current user: public

If you have questions about the server, please let us know.

Query: PF10177.9; W5KY66_ASTMX/13-159; Uncharacterised conserved protein (DUF2371 topsan), from PfamA32U

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# E-value Template Links and tools%idFirst RQDSLRTKNRAENKRRRKARKKRKNDIVVVKGKLNLCSVSGMAAAFGVLVLMVGIAMAVLGYWPRENLAHTVSLQRVNDATINSTKPIPPASRHVGFFEDFFSNYQYSDNLKVFGPLVMGIGIFLFICANAVLHENRDKKTKIINLRLast
1 5.000e-20UniRef50_W5KY66 Uncharacterized protein n=10 Tax=Otophysi TaxID=186626 RepID=W5KY66_ASTMX  ali  100  13RQDSLRTKNRAENKRRRKARKKRKNDIVVVKGKLNLCXXXXXXXXXXXXXXXXXXXXXXXXXXXRENLAHTVSLQRVNDATINSTKPIPPASRHVGFFEDFFSNYQYSDNLKVFGPLVMGIGIFLFICANAVLHENRDKKTKIINLR 159
2 6.000e-19UniRef50_UPI000C719932 uncharacterized protein LOC111689830 n=6 Tax=Schizophora TaxID=43738 RepID=UPI000C719932  ali  27  12...TVRRKHSLGNLRRAHPASGATWNVQVVRGKMSSKCLWHACRALGLTLLAVGAGMATLGYYADH-------LSIGSEIRGNATVRVKNDLKG-----------FHLNNFSYVGPIVMGFGGFIVVASCVMTFEARDSAAKVVPAR 139
3 2.000e-18UniRef50_A0A182QSJ1 Uncharacterized protein n=2 Tax=Culicomorpha TaxID=43786 RepID=A0A182QSJ1_9DIPT  ali  27  54.......KASLGPLRRAHPASGATWNVQVVRGKMTSRCLWHACRALGMVLMFVGGGMATVGYYANNFP-------SLSDVRSNSTSTIRVKNEHRG---------LHLNNLSYVGPIIMGVGGFIVVASCVMTFEARDSAAKVVPAR 179
4 3.000e-18UniRef50_UPI00083E02FD LOW QUALITY PROTEIN: uncharacterized protein LOC108576275 n=10 Tax=Hymenoptera TaxID=7399 RepID=UPI00083E02FD  ali  27  7.........HWQGTQRRACGPGAHWNVQVVRGKVTTRCLWYACKALGLLLMLSGACMATIGYFADQ-------LSVAQEIRGNLTIRVKNESRG-----------FHLNNLSYAGPIVMGVGGFIVVAACVMTFEARDNAAKVVPAR 128
5 1.000e-17UniRef50_U3IYC8 Uncharacterized protein n=25 Tax=Euteleostomi TaxID=117571 RepID=U3IYC8_ANAPL  ali  57  14KQDPLRPQSQAPKRK-RKTKKKRKNDVVVVKGKLKLCXXXXXXXXXXXXXXXXXXXXXXXXXXXKPSQVYREG-----GVSGGRHLAPQAPQASVGFLFRLFSSYLHSDKLKVLGPLIMGIGIFLFICANAVLHENRDKKTKIINLR 154
6 1.000e-17UniRef50_A0A060XMW6 Uncharacterized protein n=1 Tax=Oncorhynchus mykiss TaxID=8022 RepID=A0A060XMW6_ONCMY  ali  60  13RQDSLRSKSRAENKRKRKAKKKQKNEVVVVKGKLNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXESPLYPAPRHTQKKEDNNRSNGTGLEQPPMGFLAEFLDNYLYSDKLKVFGPLIMGIGIFLFICANAVLHENRDKKTKVINLR 163
7 2.000e-16UniRef50_A0A2U3YEF4 transmembrane protein 200C-like n=3 Tax=Laurasiatheria TaxID=314145 RepID=A0A2U3YEF4_LEPWE  ali  48  14KQDPLRPPTQVPKRK-RKAKKRRKNDVVVVKGKLKLCKANGTNREGGKQLPAAGSGHRVPTTANSGGSGSKNRSRSHLGTPGGVNSSPSSSSTSVGFFFRIFSGYLHSDKLKVFGPLIMGIGIFLFICANAVLHENRDKKTKIINLR 201
8 2.000e-16UniRef50_B4QLG6 GD13580 n=3 Tax=Acalyptratae TaxID=43741 RepID=B4QLG6_DROSI  ali  23  10...TTKRKHSLGNLRRAHPASGATWNVQVVRGKMSSKCLWHACRALILGLTLMLLGMATLGYYADH-------LSMGSELRGNVTVRVKNDLKG-----------FHLNNFAYVGPIVMGFGGFIVVASCVMTFEARDSAAKVVPAR 137
9 3.000e-16UniRef50_A0A2P6KL56 Uncharacterized protein n=2 Tax=Araneoidea TaxID=74975 RepID=A0A2P6KL56_NEPCL  ali  28  17KNSSGETSSESKGKLPSSRIAGANWNVMAVRGKVTDRCLWSACKAMGFLFIVVGAGMATLGFYSDH-------LSKVEETRGNTTIWIKNESKDS-----------HLGSLTYFGPVVMGIGGFTIVAACVMTFEARDTAAKIVPI. 146
10 3.000e-16UniRef50_A0A1B0G7C6 Uncharacterized protein n=1 Tax=Glossina morsitans morsitans TaxID=37546 RepID=A0A1B0G7C6_GLOMM  ali  23  18.......KHSLGNLRRAHPASGATWNVQVVRGKMSSKCLWHACRX-----XXXXXXXXXXXXXXXXXXXYADYLSMGSELRGNATVRVKNDLKG-----------FHLNNFSYVGPIVMGFGGFIVVASCVMTFEARDSAAKVVPAR 141
11 3.000e-16UniRef50_UPI0008DC869A uncharacterized protein LOC108978126 n=1 Tax=Bactrocera latifrons TaxID=174628 RepID=UPI0008DC869A  ali  24  10...TVRRKHSIGNLRRAHPASGATWNVQVVRGKMSSKCLWHACRALVLGLTLMLLGMATIGYYADH-------LSTNSELRGNATVRVKNDLKG-----------FHLNNLSYVGPIVMGFGGFIVVASCVMTFEARDSAAKVVPAR 137
12 4.000e-16UniRef50_A0A0N0BED0 Usher syndrome type-1G protein like protein n=1 Tax=Melipona quadrifasciata TaxID=166423 RepID=A0A0N0BED0_9HYME  ali  27  7.........HWQGTQRRACGPGAHWNVQVVRGKVTTRCLWYACKALGIGLLLMLACMATIGYFADQ-------LSMVQEIRGNLTVRVKNKSRG-----------FHLNNLSYAGPIVMGVGGFIVVAACVMTFEARDNAAKVVPAR 128
13 6.000e-16UniRef50_A0A2A3EEC3 Usher syndrome type-1G protein n=2 Tax=Apis cerana TaxID=7461 RepID=A0A2A3EEC3_APICC  ali  27  7.........HWQGTQRRACGPGAHWNVQVVRGKVTTRCLWYACKALGIGLLLMLACMATIGYFADQ-------LSVAQEIRGNLTIKVKNESRG-----------FHLNNLSYAGPIVMGVGGFIVVAACVMTFEARDNAAKVVPAR 128
14 6.000e-16UniRef50_UPI0009716155 uncharacterized protein LOC105274990 isoform X3 n=1 Tax=Ooceraea biroi TaxID=2015173 RepID=UPI0009716155  ali  27  7.........QWQGTQRRACGPGAHWNVQVVRGKVTTRCLWHACKALGIGLLLMLACMATIGYYADQ-------LSVAQEIRGNITVKVKNESRG-----------FHLNNLSYAGPVVMGLGGFIVVAACVMTFEARDSAAKVVPAR 128
15 9.000e-16UniRef50_UPI000B98638C uncharacterized protein LOC111055766 n=1 Tax=Nilaparvata lugens TaxID=108931 RepID=UPI000B98638C  ali  29  2....AALQHGASTRCSGVPRNPAQWNVQVVKSKVNKRCFWNACKSFGLLLMLIGASMATIGYYADQISLEQ-------EMRGNSTVHIKPDTR-----------VLHLNNLSYAGPIVMGVGGFIVVAACVMTFEARDSAAKIVPTR 128
16 1.000e-15UniRef50_W5PLG8 Uncharacterized protein n=4 Tax=Laurasiatheria TaxID=314145 RepID=W5PLG8_SHEEP  ali  51  14KQDPLRPPGQVPKRK-RKAKKRRKNDVVVVKGKLKLCSVSGLIAPRAPPAAIPSMTNSSSGGSRNRSRTQPGPPEGVTTSSVGAPRSTPPARTSVGFFFRVFSGYLHSDKLKVFGPLIMGIGIFLFICANAVLHENRDKETKIINLR 171
17 2.000e-15UniRef50_A0A2K6UW43 Transmembrane protein 200C n=6 Tax=Boreoeutheria TaxID=1437010 RepID=A0A2K6UW43_SAIBB  ali  49  14KQDPLRPPSQIPKRKR-KAKKRRKNDVVVVKGKLKLCKANGANREAGKQLPPEGSRHRVPTTANSSSSGSKIRSRSHPGAPGGVNSSSAGAPRSVGFFFRIFSGYLHSDKLKVFGPLIMGIGIFLFICANAVLHENRDKKTKIINLR 201
18 2.000e-15UniRef50_A0A2W1CD72 Uncharacterized protein n=1 Tax=Helicoverpa armigera TaxID=29058 RepID=A0A2W1CD72_HELAM  ali  26 1718....RRARSVTGPLRRAHPASGATWNVQVVKGKMSSTCLWHACRX-----XXXXXXXXXXXXXXXXXXXXXDTLSVAQEVRGNSTVSVKDEARG-----------FHLNNLSYAGPIVMGFGGFIVVAACVMTFEARDSAAKVTPAR 1844
