMIITIADNREINYSGNDGQMENG--------------PGLSTILEELEEIRAKYPKALVHQALLFDYSAPHDGASLPEGILPVPPPELSRTTTMKTVMCDLTSLLLGEMTTFAKALQDLPTLESPMSESSRPVSPSGSTDRNAYRMSMPASISTSSEPSGTSEGRPPLNPSNSAPAQPPTTFDEIAASGLQRSNSIMNTVSRSSAGTREHSRDRISLQKFGTSNMTERAKNKGRARIGLVIGTLYLHAGRWGDAVRELVENASIAKANSDHLWHAKGLENILVCLLLFAWVGMDFQIPQICYPIADKSSKSPHHTPSGSSTDLNSGRRGHVPNRLVSLQNLTALLPDLLNNTINLYNRAANFSGEALPQTAFSEAVIRYSKLLTAVHLSNGHLDDETLQHLITNAPLCDPRSITIPRSVISPTRTEIVTLLFRAMPPSAKGNLSVVDHALILSGIASVLGSLGLSRKKSLVVKEMLLLLVPALVQARKLGAAEAGVHPLAALSALNTDSDSLAALDFGV-DTAVGIREFLAVLGHIYGVVGTSEDRKSSLPGGSENVNRNSLSGSKNDSNEEIIERIMQDNTRRMFGSHPLKMNILRTCINLCEALPDFQGVLQFTTDLLRTAASGIAVSPNDEDWYPVLIREDQLRLAANISRTIGAARKLGLHGVAAEYWDEFLVRGVKLEDPPLWKRAIPHANSELKG--LEEHQNEKSPFIYNPFSKKASSAQDRFLVAGEPSQFTITLQNPNAFDLEIEHMEIESEGVELDA-AVHGLILGAYTTEDVPITAIPRACGQMKVSGCVVKIKGCRRRRFPIFRETWRPEHDFKVKSIGLAASRHRVPRPMSTVSVGSKMRPPPPPPGPKIDTLDLNVIKSQPVLVISGTSLPQSSIMLLEGEVKTFTVTVENISTTPVDFLLITFHDSTESSLKAAISNKHTAASELFELERMYTHQRSFRWRRKS--DEAISIEPKQKATFEIEVLGNPSLTSGLVQVDYAYLGAPRAEIKDKFYTRQVTVPVTVTVNASINLLRVDLLPLSQDIAWAKAHSQPMVN-----GSSTQDEHYIADTTVPSATSITDTCFKSLLNGTNSPSKSKEHCLLQLDLQNAWPRPLAVTLEPNTVSGPEADGLTSPPSSPPDEHYSVQETIQPGHISRILLLIPRIFVQNPYKPIPAFNPATRRQFIVSSSTISPDVERTHRAAFWYREEILKRIQGTWHDDACNQQGEVDLRTLRLSPRMIEAVRVEELGIEMSISGTGSSQTLSSSPPPNDPTVHQTGHATFLAPAETFLILTTRLHNRTDLPILPLLRLQPSLANQPLPVALDLSKRFAWTGLLQRPLPLLQPGATTEV.... 1483
128 0.000e+00UniRef50_D5GMR0 Uncharacterized protein n=4 Tax=Pezizales TaxID=5185 RepID=D5GMR0_TUBMM  ali  39  6.LSYAAPSRIKALALPLGRIKRSRFSSFVTRLQSSNVVRLGDVTPDSTPNRTLFSPQGFPNGQLIYDLTLSF-DKEHEYLESFEPYRRTYLIIAVADHTEGSDP--------------------------EILSQQLEELKFLYPRALYHTCLIFDSPPTLPNPSESSRFIPVPVKRESRSPSMRTIMCDITSILLSELSGLARTIQAFPTIDSPLSSENQVASSS-------------------------------------------------SSQDHRMSVPVGLGANLTVAGNTGAASKRMTMTGFGSASVSERTRNKGKCRVNIVIASLYLLAGRIPDALKEFVEGGNVAKNNNDHLWHGKALEGIGICLAILVHLKVDFQMPLIPYPTAE-VTKATKPSPSNSKPVTPSPDPGGVPDASTSPAKVNELLGELLEIILNLYTRSANFAGESIPQICFSETVIRFSKLRATTYVTGG-LNDESLDHVVFGKPLPSGKHLK-----IIPYKAEISMLVMRGYPFPLESLM-VLDATRVLSGIASVLGMIGSRRRKALVTRELIKILIPGLIQARVVGAAEVGVHPAAGLSAVSGGALGGSPLDLGEGDAECGVMELLEDLCRAYGVLPGKKDDDRSPSIA-----EKKESGNEEIVSSLATAEVIAEQEIRAFGWPALKIHVLRNCTALCEALPDFHGVLRFTTQLLRT-------------ADADLTKEEQMRLSTTISRTVGAARKLGLPNVEADYWDQFLLRDVEVVENSMWRPPISHAKNELMDADSDTPPSDKNPFIYNPFLKKAEAVAEPVLVKGEAAEFRVTLQNPFEFDIEVESVTLDVTGVGLEVQKV-GVVINPYRTYQVAVYATPQESGSIKVTGCKIKVFGCRERAFPIFTGLDNRERDTKRKRYGLKAADPKTERPVSTVSGRLSKPPPQ--LHPIPKNLDLTVVESQPLLVVKSTSLSQSALMVLEGERRTFNITFKNLSGTDVDLLVFSFRDSTTGRIQQALADKGNNPAEMYELELMLAKKRAFVWSEDKAGERAVFVPAHGVATFEVEVLGKPGLTHGSVQADYGHLGMPRNEVAERFYTRQVVFPVTVTVNASIELARVDFVPFSTDLQFDSFNNTQTNGVEGLKDEQEGVSQKG--------------QFKELFRRIGLKDDPAQYCLMLLDLRNAWPQALKVRMNVRDPSSKNPKDLEPS----WGDSFYAEDVLQAGHTSRVILPIKRVFLQNPSHPIPSLS-ANQRQFVVSTAKVSAEQERQSRESFWYREEVLDCVRGRWEEIATGRSGDIELRGIRLSPRMVETIRIEDIGIDVSV-------------KQVEEQVRKIGPAKYLVVTDNFLTLVTTLTNRTARTVTPLLRLLPALRNQNGGVAMDLTRRLAFNGLLQQSLRPLEAGEVRIVEIG. 1351
129 0.000e+00UniRef50_A0A1C7NHH0 Uncharacterized protein n=1 Tax=Choanephora cucurbitarum TaxID=101091 RepID=A0A1C7NHH0_9FUNG  ali  24  5.LDITSSCRVRVLLIPVSPIKKSKFWSHVELVRKFSLVRLGDVTPNHKGANARFSSQVFQEGQMHFQFVTKY-DRDHSHLEDFQPHRRIFGVIGIMDCQEWKDK------------------------ELSEGYQKFHDMLGQYPTAVATRCFAFDPNENQPDD--TKGLIMIPNV-GNMSFYMSTMICDFASEILDQFASIADRIEKLKMLESPIPIGFLP------RNVEQTRVQPQPSSSSPANRLSTSPTTNGNTGPSPTGSVSSSFLKRASTTASNNNRKSTINPSPPTPK-PSLSRSTTFTGSLNTGNDTNRTIQRTPGRIKKLFADFYLLAGRLPDAIKHYQEAIDMTQSSSDYLWLGSAKEGLACTMILMTYLRSDVGHIVSR----------QSVNSEEEETSDSKGASQESQTTKKPPVTLVSEITNMYEELVQSYIKVNTSTNIPIPKLVLAEACLKIARFLMTVFLNGGWNDDLVSR-IVQSPTIQVSRSTRFMTKGSDISRFSIANWVSKLWTMDMRDMI-IIDQINIMTQMSSILSTIGYHRKSAWYMYETLNRMIPLLIQGR--------------------ATIASTGAAKKMAKGDDGILEVLKRICEVYGIGESNVHDGGALQMIRNRFDSQERSK----------DVSGTKNDTVGFGWAALQIDILRECIVISEAIQDHASMLYYTTVLLKNLYQY-------------ISKEEQIRLASSIQRIVNISKRSGQIENNVNYWGFNIVKLIQSIPPIPRKAIYQHPIAKAIAASKEDRTNSGDPFIYNPFAKKKNDKPQINLIKDEVCEFKAVLTNPFGFDLELTNIVLSTSGIEFSAIPT-AATIPANDTLVIRLMGTPLETGLLVIRGCIIKITGFAEQEFLNEKQEIKKVEQPKNSKDIIQQSKESERFKYTGLLEIESSDTAASSSTEKSEQLTLNVIEDQPLLKIKSTSLLHGAVMLFEGEMKHITIDVENIGNIPVDFLTLSFNDSTTTHPKPI--NPELPSEEQYEIELYTKGTPVFSWEGSKSDSHQIDLPPGERTQIVVNIYGKQGCTGGAIHIDYGYLDRADQELPTTLYTRQLYLPIMITVYQNLEALNWDALYLRDNMTVTQSQFDHAVDLIKKLSIDHMTSTEQPVEELLMITQQANDD-----------NDKNPYCLLTLDIRNTWTVPFDVEFTIDNSTNDQ-----------PDSMLKSTVTIQPALTKRMVLPLKKLFLTHEERLQPIPSFEPNKQFVVSQPKMAPEQERAHLQMFWYREQLLSRVKANWRCRASGRSGIINLRSLRLTALQLSVLKKQDIEFIVDMTQEDGTTTVA--------------HRQFACQVNTFVHMNVTIANRQVRPVKLILRIQPVQSYNDGAKEYDLTEKLLMQGISQFVLPEIPSGGEYTHVIP. 1349
130 0.000e+00UniRef50_Q2GW75 Uncharacterized protein n=2 Tax=Sordariomycetes TaxID=147550 RepID=Q2GW75_CHAGB  ali  37  5PLLPVGPARVKALVLPIGHITRERFTAFVSRLNAESIVFLRDVTPDARPHRNMFSPLAFPDGAMFYDLMMHHPPASHLALSPFDLFREPLAVIAVADGAELPKAVFSKRHS---------GGKTVEEANIRSLYQDLEDLRDRYSKVLAHQVLVFDYTPAKENPPIPEGIVTVPPAEQSKRTTIKTVMCNISALILAEMTTLAKSYEGMSFIDSPGQSSGSSTSGLPDRSRVRMTMPPVPSKGQLSESAGSTPTVRPTTPVSPLPSPPSTFENIIGPMTPNSPEQAGLSRHDTSDSFRTQSQDRVSVQGFGPGGLNERWRSKGRSRVQVVVGSLYLQAGLWNNALKELTEAATIAKSINDHLWHGKALELTLISLLLLGWAGIEFRVPSILLPPHDKGNSAAIAMQEAEARD---------PHQPPWLRHLQVHMPELLDRIMGLYSR---ISAEHLPPLPHSEAIIRFCRMSAAIHTANGQICRESLEMIVFGVP-PRVPLTTSPRFTIQPTRTQIVNTLFRAFPTSSAELLTTVDRVVILSGIASVLGHLGFRRKKAMVVRELVSILVGGLVEARTRGAADVGIHPAAGLVGLNGASAAGGVLELAEGDVEHGIDSFLGLLMKTYGVVGGNTLGDKE-----------------DSSDGALVGRIQQQSAARHFGMQSVKLNILRACINFSEALPDFQGVLKYSSDLLRTAGSGIAPGPRRENAYPSITREEQVRLVTNILKTSSLSKRLGIGNLTAEYWDEFLLRGITMEALPPTRTPVPHAKTVLPGIITTRSSQD----------------------------------NPYEIELELESIRLDTEGAEFES-AVETTAIGAYRTQIMRISGTPKSAGTVKVTGALIKARGCRERRFPIFADPWAPDDAVKIKAIGLGALDV------------NAATVSPAIERLRPDHIELNVIAPQPVVVVKSSTLPQSSVMVLEGERQTFSVTLQNLSTTPADFLLFSFKDSTQEPLQLALGNRDATATELYEYELVLAKKQPLRLK--NRGDSKRFIAPGQTATFDFEILGRPGLTHGLIQVDYAHIGVPHDEVAEKFYTRQVSMELTVTVNASIDITRVDVLPLTGSIPAPLWSRATNNNHDQSTP--------------------------------PPDFTADTHCLLLLDLRNSWPSQMTIHLSS--------SPPADNPSETDTQPIEVEAHILPGNTARLVLPIRRVYLEDPHAFVPALNPARQRQFVVS-TKVAPEAERQSREAFWFRERVLDALSARWRTAAVAREGEIDLRALRFSPRMVEAVRVDEVDVAISVVDPAT-----GEPLAPSSTSSSTNTGRFAVDVDAFLQLRVRVTNRSARPVYPLLRLTPVLSHRPFNVSLDFTRKFAWNGNLQQALPLLEGGGVAEVAMGV 1361
131 0.000e+00UniRef50_A0A0B7NAV4 Uncharacterized protein n=6 Tax=Mucorales TaxID=4827 RepID=A0A0B7NAV4_9FUNG  ali  24  5.LDITSACRVRVLLVPVSPIKKSTFWRHVELVRKFSLVRLGDVTPDHQGTNAKFSSQAFQEGQMHFQFVTKYN-QDHCHLEDFQPHRRIFGVIGIMDCREWKDK------------------------DLNEGYRKFVGMLGQYPTALATRFFAFDPTENQPDD--TKGLIMIPNV-GNMSFYMSTMICDFASQILDQFAAIAERIESLNVLESPIPSGYVPKSLDPSNVNNRL-------LQPQSSNSSPQQLIRNSQALGPTPSSSVSSSFLKRASTTAANTRKSLAPANSPPTPKPSLSRSITLTGSPAAGDAGRTLQRTPGRIKKLLGDFYLLAGRLPDAVNHYNEAIEMAQNSSDYLWLSSAKEGLACTTIILAFLQADAGHIVSRR-------TLTTEDDAVVDPTPVTTTTAPPNEETNKLPTIVNEIIQMYDDLLQTYAKVSSTTNIPIPKLVFAEACLKISRFLMAIYLNGGWDKDLLTKIVQTPPSQSLLKRGTQLYKGSGLTRYFIAKWITKVWILDV-DDMPLIDQINIMTQMSSVLSTIGYHRKSAWFMYETLNRMIPLLIQGR-------------------AAMASSNSSKKSAEKGDDGILQVLKRICEVYGIGESNVQDGGTLQMLHSKFNNQQEKTDYA-----------AKSNIVGFGWAALQIDILRECIVISEAIQDHASMLYYTTVLLKNLYQH-------------ISKDEQIRLASSIQRIVNISKRSGQVDSTINYWGFNIVKSIQPIPPIPRKAIYQHPIAKALAASKEGRASSGDPFIYNPFAKKKNDKPQINLIKDEVCEFKVVLSNPFGFDLELSNIILSTSGIEFSAVPA-AATIPANDTLTLRLTGTPLETGSLIIRGCIIKITGFAEQEFMNEKQEVKKVEQTKNSKDIIQRSIESERFKYTGKRPNQDQKSTEKNIIENKQQEGLNVIDDQPLLKIKSTSLLHGAVMLFEGEMTHISIEVENIGNIPVDFLTLSFTDSTT--VHPKPINPELPTEEQYEIELYTKGTPVFSWEGSKADSNQIGKPPGKHTEIIVNIYGKQGCTGGAIHVDYGYLDRASQELPTTLYTRQVYLPIMITVYQNLEPLNWDVLYLRDNMSVTDSMVKDASNKIESLDIKRIESAEQPVEQLLVITQ-----------QASDSDDKNPYCLLTLDVRNTWTIPFDIEFTVDNS--------TEKDDANTNSLLRSVVTIQPALTKRMVLPLKKLFLTSEQRLQPIPSFDLNKQFVVSQPKMAPEQERARLQMFWYREQLLSRVKAKWQCRSNGRGGIINLRSLRLTSLQLNVLKKQDIEFIVDMSKEG---------------VATTGHRQFRCRVNYFVQMNVTIANRQARPVKLILRIQPVQSYNDGAKEYDLTEKLLLQGVSQLVLPEIPPNGEITHEIPM 1358