19 3.000e-15UniRef50_H2SUU5 Uncharacterized protein n=2 Tax=Tetraodontidae TaxID=31031 RepID=H2SUU5_TAKRU  ali  68  79...........................................................................NQQEYQSHSNSSVHGSSRHCGFLCTFLDNYLYSDNLKVFGPLVMGIGIFLFICANAVLHENRDKKTKVINLR 150
20 3.000e-15UniRef50_UPI000521404D transmembrane protein 200C-like n=1 Tax=Apaloderma vittatum TaxID=57397 RepID=UPI000521404D  ali  49  93KQDPLRPQSQVPKRKR-KAKKKRKNDVVVVKGKLKLCXXXXXXXXXXXXXXXXXXXXXXXXXXXKPSQVYREGSSSGGRHLAPQNPEGASPQGAMGVLFQLFSSYLHSDKLKVLGPLIMGIGIFLFICANAVLHENRDKKTKIINLR 247
21 3.000e-15UniRef50_UPI0007673695 transmembrane protein 200C n=1 Tax=Myotis davidii TaxID=225400 RepID=UPI0007673695  ali  67  14KQDPLRPPSQVPKRK-RKVQKRRKNDVVVVKGKLKLC-----------------XXXXXXXXXXXXXXXXXXXXXXXXXXXKRAAAPSPPSSTSVGFFFRVFSGYLNSDKLKVFGPLIMGIGIFLFICANAVLHENRDKKTKIINLR 142
22 3.000e-15UniRef50_UPI0007E76084 actin cytoskeleton-regulatory complex protein pan1 isoform X3 n=1 Tax=Drosophila kikkawai TaxID=30033 RepID=UPI0007E76084  ali  23  11...TTKRKHSLGNLRRAHPASGATWNVQVVRGKMSSKCLWHACRALILGLTLMLLGMATLGYYADH-------LSMGSEIRGNVTVRVKNDLKG-----------FHLNNFAYVGPIVMGFGGFIVVASCVMTFEARDSAAKVVPAR 138
23 4.000e-15UniRef50_A0A087ZTW1 Uncharacterized protein n=56 Tax=Hymenoptera TaxID=7399 RepID=A0A087ZTW1_APIME  ali  27  7.........HWQGTQRRACGPGAHWNVQVVRGKVTTRCLWYACKALGIGLLLMLACMATIGYFADQ-------LSVAQEIRGNLTIKVKNESRG-----------FHLNNLSYAGPIVMGVGGFIVVAACVMTFEARDNAAKVVPAR 128
24 5.000e-15UniRef50_A0A1I8MVE5 Uncharacterized protein n=8 Tax=Schizophora TaxID=43738 RepID=A0A1I8MVE5_MUSDO  ali  24  12...SKRRKHSLGNLRRAHPASGATWNVQVVRGKMSSKCLWHACRX-----XXXXXXXXXXXXXXXXXXXYADYLSIGSELRGNATVRVKNDLKG-----------FHLNNFSYVGPIVMGFGGFIVVASCVMTFEARDSAAKVVPAR 139
25 6.000e-15UniRef50_A0A0C9PNN6 TMEM200A protein (Fragment) n=2 Tax=Fopius arisanus TaxID=64838 RepID=A0A0C9PNN6_9HYME  ali  28  8..........WQGTQRRACGPGAHWNVQVVKGKVTTRCLWHACKALGIGLLLMLACMATIGYYADQ-------LSVAQEIRGNLTVRVKNESRG-----------FHLNNLSYAGPIVMGVGGFIVVAACVMTFEARDSAAKVVPAR 128
26 6.000e-15UniRef50_UPI000C719A19 uncharacterized protein LOC106653693 n=1 Tax=Trichogramma pretiosum TaxID=7493 RepID=UPI000C719A19  ali  26  7.........QWQGTQRRTYAPGANWNVQVVRGKVTTRCLWHACKALGIGLLLMIACMATIGYYADQ-------LSVAQEVRGNLTVRVKNESKG-----------FHLNNLSYAGPIVMGVGGFIVVAACVMTFEARDSAAKVVPAR 128
27 6.000e-15UniRef50_UPI000A1D20EC LOW QUALITY PROTEIN: cyclin-dependent kinase 12 n=4 Tax=melanogaster group TaxID=32346 RepID=UPI000A1D20EC  ali  23  11...TTKRKHSLGNLRRAHPASGATWNVQVVRGKMSSKCLWHACRALILGLTLMLLGMATLGYYADH-------LSMGSEIRGNVTVRVKNDLKG-----------FHLNNFAYVGPIVMGFGGFIVVASCVMTFEARDSAAKVVPAR 138
28 1.000e-14UniRef50_UPI00038EF39F transmembrane protein 200C n=1 Tax=Chinchilla lanigera TaxID=34839 RepID=UPI00038EF39F  ali  48  14KQDPLRPPGQVPKRK-RKAKQRRKNDVVVVKGKLKLCKASGASREGGRQLPPAGTGHANSSGLAQSWSPRGGAPSSSVGAPRSTRAPRPSSPAPVGFFFRIFSGYLHSDKLKVFGPLIMGIGIFLFICANAVLHENRDRKTKIINLR 189
29 2.000e-14UniRef50_UPI000B3BF2C1 uncharacterized protein LOC105842370 n=4 Tax=Obtectomera TaxID=104431 RepID=UPI000B3BF2C1  ali  24  2....RRARSVTGPLRRAHPASGATWNVQVVRGKMSSQCLWHACRX-----XXXXXXXXXXXXXXXXXXXXADTLSVAEEIRGNATVSVKDEARG-----------FHLNNLSYAGPIVMGFGGFIVVAACVMTFEARDSAAKVTPAR 128
30 2.000e-14UniRef50_B3M5E5 Uncharacterized protein n=11 Tax=Drosophila TaxID=2081351 RepID=B3M5E5_DROAN  ali  23  11...TVKRKHSLGNLRRAHPASGATWNVQVVRGKMSSKCLWHACRALILGLTLMLLGMATLGYYADH-------LSMGSELRGNVTVRVKNDLKG-----------FHLNNFAYVGPIVMGFGGFIVVASCVMTFEARDSAAKVVPAR 138
31 2.000e-14UniRef50_UPI000521AE5F transmembrane protein 200B n=1 Tax=Dryobates pubescens TaxID=118200 RepID=UPI000521AE5F  ali  35  37....................RRKSPPEVQVKGQLRMRSPSGAFVKVGISVVLVGMTIAVVGYWPHRGAGVSGASTGNSSTSGDVRREVAPARSQV----------PHSEKLKLIGPVIMGIGLFIFICANTMLYENRDMETRRLMQK 153
32 2.000e-14UniRef50_A0A1A9UID7 Uncharacterized protein n=1 Tax=Glossina austeni TaxID=7395 RepID=A0A1A9UID7_GLOAU  ali  23  18.......KHSLGNLRRAHPASGATWNVQVVRGKMSSKCLWHACRX-----XXXXXXXXXXXXXXXXXXXYADYLSMGSELRGNATVRVKNDLKG-----------FHLNNFSYVGPIVMGFGGFIVVASCVMTFEARDSAAKVVPAR 141
33 2.000e-14UniRef50_A0A1A6GUK9 Uncharacterized protein n=2 Tax=Euteleostomi TaxID=117571 RepID=A0A1A6GUK9_NEOLE  ali  40  16RQDSARSQQHVAAQDQKPVRRRPRADVVVVRGKIRX-------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEHFIDAETTLSTNETQVVRNQGGVVVRFFEQHLHSDKMKMLGPFTMGIGIFIFICANAILHENRDKETKIIHMR 161
34 2.000e-14UniRef50_F6ZD58 Transmembrane protein 200C n=1 Tax=Xenopus tropicalis TaxID=8364 RepID=F6ZD58_XENTR  ali  64  14KQDPLRQKSQTPKRK-RKAKKKRKNDVVVVKGKLKLC--------------XXXXXXXXXXXXXXXXXXXXXXXXXXXKTSDHNISRSLQHKTSPGFFAGLFSGYLHSDNLKVFGPLIMGIGIFLFICANAVLHENRDKKTKIINLR 145
35 2.000e-14UniRef50_B4LBC5 Uncharacterized protein n=36 Tax=Drosophila TaxID=2081351 RepID=B4LBC5_DROVI  ali  23  11...TTRRKHSVGNLRRAHPASGATWNVQVVRGKMSSKCLWHACRX-----XXXXXXXXXXXXXXXXXXXYADHLSMGSELRGNVTVRVKNDLKG-----------FHLNNFAYVGPIVMGFGGFIVVASCVMTFEARDSAAKVVPAR 138
36 3.000e-14UniRef50_UPI000BA0B550 histone-lysine N-methyltransferase Suv4-20 isoform X1 n=2 Tax=Drosophila obscura TaxID=7282 RepID=UPI000BA0B550  ali  23  10...TIKRKHSLGNLRRAHPASGATWNVQVVRGKMSSKCLWHACRALILGLTLMLLGMATLGYYADH-------LSMGSELRGNVTVRVKNDLKG-----------FHLNNFAYVGPIVMGFGGFIVVASCVMTFEARDSAAKVVPAR 137
37 4.000e-14UniRef50_Q86VY9 Transmembrane protein 200A n=260 Tax=Gnathostomata TaxID=35060 RepID=T200A_HUMAN  ali  40  16RQDSARSQQHVATQEKKPIRRRPRADVVVVRGKIRX-------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEHFIDAETTLSTNETQVIRNEGGVVVRFFEQHLHSDKMKMLGPFTMGIGIFIFICANAILHENRDKETKIIHMR 161
38 4.000e-14UniRef50_K7F0W8 Transmembrane protein 200C n=5 Tax=Archelosauria TaxID=1329799 RepID=K7F0W8_PELSI  ali  47  14KQDPLRPQSQAPKRKR-KAKRKRKNDVVVVKGKLKLCSPAYREGSFGGSRHLPAQGGASRGQPGAHGGSHPDTPRANASSSSRGAPRAAPAPVSAGFLFQLFSGYLHSDKLKVLGPLIMGIGIFLFICANAVLHENRDRKTKVINLR 192