132 0.000e+00UniRef50_A0A0L1HVL6 Hypercellular protein n=1 Tax=Stemphylium lycopersici TaxID=183478 RepID=A0A0L1HVL6_9PLEO  ali  38  5PLSPIAPARIRALLLPVGRIKRSRFLTFVDLLQQESLVRLGDISPDPRPDRNMFSPLAWPVGTLLYELSTSMPSASHLSLSPFEQFREPLLVIGIGDASEYTWLHPSRAPDESSAEAFEDPPAE--DENANSLLFGIDDLREQFPRAYLHSLMMFDSATHTRHPRLPQETLLVPPKTHLKTTTMKTFMCDLTATLLAEMTTLAKSIQALPTLVSPASQSGTSRPESPVGNAQKDTHRASMPVLPSSSGGPLSTEDPRSASVSAQGTRTPPTTFDEISGINAANTLHQAASNPAKPSTKNAAADRVSIHGFGSGGVGERARNKGRGRISIVTGTLYMCAGQWVEAIRELTDGATRARTLSDHLWHAKALENIMV--------------------SFDKSNGTKSPQHTPTNSAADVSASSKTLNHDNSLDALNSLLPDLVNMILNLYTRAANFAGESLPPLAFSECVVRFSKLLAAINLSAGYLDEDSLRHLVQNIPYKQKPRFTVPRLSVHPTRNDIASMLFRALPGPVASGMNPTDRVVILAGVASVLSSLGLQRKKAIVMKEFITSLVPGLIQARKVGAAEMGVHPAAGLAALNGSGSGAGALNLGEGEVENGIDEFLGLLGRIYGIPNSKGTVPD--MTAADKRGENEESASDSVASQRVVDSILAISSLRSFGSLSLKLEILRTCLSFCEALPDFNGVLHFTALLLRVAGPGTAPKPNSTDVYVSLPRDEQVRLYSNISRTVTAATKLGFQHVETEYWDDFLVRGLFILDETEALRLTQRQGTELK----SDTQGKDGPFLYNAWVKKPQSAANTILVANEGYRFVIALQNPYDFELGVESLRIAAEGVEF-VGVEEHFLLGPYRTQKFQISGTARSAGELKIIGCYVKLIGCRERLFPIFPEPWKPKREAKMKRLGLKACLGAPTSRPSSAISPSIDRKATSQ--PRPESLTFSVIQDQPVIVITKVSLPQSAVMVLEGERKRFTVTVKNTSTTAVDFVHISFQDTATAAIHTATSNKDLAPAELHELEVQLAHYPSLRWCKDAEEEESVSIKPGAEMDFTIEVTGRTRLTDATIQIDYANLGKRRSEVEDRFFTRQVSAGISITVNASVQLQRPDIVPLSGDIGWSKATVSSQECYSEPARHSAGGKADAHLR--------------SFLKHKQNQGHDDEYCMLLLDLRNSWPNPLSITLEARRPSTDESQS-----DDPWKDAHSVNEVIQPGHVSRLVVILPKLYLDNPHAAVPSLNPANQRQFVVSTSKISPETERASREAFWYRQELLKIVRGRWKEEDNGRHGDLELRGIRFTPRMVEAIRLDDVEITAMLVSDXXXXXXXXXXXXXXXXVQQLSRAKFSAPIDTFLSLKTTIRNRSPHSISPILRLQPHLAALPHNIALDLDKRLSWTGVLQRKLPVIRPGASVESELGV 1435