39 5.000e-14UniRef50_UPI00042BD1FC transmembrane protein 200C-like n=3 Tax=Amniota TaxID=32524 RepID=UPI00042BD1FC  ali  48  14KQDPLRPQSQAPRRKR-KAKKKRKNDVVVVKGKLKLCSPVYREGSFGGSKHLPSRGGATTKRSRGQSPPDPPRANASSSSSSRGSPRAAPAPSSVGFLFQLFSGYLHSDKLKVLGPLIMGIGIFLFICANAVLHENRDRKTKIINLR 194
40 6.000e-14UniRef50_UPI000B4F30B9 transmembrane protein 200C-like n=1 Tax=Oncorhynchus mykiss TaxID=8022 RepID=UPI000B4F30B9  ali  58  220......................................................................QMSDAMNGSVPQPVSVSTSPRPPSGGFLSEFLDSYLYSDNLKVFGPLVMGIGIFLFICANAVLHENRDQKTKVINLR 296
41 7.000e-14UniRef50_A0A146Q425 Transmembrane protein 200A n=1 Tax=Fundulus heteroclitus TaxID=8078 RepID=A0A146Q425_FUNHE  ali  35  16RQDSARSQHRPPTSEAAPRKRKRRTDVVVVRGKLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHNKAAPTGGGNQAKVEKGVTNASHSPSKQTGGALTRFLEQHLHSERMKMLGPFTMGIGIFIFICANAILHENRDRETKIIHMR 176
42 8.000e-14UniRef50_UPI000CD7D85D uncharacterized protein LOC111862493 n=1 Tax=Cryptotermes secundus TaxID=105785 RepID=UPI000CD7D85D  ali  27  14....RRKLSVAPHPRRGYQPHGAHWNVQVVRGKVTTRCLWNACKALTLGLLLLLLAMATVGYYADQ-------LSVAQEVRGNQTVRVKNESRG-----------FHLNNLSYAGPIVMGVGGFIVVAACVMTFEARDSAAKVVPAR 140
43 9.000e-14UniRef50_A0A2R8RNR1 Uncharacterized protein n=7 Tax=Cyprinidae TaxID=7953 RepID=A0A2R8RNR1_DANRE  ali  68  13RQDSLRSKNRAENKKKRKAKKKRKNDVVVVKGKVQLCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNTHATAGFTHNNESSFNSSSPVAHS---LGFFQSLFGGYLQSDNLKVLGPLVMGIGIFLFICANAVLHEDRDKKTKIINLR 156
44 9.000e-14UniRef50_A0A2D0SRM4 transmembrane protein 200C n=24 Tax=Neopterygii TaxID=41665 RepID=A0A2D0SRM4_ICTPU  ali  64  122.............................................................................DVKSSNSTNGTTEESPKLGVFAEFLNRHLHSDKLKVFGPLIMGIGIFLFICANAVLHENRDKKTKIINLR 191
45 1.000e-13UniRef50_Q4RWU6 Chromosome 15 SCAF14981, whole genome shotgun sequence (Fragment) n=1 Tax=Tetraodon nigroviridis TaxID=99883 RepID=Q4RWU6_TETNG  ali  70  122............................................................................NTVNQSHSNSSVPGSSHHCGFLCTFLDNYLYSDNLKVFGPLVMGIGIFLFICANAVLHENRDKKTKIINLR 192
46 1.000e-13UniRef50_UPI0008114EB6 uncharacterized protein LOC108377152 n=1 Tax=Rhagoletis zephyria TaxID=28612 RepID=UPI0008114EB6  ali  24  10...TVRRKHAIGNLRRAHPASGATWNVQVVRGKMSSKCLWHACRX-----XXXXXXXXXXXXXXXXXXXXXDYLSTGSELRGNATVRVKNDLKG-----------FHLNNLSYVGPIVMGFGGFIVVASCVMTFEARDSAAKVVPAR 137
47 1.000e-13UniRef50_A7UTL3 AGAP005329-PA n=14 Tax=Anopheles TaxID=44484 RepID=A7UTL3_ANOGA  ali  25  12.....RRKASLGPLRRAHPASGATWNVQVVRGKMTSRCLWHACRX-----XXXXXXXXXXXXXXXXXXXYANNFPSLSDVRSNNTSSIRVKNEHRG---------LHLNNLSYVGPIIMGVGGFIVVASCVMTFEARDSAAKVVPAR 139
48 2.000e-13UniRef50_A0A060VWU8 Uncharacterized protein n=2 Tax=Oncorhynchus mykiss TaxID=8022 RepID=A0A060VWU8_ONCMY  ali  38  17RQDSARSQHHLPAQEKRRAKRKPRADVVVVRGKIRX-------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXREDLVAANAKLSTNDTRVTREESGTLAQFFEQHLHSEKMKMLGPFTMGIGIFIFICANAILHENRDRETKVIHMR 164
49 2.000e-13UniRef50_UPI000703E481 transmembrane protein 200C-like n=1 Tax=Myotis brandtii TaxID=109478 RepID=UPI000703E481  ali  81  10............................................................................................TSVGFFFRVFSGYLNSDKLKVFGPLIMGIGIFLFICANAVLHENRDKKTKIINLR 64
50 2.000e-13UniRef50_A0A1S3QTP6 uncharacterized protein LOC106596709 isoform X1 n=4 Tax=Salmo salar TaxID=8030 RepID=A0A1S3QTP6_SALSA  ali  65  403.............................................................................NGSVLVSVSTPPPPIPSGGLLSEFLDNYLYSDNLKVFGPLVMGMGIFIFICANAVLHENRDKKTKVINLR 472
51 2.000e-13UniRef50_UPI0009A3AB51 LOW QUALITY PROTEIN: transmembrane protein 200A-like n=1 Tax=Rhincodon typus TaxID=259920 RepID=UPI0009A3AB51  ali  47  78.....................................................................GTDIFETIKVQSNDTNNSTVLERTTLEIISKFLASYLHSEKLKVLGPLIMGIGIFLFICANTVLHENRDKKTKIINIR 155
52 2.000e-13UniRef50_A6NKL6 Transmembrane protein 200C n=60 Tax=root TaxID=1 RepID=T200C_HUMAN  ali  49  14KQDPLRPPSQIPKRKR-KAKKRRKNDVVVVKGKLKLCKATGTNREGGKQLPPAGSSHRVPTTANSSSSGSKNRSRSHPRAPGGVNSSSAGAPRSVGFFFRIFSGYLHSDKLKVFGPLIMGIGIFLFICANAVLHENRDKKTKIINLR 201
53 3.000e-13UniRef50_T1ICM4 Uncharacterized protein n=3 Tax=Cimicomorpha TaxID=33354 RepID=T1ICM4_RHOPR  ali  32  51........................WDVEVVKGKVSSRCFWNACKSFGLLLMFIGTTMAILGYYADQ-------LSMGQELRGNTTVRIKHEARG-----------FHLNNLSYAGPIVMGVGGFIVVAACVMTFEARDSAAKVVP.. 155
54 3.000e-13UniRef50_A0A091DA00 Transmembrane protein 200C n=1 Tax=Fukomys damarensis TaxID=885580 RepID=A0A091DA00_FUKDA  ali  51  190KQDPLRPPGQVPKRK-RKAKKRRKNDVVVVKGKLKLCKAGGAAREGGRQAPPGNGSDRAP-----PRRPPGGAPASPEGALQSTRAPGPPAPAPVGFFFRVFSGYLHSDKLKVFGPLIMGIGIFLFICANAVLHENRDRKTKVINLR 357
55 4.000e-13UniRef50_UPI000947DA98 transmembrane protein 200A-like n=1 Tax=Branchiostoma belcheri TaxID=7741 RepID=UPI000947DA98  ali  24  19....RTSKLQKQGTRRLRRITPRPAKMMVIKGRLNLLSPYSICVILGFCILVTGVIMCMFAYEYVDVALR--------------NNNNSSSTMGMEADRAFPTDRAFLRDFRLIGPLTVGLGVFAVLCGVTALLEDRDRRTKRIFVR 147
56 5.000e-13UniRef50_A0A1S3LYZ7 uncharacterized protein LOC106569361 n=1 Tax=Salmo salar TaxID=8030 RepID=A0A1S3LYZ7_SALSA  ali  58  183......................................................................QMSDVMNGSVPQPASVSTSPRPPSGGFLSEFLDSYLYSDNLKVFGPLVMGIGIFLFICANAVLHENRDQKTKVINLR 259
57 5.000e-13UniRef50_UPI00092F1835 transmembrane protein 200C n=1 Tax=Gavialis gangeticus TaxID=94835 RepID=UPI00092F1835  ali  45  14KQDPLRPPSQVAKRK-HKAKKKRKNDVVVVKGKLKLCSLPYRQGSFEGARALLPLGSAVKNRSRELAGIHAGDDSSGSTRRPPPPLDTASSSSSAGFLLRLFSGYLQSDKLKVLGPLIMGIGIFLFICANAVLHENRDKKTKVIDLR 191