133 0.000e+00UniRef50_A0A167Z1Q5 Hypercellular protein n=1 Tax=Sporothrix insectorum RCEF 264 TaxID=1081102 RepID=A0A167Z1Q5_9PEZI  ali  34  401PFLPIAPAQVKVLVLPVGPVHRDRFASFLERLKGEYAVHLRDVSADSRPNRNMFNPLAFPDGVIFYDLITHVPPLDHLALSPFDQYREPLVILALADGAALKTVAFGGKRQSA-------GGRSIEERNIRTLYQELEALRDTYTRVLVHRVLIFDYVPAPTHIPIPEGLATVPPIAQSKRTTMKTVMADVSSLLLAEMTTLARSYDAMSYIESPGQATGVFRPGSGSGGANSTLPSRRNSQYTLPPQRSSSVPGRPSTPVRSGLSGPATTFDDMAAASSPDRSVSPFDSASGDAGFRAHSQDRISVQGFGPGGLNERWRTKGKSRVTIVVASLYLQAGRWTDALKELVDGATVSRSINDHLWHGKALELIVVCLLLLAWADIEFQIPNVCLPPPEKGSAAVAAAQALE------AAEKAHPEQPRWLRHLQIILPDLLDRILGLYAR---ISGEHLPPLPLAEATIRTCNLLAALHLADGVLGRSFLDMAVDGTYDASRVLTTSPRLSVAPSRSHIVNTLFRAFPSSGADLLTTVDRIVTLSGIASVLGRLGYQRKRAMVVRELVSVLIGGLVEARTRGAAEVGIHPAAGQQQQPGQTNGAAALDLAEGDIESGLDAFLGTLLKTYGVVEFDPMGAAAPATVSTAAV--------DDGDAATIARIRMQAASRLYGMPGTKLNLLWACIQFSQALPDFAGVLKFSSDLLRTAGRGIAPGPRKGDAAPIISRDEQVQLVNNIAKTANLSRRLGLGEMAAEYWDEFLLRGVKAEPPPLPCLPVAHTKSELSASAAARTSQDVDPFIHNSFLKPADKTVEQILVADELTTFKLTLQNPYDIEVAVESVRLETDGVAFDAHVGS-AVLGPYRTQIVKITGTPKAPGALTITGAVVRVRGCRERRFPIFVQPWSPEREDRVKAIGIPPFRRHQTKDSPASPTVXXXXXXXXXXXXQAERVALTVIPPQPLVVVQSTTLPQSSAMLLEGERQVFSVTLQNLSTTPVDFLLFSFQDSTQASVQAALSNRDASPAELYEYELILAKKQALRLRPRAXXXXXXXIAPGAAATFDFEILGKPGLTSGTIQVDYAHLGQPADEVTTKFYTRQVALHLTVTVNASIEVARMDVLPLHGRIPPPLWEQCYRSGGEKRGSQEXXXXXXXXXXXXXXRDSDSDNTNSGGTHPEEEEEEEDKYCLLLLDLRNAWPSQMRVDLAAADGL-------------------MVTEHILPGNTSRVLVPLPRIFLEDPHAAIPALNPARQRQFVVSTGKITPDAERANREAFWYREAILGALRGSSSDTTPPRQGSIELRSMRLTARMIEAIKVDEVGIAMAVERPVAPEAAGGDAADDSDSWVTSS----TIPVDEFAQLRVRITNRTAQPLYPTLRLMPALCHRPLNVALDLTRKLAWDGTLQQALPLLAARTTTEVRIGI 1921
134 0.000e+00UniRef50_A0A179FIG8 Hypercellular protein HypA n=5 Tax=Hypocreales TaxID=5125 RepID=A0A179FIG8_METCM  ali  38  