58 5.000e-13UniRef50_UPI000B8E7D5A uncharacterized protein LOC110836030 n=1 Tax=Zootermopsis nevadensis TaxID=136037 RepID=UPI000B8E7D5A  ali  27  14....RRKLSVAPHPRRTYQPHGSQWNVQVVRGKVTTRCLWNACKALTLGLLLLLLAMATVGYYADQ-------LSVAHEVRGNRTVRVKNESRG-----------FHLNNLSYAGPIVMGVGGFIVVAACVMTFEARDSAAKVVPAR 140
59 6.000e-13UniRef50_G3N838 Uncharacterized protein n=1 Tax=Gasterosteus aculeatus TaxID=69293 RepID=G3N838_GASAC  ali  68  66...................................................................................ETMNGTIGRLPGGFLEDFLHRYVYSDRLKVFGPLIMGIGIFLFICANAALHENRDKKTKVINLR 129
60 7.000e-13UniRef50_G3PWM7 Uncharacterized protein n=2 Tax=Eupercaria TaxID=1489922 RepID=G3PWM7_GASAC  ali  73  124................................................................................QSHSNSSAQEPSPRCGFLCDFLNNYLYSDNLKVFGPLVMGIGIFLFICANAVLHENRDKKTKIINLR 190
61 7.000e-13UniRef50_H2MRU7 Transmembrane protein 200A n=2 Tax=Percomorphaceae TaxID=1489872 RepID=H2MRU7_ORYLA  ali  34  17RQDSARSQHRSPNTDPVPRKRKRRTDVVVVPGRLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHRKTTPTGGGNGADLANTSHNVQGTPSKQTGSAVMRFLQRHLHSERMKMLGPFTMGIGIFIFICANAILHENRDRETKIIHMR 177
62 7.000e-13UniRef50_UPI000C20133C uncharacterized protein LOC111429247 n=2 Tax=Polyphaga TaxID=41084 RepID=UPI000C20133C  ali  27  23..............RRAHPASGAQWNVQVVRGKVNGKCLWNACKX-----XXXXXXXXXXXXXXXXXXXYADHLSFAQEVRGNHTVRVKNESRG-----------FHLNNLSYAGPIVMGVGGFIVVAACVMTFEARDSAAKVVPAR 139
63 7.000e-13UniRef50_UPI000D63F224 LOW QUALITY PROTEIN: transmembrane protein 200C n=1 Tax=Gallus gallus TaxID=9031 RepID=UPI000D63F224  ali  48  161KQDPLRPQSQIPKRKR-KAKKKRKNDVVVVKGKLKLCSQVYREVGGGRHLTPQGGTPKNRSQNQEGAQAEIYPVSSPRANSTAATSQEFPPQASVGFLFRLFSSYLHSDKLKVLGPLIMGIGIFLFICANAVLHENRDKKTKIINLR 343
64 8.000e-13UniRef50_K4HR53 Transmembrane protein 200A (Fragment) n=1 Tax=Mustela putorius furo TaxID=9669 RepID=K4HR53_MUSPF  ali  47  32.........................................................................EHFIDAETTLSTNETQVIRNQGGVVVRFFEQHLHSDKMKMLGPFTMGIGIFIFICANAILHENRDKETKIIHMR 105
65 8.000e-13UniRef50_G5B1L1 Transmembrane protein TTMA n=4 Tax=Amniota TaxID=32524 RepID=G5B1L1_HETGA  ali  47  14KQDPLRPPGQVPKRK-RKAKKRRKNDVVVVKGKLKLCKAGGAAGEGARQLPPAGPEHRALASGSGRAPPRSDAPSSSESVPRSTHAPAPSSPAPAGFFFRVFSGYLHSDKLKVFGPLIMGIGIFLFICANAVLHENRDKKTKVINLR 189
66 9.000e-13UniRef50_G1KJF4 Transmembrane protein 200C n=42 Tax=Tetrapoda TaxID=32523 RepID=G1KJF4_ANOCA  ali  46  14KQDPLRPQSDVPKRK-RKAKKKRKNDVVVVKGKLKLCKPFYRAGRHGDRHQSPPHGSAVISHSRNQTEGQRTNSSFMNSKKSLRPSSPAPSPNSKSFLIQLFSQCLHSDKLKVLGPLIMGIGIFLFICANAVLHENRDKKTKIINLR 194
67 9.000e-13UniRef50_D6W6B2 Uncharacterized protein n=2 Tax=Tribolium castaneum TaxID=7070 RepID=D6W6B2_TRICA  ali  25  10...GWARGGASEVVRRAHPASGAQWNVQVVRGKVNGKCLWNACKX-----XXXXXXXXXXXXXXXXXXXYADHLSIAQEVRGNHTVRVKNESRG-----------FHLNNLSYAGPIIMGVGGFIVVAACVMTFEARDSAAKVVPAR 137
68 1.000e-12UniRef50_A0A147A033 Transmembrane protein 200C n=1 Tax=Fundulus heteroclitus TaxID=8078 RepID=A0A147A033_FUNHE  ali  68  114........................................................................SRHTNVSNQSHSNSSIPDPAPHCGILCDFLDNYLYSDNLKVFGPLVMGIGIFLFICANAVLHENRDKKTKIINLR 188
69 1.000e-12UniRef50_A0A151NEN5 Transmembrane protein 200C isoform B n=15 Tax=Amniota TaxID=32524 RepID=A0A151NEN5_ALLMI  ali  44  14KQDPLRPPSQVAKRKH-KAKKKRKNDVVVVKGKLKLCSLPYRQGSFEGARALLPLGSAVKNHSRGLAGIHAGDDSSGSARRPPPPHDTASSSSSAGFLLHLFSGYLHSDKLKVLGPLIMGVGIFLFICANAVLHENRDKKTKVIDLR 191
70 1.000e-12UniRef50_A0A0S7J149 T200C (Fragment) n=1 Tax=Poeciliopsis prolifica TaxID=188132 RepID=A0A0S7J149_9TELE  ali  87  14.............................................................................................HCGILCDFLDNYLYSDNLKVFGPLVMGIGIFLFICANAVLHENRDKKTKIINLR 67
71 1.000e-12UniRef50_A0A1S3G1D9 transmembrane protein 200C n=16 Tax=Eutheria TaxID=9347 RepID=A0A1S3G1D9_DIPOR  ali  46  14KQDPLRPPSQVPKRKR-KAKRRRKNDVVVVKGKLKLCKANGAHREGAKQQPPPGSGLRVQTAASNGSTPSRGHPGTPEGVNSSSTGVSQSTPPSVGFFFRIFSGYLHSDKLKVFGPLIMGIGIFLFICANAVLHENRDKKTKVINLR 202
72 1.000e-12UniRef50_U4UBQ6 Uncharacterized protein n=1 Tax=Dendroctonus ponderosae TaxID=77166 RepID=U4UBQ6_DENPD  ali  25  13...GWTRGGTSEVVRRAHPASGAQWNVQVVRGKVNGKCLWNACKX-----XXXXXXXXXXXXXXXXXXXYADQLSVAQEIRGNHTVAVKNESRG-----------FHLNNLSYAGPIVMGVGGFIVVAACVMTFEARDSAAKVVPAR 140
73 2.000e-12UniRef50_N6TZ54 Uncharacterized protein (Fragment) n=1 Tax=Dendroctonus ponderosae TaxID=77166 RepID=N6TZ54_DENPD  ali  25  13...GWTRGGTSEVVRRAHPASGAQWNVQVVRGKVNGKCLWNACKX-----XXXXXXXXXXXXXXXXXXXYADQLSVAQEIRGNHTVAVKNESRG-----------FHLNNLSYAGPIVMGVGGFIVVAACVMTFEARDSAAKVVPAR 140
74 2.000e-12UniRef50_A0A2D0T7H8 transmembrane protein 200C-like n=2 Tax=Characiphysae TaxID=186628 RepID=A0A2D0T7H8_ICTPU  ali  71  122..............................................................................NSSDGMINATKPNFRPVGFFKGLFSTYLYSDNLKVFGPLVMGIGIFLFICANAVLHENRDKKTKIIDLR 190
75 2.000e-12UniRef50_U3KIF3 Transmembrane protein 200C n=24 Tax=Amniota TaxID=32524 RepID=U3KIF3_FICAL  ali  46  14KQDPLKPQSQLPKRK-RKAKRKRKNDVVVVKGKLKLCSQAYRESSFGKGRHPAPQGGAHGSRSQSQEESPPGANTSAPAASAGSAPTSSSPQASAGFLFRLFSSYLHSDKLKVLGPLIMGIGIFLFICANAVLHENRDKKTKIINLR 196
76 2.000e-12UniRef50_B0W089 uncharacterized protein n=3 Tax=Culicidae TaxID=7157 RepID=B0W089_CULQU  ali  25  12.....RRKTSLGPLRRAHPASGATWNVQVVRGKMTSRCLWHACRX-----XXXXXXXXXXXXXXXXXXXYANNFPSLSDVKSNSTTTVRVKNEHRG---------LHLNNLSYVGPIIMGVGGFIVVASCVMTFEARDSAAKVVPAR 139
77 2.000e-12UniRef50_A0A091F0L5 Transmembrane protein 200A n=6 Tax=Gnathostomata TaxID=35060 RepID=A0A091F0L5_CORBR  ali  37  16RQDSARSQQHVNPEEKKPVRRRPRTDVVIVRGKIRX-------XXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEQLLGSEGNPSLNGTRTLRSQGSILLRFFEQHVHSDKMKMLGPFTMGIGIFIFICANAILHENRDKETKIIHMR 161