1....................................................MFSPLAYPDGAMLYDLITHVPPASHLSLSPFDLYREPLALIALADGEELHDETFSKRHSASGAXXXXXXXXXXXXXXX-------XXXXXXYPKALVHRVIVFDPPEGVHVHMPDEGIVTVPPREERKRTTMKTVMCDTSSLVLAEMTTLAKSFEAMTTIESPGLYSARSRRNSQFSLPQQDKTQARMSMPPMASRSPSNATVRPSTPPRSGLSATPMSPDGALGSSTGPSSPEQKPQKADADKSREVSRDRVSVQGFGPGGANDRWRLRGKGRTSVLIGSMYLQAGRWSDSLRELSEGATAARSLNDHIWHGKALELILMNLFLLGWSKLEFQIPTVCLPNQDRPTSTPGI--------LKTDGDGADPSQPKHIRHLQSLLPELLDRILGLYSR---ISSENLPPLPLAETTIRFCKILSAVHLSGGRLDQKALEVIVTGQ-VPSQTLTTSPRLTVTPSRQQIVNTLFKAFPSSSTELLTIADRTSILSGIANVLGPLGYHRKKAMVIRELVSVLIAGLVEARTKGAAEAGVHPAAGLVSLVPGSEAGVALDLGEGDIEHGIEAFLELLCKSYGVVGF-----DACKHENNDCGSDAGTGADADTIARVL----AQSSKRFFGFTEIKLNILRACINFSEALPDFNGVLKFSSDLMRTAGSGVAPGPKREDAAPHIHKEEQVRLVTNIARTAALTERIGLGDLAAEYWDEFLVRGIMLEPLPNTRAPIPHAKSVLPGANPSRASQDVNPFIYNPFLKEPDEVAAENLVAGETATFKVTLQNTYDVEVDIESMRLDTEGVDFEP-VAQDAVLGPYRTQLVRLKGRPKAAGAIKITGAIIKVRGCRERRFPIFARHWTPSRAEKIKTKGPPALDVGDEK---------------IPAKLETKLLSLNVVQAQPLVVVKSTSLAQSSVMILEGERQVFTVTMQNTSTTPVDFMLFSFKDSTQGPLQTALSNRDATPAELYEYELILMKKQALRLPRND---QSRHIPPGGEATFEFEILGKPGLTHATIQADYTFLGVPRDEITEQFYTRQLSLDLTVTVNASVELARIDAVAMQGHLPPPLL---------------------------------------ERLGADAENTPADKYCLLAVDLRNAWPSQMSIRLEGEEGM-------------------AVEDSILPGKTSRVVMPVKRVYLEDPHESVPSLNPSRNRQFVVSTSKISPDMERANREAFWYREKLLQNLKATWRTTSPKRRGVVELRSIRLTPRMIEAIKVDEVDISVSVEGAPDNT----------------------VYVDEFLQLKVQVVNRTSKPITPLMRLMPALCHRPLNVALDYTRKFAWNGALQQLLPELQGHDSTEFVIGV 1302
135 0.000e+00UniRef50_R7YIL0 Uncharacterized protein n=2 Tax=Dothideomycetes TaxID=147541 RepID=R7YIL0_CONA1  ali  38  5.LSPIAPARVRALLLPVGRIKRASFRTFTSLIQAENAVRLGDVSPDPRPDRNMFSPLAFPDGHVLYEMSTSQSTASQLSLSPFELFREPLVIIGVADGKEYEISTGRVANSSET----SGVDDSNVHQIRSELRDAVELLRERYSRTLVIRLFMFNHPAGIGEEWLPQETAVIPPVEQLKITTMKTVMCDLTSMLLAEMTTLARSYQALPSIASPGPSQLTNGVHSASPALDQQASHHRLSMPAHLPSSVASTPLDDSRPPADGTRTPPVTFDEIAGPGSTDDGSSSVTLSRASSASREASRDRVSVHGFGSGSVSERARNKGKGRVGIVLGSIYLLAGRWHDAMRELVDHTSKARAFSDHLWHAKGLENILVCMLLLLWAGVDFKIPQICYPITGKALSIRSQTPSASENDLSTLGSPKSSAQGGAARHLADLLPELIDMILNIYGRAANFTGEAMPQLAIAECTIRSAKSLAALHLANGVLSVAALDHLVRGVPFEPAPDLFVPKPTIRPTKHDISS<