78 2.000e-12UniRef50_G3MZJ8 Transmembrane protein 200C n=6 Tax=Amniota TaxID=32524 RepID=G3MZJ8_BOVIN  ali  50  14KQDPLRPPGQVPKRKRKTKK-RRKNDVVVVKGKLKLCXXXXXXXXXXXXXXXXXXXXXXXXXXXKANGAHREGAKQPPPPPGDSGPRVPSVTSSSGGNRXVFSGYLHSDKLKVFGPLIMGIGIFLFICANAVLHENRDKETKIINLR 168
79 2.000e-12UniRef50_A0A1U7SRH0 transmembrane protein 200C n=12 Tax=Theria TaxID=722675 RepID=A0A1U7SRH0_TARSY  ali  48  14KQDPLRPPSQIPKRKR-KTKKRRKNDVVVVKGKLKLCKAHGANREGGKQPPPAGSSHRVPATAHSTPSGSKNRSGSTPPARPAAPSSSSSSSTSVGFFFRVFSGYLHSDKLKVFGPLIMGIGIFLFICANAVLHENRDKKTKIINLR 204
80 2.000e-12UniRef50_UPI000BBD9953 transmembrane protein 200C n=1 Tax=Astyanax mexicanus TaxID=7994 RepID=UPI000BBD9953  ali  61  121............................................................................NDFISSNHSNGTAEVSPKLGAFAEFLKRLLYSDKLKVFGPLIMGIGIFLFICANAVLHENRDKKTKIINLR 191
81 2.000e-12UniRef50_UPI000C6E8CA3 uncharacterized protein LOC111620572 n=1 Tax=Centruroides sculpturatus TaxID=218467 RepID=UPI000C6E8CA3  ali  25  4........PKQSTKKKDVSNTKSIWGISSVRGKITDKCLWAACKAMGFFLILIGTGMATVGFYSDQ-------LSKVEKKQGNITVYHKDGLKDM-----------HLSSLTYFGPVVMGVGGFIILATCVMTFEARDTATKIVP.. 124
82 2.000e-12UniRef50_C3ZPH7 Uncharacterized protein n=1 Tax=Branchiostoma floridae TaxID=7739 RepID=C3ZPH7_BRAFL  ali  28  17KKRTLKLQKQGTRKLRRITPKPAK--IMVIKGRINLLSPYTICVLLGFCVLTVGVVMCMFAYEYV--------------EVAVRNNNNSSSTAEMDRDRSFLINRALLRDFRLIGPLIVGLGVFTMLCGMTALLEDRDGRTKRIIIR 147
83 2.000e-12UniRef50_UPI00096B4975 uncharacterized protein LOC109596800 n=1 Tax=Aethina tumida TaxID=116153 RepID=UPI00096B4975  ali  25  10...GWARGGTSEVVRRAHPASGAQWNVQVVRGKVNGKCLWNACKXX-----XXXXXXXXXXXXXXXXXXYADDLSIAQEIRGNHTVKVKNESRG-----------FHLNNLSYAGPIVMGVGGFIVVAACVMTFEARDSA....... 130
84 2.000e-12UniRef50_UPI000C6F89D4 uncharacterized protein LOC106639028 n=1 Tax=Copidosoma floridanum TaxID=29053 RepID=UPI000C6F89D4  ali  26  7.........HWQGTQRRAYAPGANWNVQVVRSKATTRCLWHACKALGVGLLLMLACMATIGYYADQ-------LSVAQEIRGNLTVRVKNESRG-----------IHLNNLSYAGPIVMGFGGFIVVAACVMTFEARNSAAKVMPAR 128
85 2.000e-12UniRef50_A0A1Y1MRV8 Uncharacterized protein (Fragment) n=4 Tax=Polyphaga TaxID=41084 RepID=A0A1Y1MRV8_PHOPY  ali  26  21....RAGGTSSGVVRRACPASGAQWNVQVVRGKVNGKCLWNACKX-----XXXXXXXXXXXXXXXXXXXYADHLSVAQEIRGNHTVRIKNESRG-----------FHLNNLSYAGPIVMGVGGFIVVAACVMTFEARDSAAKVVPAR 147
86 2.000e-12UniRef50_A0A287BP26 Transmembrane protein 200C n=6 Tax=Boreoeutheria TaxID=1437010 RepID=A0A287BP26_PIG  ali  49  14KQDPLRPPSQVPKRKR-KAKKRRKNDVVVVKGKLKLCKANGANKDGVKQLPPTGSGHRVPTMTNRSSSGSKKQSGNHLGTPEGVNSSSVGASRSVGFFFRVFSGYLHSDKLKVFGPLIMGIGIFLFICANAVLHENRDKKTKIINLR 202
87 3.000e-12UniRef50_A0A2K6NL97 Transmembrane protein 200C n=3 Tax=Boreoeutheria TaxID=1437010 RepID=A0A2K6NL97_RHIRO  ali  47  14KQDPLRPPSQIPKRKR-KAKKRRKNDVVVVKGKLKLCKATGANREGGKQLPPVGSSHRVPTTANSSGSGSKNRSRSHPRGPGGVNSSSAGAPQSVSFFFRIFSGYLHSDKLKVFGPLIMGIGIFLFICANAVLHENRDKKTKIINL. 200
88 3.000e-12UniRef50_UPI00045752F3 transmembrane protein 200A-like n=1 Tax=Callorhinchus milii TaxID=7868 RepID=UPI00045752F3  ali  51  12......SAGSSSNYNTRKSRNKCKNDVVMVKAKLKLCSXXXXXXXXXXXXXXXXXXXXXXXXXXXXNEIFEAPNNTTTNISHNETS-------ILQIISDVLASYLHSDKLKVLGPLMMGIGLFLFICANAVLHEARDKKSKIINL. 144
89 4.000e-12UniRef50_UPI000D0A08CF uncharacterized protein LOC112240559 n=1 Tax=Oncorhynchus tshawytscha TaxID=74940 RepID=UPI000D0A08CF  ali  58  188......................................................................QMSDVMNGSVPQPLSVSTSPRPPSGGFLSEFLDSYLYSDNLKVFGPLVMGIGIFLFICANAVLHENRDQKTKVINLR 264
90 4.000e-12UniRef50_A0A2I4AIX5 transmembrane protein 200C-like n=12 Tax=Ovalentaria TaxID=1489908 RepID=A0A2I4AIX5_9TELE  ali  45  14RQDSLRAKPQKAHPPKKKRKNKRSSEVVVVKGKLKLCXFFSAQPQEGSAMASVSSSSTTPALSSVQEEMWEEEPEGDTDERGGETTNKTTPQLPQGFFEYFLDRYLYSDSLKVFGPLIMGIGIFLFICANAVLHENRDKKTKVINLR 198
91 5.000e-12UniRef50_UPI0008FA60B7 transmembrane protein 200C-like n=1 Tax=Cyprinus carpio TaxID=7962 RepID=UPI0008FA60B7  ali  56  79................................................................RNNEKFIEPVRRIKEDNLTSNNKLVKSNTSSGFLKSLIVSYLYSDNLKVFGPLVMGIGIFLFICANAVLHEDRDKKTKIINLR 161
92 6.000e-12UniRef50_A0A1A7ZN60 Transmembrane protein 200A n=22 Tax=Percomorphaceae TaxID=1489872 RepID=A0A1A7ZN60_NOTFU  ali  32  16RQDSARSQHHAPETAPRRRKRRTDVVVVRGRLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHGKATPTGAGNAAKAEKEVSNTTHEIPPSQQSGGPLMRFLGQHLHSERMKMLGPFTMGIGIFIFICANAILHENRDRETKIIHMR 172
93 6.000e-12UniRef50_UPI0009731B84 transmembrane protein 200C n=1 Tax=Esox lucius TaxID=8010 RepID=UPI0009731B84  ali  61  140.......................................................................GSSSVPVNRSVSVSAPPPSTPTSVGFVSEFLDRYLYSDNLKVFGPLVMGIGIFLFICANAVLHENRDQKTKVINLR 215
94 6.000e-12UniRef50_A0A212FJG5 Uncharacterized protein n=1 Tax=Danaus plexippus plexippus TaxID=278856 RepID=A0A212FJG5_DANPL  ali  26  214........SVTGPLRRAHPASGATWNVQVVKGKMSSQCLWHACRX-----XXXXXXXXXXXXXXXXXXXXXDTLSVAEEVRGNSTVSVKDEARG-----------FHLNNLSYAGPIVMGFGGFIVVAACVMTFEARDSAAKVTPAR 336
95 7.000e-12UniRef50_UPI000BBEE616 transmembrane protein 200C-like n=1 Tax=Seriola dumerili TaxID=41447 RepID=UPI000BBEE616  ali  69  123..................................................................................DKTLNETTRRPSRGFLEDFLDRYLYSDRLKVFGPLIMGIGIFLFICANAVLHENRDKKTKVINLR 187
96 2.000e-11UniRef50_H0YR45 Uncharacterized protein n=3 Tax=Neognathae TaxID=8825 RepID=H0YR45_TAEGU  ali  33  40..............................KGQLRMRSPAGAFVMVGISVVLEGMTIAVVGYWPHRGYGGSGASAGNTSVVGDMRREVVAGR-----------HMPHSEKLKLIGPVIMGIGLFIFICANTMLYENRDMETRQLMQK 145
97 2.000e-11UniRef50_UPI0009B402B4 transmembrane protein 200C-like isoform X1 n=4 Tax=Percomorphaceae TaxID=1489872 RepID=UPI0009B402B4  ali  55  107............................................................GGEWEHGDDRRRGDHFNQTEIVNGTTRQLP----RGFLQEFLDRYLYSDRLKVFGPLIMGIGIFLFICANAVLHENRDKKTKVINLR 189
98 2.000e-11UniRef50_UPI0009E46D39 transmembrane protein 200C n=2 Tax=Tetrapoda TaxID=32523 RepID=UPI0009E46D39  ali  44  77.....................................KPLYRAGNLGGKQFSPPHGSAAQSHSRNQTEDSGESHPEGSRTNSSSTGSKKPSPTSRGFLFQLFSRYLHSDKLKVLGPLIMGIGIFLFICANAVLHENRDKKTKIINLR 194
99 2.000e-11UniRef50_UPI0004571B95 transmembrane protein 200C n=1 Tax=Callorhinchus milii TaxID=7868 RepID=UPI0004571B95  ali  46  14RQDSFRSHNHVSKRKRKAKKKHKNDVVVVKGKLKXXXX-----XXXXXXXXXXXXXXXXXXXXXXXXXKKNDIFEANTVLAHNATNSTRLETTSLEIISNFLASYLHSDKLKVFGPLIMGIGIFLFICANAVLHENRDKKTKIINLR 155
100 3.000e-11UniRef50_UPI000A33051C transmembrane protein 200C n=2 Tax=Boreoeutheria TaxID=1437010 RepID=UPI000A33051C  ali  48  14KQDPLRPPGQVPK-RKRKAKKRRKNDVVVVKGKLKLCKAGGAAGEGARQLPPAGPEHRALASGSGRAPPRSDAPSSSESVPRSTHAPAPSSPAPAGFFFRVFSGYLHSDKLKVFGPLIMGIGIFLFICANAVLHENRDKKTKVINLR 189
101 7.000e-11UniRef50_UPI00064472F7 transmembrane protein 200C-like n=1 Tax=Clupea harengus TaxID=7950 RepID=UPI00064472F7  ali  44  109..............................................................WNHTSNTKLGQQRALNLTRGNGTTSSPQAPAPLGILGELLASCLHSDQLKMYGPLVMGMGIFLFICANAVLHEDRDRQTKVIDLR 196
102 8.000e-11UniRef50_A0A087YQJ8 Transmembrane protein 200C n=37 Tax=Percomorphaceae TaxID=1489872 RepID=A0A087YQJ8_POEFO  ali  85  134............................................................................................PHCGILCDFLDNYLYSDNLKVFGPLVMGIGIFLFICANAVLHENRDKKTKIINLR 188
103 9.000e-11UniRef50_H3B2Q2 Transmembrane protein 200C n=2 Tax=Latimeria chalumnae TaxID=7897 RepID=H3B2Q2_LATCH  ali  57  89...............................................................................TKTNNSNTNKVKNSPLSLLAELLASYLYSDKFKVLGPLIMGIGIFLFICANAVLHENRDKKTKIINLR 156
104 2.000e-10UniRef50_UPI000DC6A2FE transmembrane protein 200C n=1 Tax=Canis lupus dingo TaxID=286419 RepID=UPI000DC6A2FE  ali  46  14KQDPLRPPGQVPKRKR-KAKRRRKNDVVVVKGKLKLCXXTGRDGAKQLPPAASGHRVPTVANSSSSSGGSRNRSRSPLGARGGANSSVAGAPRSAGLFFRLFSGYLHSDKLKVFGPLIMGIGIFLFICANAVLHENRDRKTKIINLR 203
105 2.000e-10UniRef50_UPI0009B40C47 transmembrane protein 200C-like n=6 Tax=Percomorphaceae TaxID=1489872 RepID=UPI0009B40C47  ali  72  147......................................................................................NGTSGHRPQGFLEDFLDRYLYSDRLKVLGPLIMGIGIFLFICANAVLHENRDKKTKVINLR 207
106 2.000e-10UniRef50_A0A1A8AAF2 Transmembrane protein 200C n=9 Tax=Nothobranchius TaxID=28779 RepID=A0A1A8AAF2_NOTFU  ali  51  129.......................................................................DNKGEYTFLNQTETINETTPQLPRSFLQEFLDRYLYSDRLKVLGPLIMGIGIFLFICANAVLHENRDRKTKVINLQ 204
107 2.000e-10UniRef50_UPI000C6E38C3 uncharacterized protein LOC111620580 n=1 Tax=Centruroides sculpturatus TaxID=218467 RepID=UPI000C6E38C3  ali  21  53QASSGASGAQAQNQSGKLAKERKKKGLAAVKEKVNCRCIIQTCKACGMFLIMIGTTMSVVGFYAPTLSKELVQEGNKTVEVTNE------------------DTKYHLHNLTFVGPVFMGLGGFAIVASCVMTFEGPEANARVVPMR 183
108 3.000e-10UniRef50_A0A0F8APT7 Transmembrane protein 200A n=13 Tax=Clupeocephala TaxID=186625 RepID=A0A0F8APT7_LARCR  ali  27  5KARDATTTSPTCRGKSRFTLRGRKKKDGVIQGKLRIRXXXXXXXXXXXXXXXXXXXXXXXXXXXXRI-ARSSILGAAEGESISESQTSGWSLGAKGFLSA--ASLIHSERMKLLGPVIMGVGLFILICANTVLYENRDRETQMLLAQ 148
109 3.000e-10UniRef50_I3KD31 Uncharacterized protein n=13 Tax=Percomorphaceae TaxID=1489872 RepID=I3KD31_ORENI  ali  57  122.......................................................................TNGGSDDGFNQTETINGTTRHLPQGFLQDFLDRYLYSDRLKVFGPLIMGIGIFLFICANAVLHENRDKKTKVINLR 197
110 4.000e-10UniRef50_A0A1B0CMN6 Uncharacterized protein n=1 Tax=Lutzomyia longipalpis TaxID=7200 RepID=A0A1B0CMN6_LUTLO  ali  26  13.....RTKPSYGPVRRACPASGATFNIEVGRAKMTSRCLWHACRX-----XXXXXXXXXXXXXXXXXXXXXDHLSIGQEVRGNATIRVRNESRG-----------FHLNNLSYVGPIVMGFGGFIVVAACVMTFEARDSAAKVVPAR 138
111 5.000e-10UniRef50_V8NV88 Transmembrane protein (Fragment) n=11 Tax=Sauria TaxID=32561 RepID=V8NV88_OPHHA  ali  29  7.PEKKTSGSSAPSRWHRGRFRRKPSPQMVVKGQLRMRSXXXXXXXXXXXXXXXXXXXXXXXXXXHRTKSGSGRAGS-SNVTGEIRKEIKVSPQARLF--------LHSEKLKLIGPVVMGVGLFIFICANTMLYENRDTETRLLMQQ 143
112 5.000e-10UniRef50_H9JQ78 Uncharacterized protein n=2 Tax=Ditrysia TaxID=37567 RepID=H9JQ78_BOMMO  ali  27  33..........................EAVVRGKMSSQCLWHACRX-----XXXXXXXXXXXXXXXXXXXXADTLSVAEEIRGNATVSVKDEARG-----------FHLNNLSYAGPIVMGFGGFIVVAACVMTFEARDSAAKVTPAR 137
113 6.000e-10UniRef50_UPI0008F9D734 uncharacterized protein LOC109039825 n=1 Tax=Bemisia tabaci TaxID=7038 RepID=UPI0008F9D734  ali  24  20.................RCTTPAQWNVS---GKVSTKCFWNACKALGLLLMLIGGSMATIGYYADQ-------QSAGNETRGNSSASNVWVKHD--------ARGFHLNNLSYAGPIVMGVGGFIVVAACVMTFEARDTAAKVAAAR 133
114 6.000e-10UniRef50_M3ZEX8 Uncharacterized protein n=4 Tax=Euteleosteomorpha TaxID=1489388 RepID=M3ZEX8_XIPMA  ali  72  13RQDSLRSKNRAENKRKRKSKKKKKNDVVVVKGKLNXXX---------XXXXXXXXXXXXXXXXXXXXXXXXXXRQTNVSNQSHSNSSNPNPTPHCGILCDFLDNYLYSDNLKVFGPLVMGIGIFLFICANAVLHENRDKKTKIINLR 150
115 2.000e-09UniRef50_A0A0R4IKP7 Si:ch211-204a13.2 n=25 Tax=Clupeocephala TaxID=186625 RepID=A0A0R4IKP7_DANRE  ali  24  5KSRGRTSATHSRQRLPRFSLHSRRKKEGVIQGKLRIRXX----XXXXXXXXXXXXXXXXXXXXXXXXXXRAHRSSLDTVEEGSSGTASGWGLGSKGLFSA--ASLVHSERMKLLGPVIMGVGLFILICANTVLYENRDRETQMLLAQ 145
116 2.000e-09UniRef50_UPI000CF7DBB8 lethal(3)malignant brain tumor-like protein 4 isoform X1 n=3 Tax=Oryzias melastigma TaxID=30732 RepID=UPI000CF7DBB8  ali  56  609...........................................................................SLTESINGTSQQIPLSFLEELLNRLARPRYLYSDWLKVFGPLIMGIGIFLFICANAVLHENRDKKTKIINLQ 680
117 2.000e-09UniRef50_W5LUV1 Si:ch211-204a13.2 n=10 Tax=Clupeocephala TaxID=186625 RepID=W5LUV1_ASTMX  ali  24  5KSQDRAPATHSSQRLPHFGLRSQKKKEGVIQGKLRIRXXXXXXXXXXXXXXXXXXXXXXXXXXXXRVQ--RSALGAVSNGLSSTSQASGWGLGAKGLFST--ASLIHSERMKLLGPVIMGVGLFILICANTVLCENRDRETQMLLAQ 147
118 3.000e-09UniRef50_W5NP22 Si:ch211-204a13.2 n=2 Tax=Lepisosteus oculatus TaxID=7918 RepID=W5NP22_LEPOC  ali  26  4.QEPWSLAQPPPSRQRPLRLAFRGKEEGAVRGKLRIKSXX---XXXXXXXXXXXXXXXXXXXXXXXXXRAHRAAAALSQSGVGLNDSLPGGRAGGSKKVLSSQNLIHSDRMKLLGPIIMGVGLFIFICANTMLYENRDRETQLLLA. 145
119 3.000e-09UniRef50_E7FAA8 Transmembrane protein 200C n=2 Tax=Otophysi TaxID=186626 RepID=E7FAA8_DANRE  ali  53  14RQDSLRAKNRAENKRKRKAKKKRKNEVVVVKGKLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKESPLYPGLINTVSSPRNGSNGTAEVDSPKLGAFAAFINRYLYSDKLKVFGPLIMGIGIFLFICANAVLHENRDKKTKIINLR 183
120 3.000e-09UniRef50_A0A182M3E3 Uncharacterized protein n=2 Tax=Nematocera TaxID=7148 RepID=A0A182M3E3_9DIPT  ali  28  12.....RRKASLGPLRRAHPASGATWNVQVVRGKMTSRCLWHACRALGMVLMFVGGGMATVGYYANNFP-------SMSDVRSNSTSTIRVKNEHRG---------LHLNNLSYVGPIIMGVGG........................ 115
121 4.000e-09UniRef50_UPI000C6C8C9C uncharacterized protein LOC111630650 n=1 Tax=Centruroides sculpturatus TaxID=218467 RepID=UPI000C6C8C9C  ali  16  29RVRPRASSHQQSNQKGEQGEKISRWEQF--RSQVTPQCFWAVCKSCGVFLLSAGMAMSVVGFYAEPLSTEAVNENNKTVRVLDQN------------------RQYHLHNLTYVGPVIMGLGGFVLLAVCVMNCDGPETGAKVVPIK 158
122 7.000e-09UniRef50_A0A2R5L7K5 Uncharacterized protein n=1 Tax=Ornithodoros turicata TaxID=34597 RepID=A0A2R5L7K5_9ACAR  ali  24  11........................WNPDPPRGKVSDKCLWAACKAMGLLLIVIGASMATLGFYSDHLATTRERRGNTTVLVKNENFEK------------------HLDSLTYVGPLVMGIGGFIIVATCVMTFEARDTSS...... 111
123 8.000e-09UniRef50_UPI00097DD42E transmembrane protein 200C-like n=1 Tax=Paralichthys olivaceus TaxID=8255 RepID=UPI00097DD42E  ali  90  1........................................................................................................YLYSDRLKVFGPLIMGIGIFLFICANAVLHENRDKKTKVINLR 43
124 8.000e-09UniRef50_B7Q9B6 uncharacterized protein n=4 Tax=Ixodidae TaxID=6939 RepID=B7Q9B6_IXOSC  ali  27  27.........................GETATRGKVSDQCLWAACKAMGLLLIVIGASMATIGFYSDH-------LSTVEERRGNITVLVKNENRDK-----------HLDSLTYVGPLVMGMGGFIIVATCVMTFEARDTSS...... 126
125 1.000e-08UniRef50_A0A2U9BLP6 Putative transmembrane protein 200A-like n=1 Tax=Scophthalmus maximus TaxID=52904 RepID=A0A2U9BLP6_SCOMX  ali  24  5KARGVKPNSTSGRRKSRFTLRGRKKKDGVIRGKLRIRXXXXXXXXXXXXXXXXXXXXXXXXXXXXRIS-RLSILGAADRDSITESQTSGWSLGAKSFLST--ASLSHNERMKLLGPVIMGVGLFILICANTVLYENRDRETQMLLAQ 148
126 2.000e-08UniRef50_K7FMD3 Transmembrane protein 200B n=3 Tax=Sauria TaxID=32561 RepID=K7FMD3_PELSI  ali  25  17RPEKKSLGHAPPSRRHRRKLRHKPPAEVRVKGQLRMRSTXXXXXXXXXXXXXXXXXXXXXXXXXHQGPHAAGPSARPV------NSSSPGDIKKQVKVSAHARYLPHSEKLKLIGPVIMGVGLFIVICANTMLYENRDTETRLLMQK 157
127 2.000e-08UniRef50_UPI0004546951 transmembrane protein 200C-like n=1 Tax=Ornithorhynchus anatinus TaxID=9258 RepID=UPI0004546951  ali  82  108.....................................................................................................FSGYLHSDRLKVFGPLIMGIGIFLFICANAVLHENRDRRTKVINLR 153
128 4.000e-08UniRef50_I3IWA2 Transmembrane protein 200A n=27 Tax=Percomorphaceae TaxID=1489872 RepID=I3IWA2_ORENI  ali  32  16RQDSARSQHPVPPTSPAPRKRKRRTDVVVVRGRLRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHSKAMLAGGGTGVKTEKDAANASHTPSRETESALMRFLEQHLHSERMKMLGPFTMGIGIFIFICANAILHENRDRETKIIHMR 176
129 5.000e-08UniRef50_UPI0006795D60 uncharacterized protein LOC106120964 n=1 Tax=Papilio xuthus TaxID=66420 RepID=UPI0006795D60  ali  32  1..................................................MLLGSAMAVIGYYADT-------LSVAQEIRGNATVSVKDEARG-----------FHLNNLSYAGPIVMGFGGFIVVAACVMTFEARDSAAKVTPAR 79
130 5.000e-08UniRef50_U3J9Y0 Uncharacterized protein n=1 Tax=Anas platyrhynchos TaxID=8839 RepID=U3J9Y0_ANAPL  ali  50  6.........................................................................................................PHSEKLKLIGPVIMGIGLFIFICANTMLYENRDMETRMLMQK 47
131 6.000e-08UniRef50_A0A194PX64 Uncharacterized protein n=2 Tax=Papilio TaxID=7145 RepID=A0A194PX64_PAPXU  ali  24  1.................................MSSQCLWHACRX-----XXXXXXXXXXXXXXXXXXXYADTLSVAQEIRGNATVSVKDEARG-----------FHLNNLSYAGPIVMGFGGFIVVAACVMTFEARDSAAKVTPAR 98
132 7.000e-08UniRef50_A0A1V9XB19 Uncharacterized protein (Fragment) n=1 Tax=Tropilaelaps mercedesae TaxID=418985 RepID=A0A1V9XB19_9ACAR  ali  29  35................................KMSERCLWSACKSVGLLLMACGAAMATLGFYSDH-------LSTVEERRGNSTVLIKNENRD-----------WQLDSLTYLGPMVMGLGGFIIVATCVMTFEARESR....... 126
133 7.000e-08UniRef50_A0A2I0LS08 Transmembrane protein 200B n=30 Tax=Archelosauria TaxID=1329799 RepID=A0A2I0LS08_COLLI  ali  31  39......................KSPPEVPVKGQLRMRSPXXXXXXXXXXXXXXXXXXXXXXXXXHRGPSGTGASVGNTSIVGDMRREVAAGR-----------HVPHSEKLKLIGPVIMGIGLFIFICANTMLYENRDMETRRLMQK 152
134 7.000e-08UniRef50_UPI000CD61BE0 transmembrane protein 200A-like n=1 Tax=Paramormyrops kingsleyae TaxID=1676925 RepID=UPI000CD61BE0  ali  23  10......PHSSACQQLPQFSFSRKKTK--AVRGKLRMKXXXXXXXXXXXXXXXXXXXXXXXXXXXHRAHRTALLSQASAGTGMSGTQATKWGQGARGMLT--VTSLVHHTRMRLLGPVIMGVGLFILICANTVLYENRDRETRLLLAQ 146
135 8.000e-08UniRef50_UPI000CD5D987 transmembrane protein 200B-like n=1 Tax=Paramormyrops kingsleyae TaxID=1676925 RepID=UPI000CD5D987  ali  28  20........SPFRQRLPRFGFCSKKKSEAAIQGRLRIKXXXXXXXXXXXXXXXXXXXXXXXXXXXRAHRAGTQGQTAVNGSR------VVQGRAAGARSLPSAAGLMHSDRMKLLGPIVMGVGLFIFICANTMLYENRDRETQLLLAQ 152
136 1.000e-07UniRef50_UPI0009A40756 transmembrane protein 200A-like n=1 Tax=Rhincodon typus TaxID=259920 RepID=UPI0009A40756  ali  36  78.......................................................................HNSQMSANREGTNTSELSVETQHARLKLQSQPGLKH-EKLKLIGPLIMGFGLFIFICANTVLHENRDRETKLLAQR 152
137 1.000e-07UniRef50_A0A0P7YGR3 Transmembrane protein 200A-like n=1 Tax=Scleropages formosus TaxID=113540 RepID=A0A0P7YGR3_9TELE  ali  34  24.......PSPFCQRLRRFSFRTRKKGDGVIRGKLRIRXXXXXXXXXXXXXXXXXXXXXXXXXXXXR--AHRLSQASVDGARLNGSHAAAGKGPGVRSILS-TTGFVHSDRMKLLGPIVMGVGLFIFICANTMLYENRDRET...... 154
138 1.000e-07UniRef50_UPI0005237488 transmembrane protein 200B n=1 Tax=Tauraco erythrolophus TaxID=121530 RepID=UPI0005237488  ali  35  1.......................................................................................NASTGGDMRREGASGRHVPHSEKLKLIGPVIMGIGLFIFICANTMLYENRDMETRRLMQK 60
139 2.000e-07UniRef50_UPI00052901B7 transmembrane protein 200B n=1 Tax=Mesitornis unicolor TaxID=54374 RepID=UPI00052901B7  ali  52  1...........................................................................................................SEKLKLIGPVIMGIGLFIFICANTMLYENRDMETRRLMQK 40
140 2.000e-07UniRef50_A0A2P4S6M3 Uncharacterized protein (Fragment) n=1 Tax=Bambusicola thoracicus TaxID=9083 RepID=A0A2P4S6M3_BAMTH  ali  47  60.........................................................................................................PHNEKLKLIGPVIMGIGLFIFICANTMLYENRDMETRMLMQK 101
141 2.000e-07UniRef50_W4XKX5 Uncharacterized protein n=1 Tax=Strongylocentrotus purpuratus TaxID=7668 RepID=W4XKX5_STRPU  ali  23  77......PKSQKAEGSPHSQKTGPGKDESKPR-RCTWCNPIHVCLVLGLAVAIGSVAMTVCGYMSYQIALRTVNLGNETITTIDD------------------ELQGEIEKFRTFGPVLIGLGSFISMCACVLMCEARDEKKR..... 193
142 3.000e-07UniRef50_UPI0004571984 transmembrane protein 200B n=1 Tax=Callorhinchus milii TaxID=7868 RepID=UPI0004571984  ali  41  47....................................................................................TIANHSKVPNEVAVKSQAQSGLKTEKLKLIGPLIMGIGLFVFICANTILHENRDRETKLIIQR 109
143 5.000e-07UniRef50_UPI000C6D4DFA uncharacterized protein LOC111630655 n=1 Tax=Centruroides sculpturatus TaxID=218467 RepID=UPI000C6D4DFA  ali  26  21................HPDNRTKWWTIDAVRIKMAENSLWTVCKX-----XXXXXXXXXXXXXXXXXXXXSEYLSRVEEQRGNTTIWVKNESRDT-----------HLGSLTYIGPVVMGTGGFIIVAACVMTFEARDTAAKIVPV. 134
144 7.000e-07UniRef50_UPI000BE200AD uncharacterized protein LOC111245186 n=1 Tax=Varroa destructor TaxID=109461 RepID=UPI000BE200AD  ali  28  16................EPSKRNCSNDAV---DKMSERCLWSACKSVGLLLMACGAAMATLGFYSDH-------LSTVEERRGNSTVLIKNENRD-----------WQLDSLTYLGPMVMGLGGFIIVATCVMTFEARESR....... 120
145 9.000e-07UniRef50_UPI000CE65630 transmembrane protein 200B n=1 Tax=Chrysemys picta bellii TaxID=8478 RepID=UPI000CE65630  ali  44  17........................................................................................................FPHSEKLKLIGPVIMGVGLFIVICANTMLYENRDMETRLLMQK 59
146 1.000e-06UniRef50_A0A0L7LLD1 Uncharacterized protein n=2 Tax=Holometabola TaxID=33392 RepID=A0A0L7LLD1_9NEOP  ali  23  13....RRARSVTGPLRRAHPASGATWNVQVVRGKMSSQCLWHACRX-----XXXXXXXXXXXXXXXXXXXYADILSVDQEIRGNATVSVKDEARG-----------FHLNNLSYVGPIVMGFG......................... 114
147 1.000e-06UniRef50_A0A0P4WFU3 Uncharacterized protein n=1 Tax=Scylla olivacea TaxID=85551 RepID=A0A0P4WFU3_9EUCA  ali  27  126........................................................MASINSSVVSNTTSTMSTIHNDNVGDNDTTSSRPKMGHIFTK----DTGFGLNKLSYVGPIVMGFGGFVIVAACVMTFEARDSAAKIVPAR 212
148 1.000e-06UniRef50_UPI0003C11CCD transmembrane protein 200A-like n=1 Tax=Latimeria chalumnae TaxID=7897 RepID=UPI0003C11CCD  ali  25  78......................................................................RGRHGALGARARAANDSSAPHSEVGVRLLLPAQPVLSGHKMKLIGPVIMGVGLFIFICASTMLYENRDKETQVLIQK 154
149 2.000e-06UniRef50_A0A195D031 Usher syndrome type-1G protein like protein n=3 Tax=Attini TaxID=143999 RepID=A0A195D031_9HYME  ali  28  7.........QWQGTQRRACGPGANWNVQVVRGKVTTRCLWHACKAIGLLLLLLGACMATIGYYADQ-------LSVAQEIRGNITVKVKNESRG-----------FHLNNLSYAGPVVMGLGG........................ 104
150 3.000e-06UniRef50_H2ZTG0 Transmembrane protein 200B n=1 Tax=Latimeria chalumnae TaxID=7897 RepID=H2ZTG0_LATCH  ali  25  54......................................................................RGRHGALGARARAANDSSAPHSEVGVRLLLPAQPVLSGHKMKLIGPVIMGVGLFIFICASTMLYENRDKETQVLIQK 130
151 3.000e-06UniRef50_A0A1D1VXF9 Uncharacterized protein n=1 Tax=Ramazzottius varieornatus TaxID=947166 RepID=A0A1D1VXF9_RAMVA  ali  23  85.....................................................................................SSHEYSLSNMTYHERNLDLHYHLKNLTYVGPAFMGLGCVIIVAICVMTFEARDKAAKICP.. 144
152 5.000e-06UniRef50_UPI00094798A9 uncharacterized protein LOC109480665 n=1 Tax=Branchiostoma belcheri TaxID=7741 RepID=UPI00094798A9  ali  25  6....................................................................................NNNNSSSTMGMEADRAFPTDRAFLRDFRLIGPLTVGLGVFAVLCGVTALLEDRDRRTKRIFVR 68
153 5.000e-06UniRef50_A0A226PEK4 Uncharacterized protein n=6 Tax=Galliformes TaxID=8976 RepID=A0A226PEK4_COLVI  ali  47  111.........................................................................................................PHNEKLKLIGPVIMGIGLFIFICANTMLYENRDMETRMLMQK 152
154 6.000e-06UniRef50_A0A1L1RKE6 Transmembrane protein 200B n=7 Tax=Aves TaxID=8782 RepID=A0A1L1RKE6_CHICK  ali  47  111.........................................................................................................PHNEKLKLIGPVIMGIGLFIFICANTMLYENRDMETRMLMQK 152
155 7.000e-06UniRef50_A0A2A4JUF9 Uncharacterized protein n=4 Tax=Noctuidae TaxID=7100 RepID=A0A2A4JUF9_HELVI  ali  26  1.................................MSSTCLWHACRX-----XXXXXXXXXXXXXXXXXXXXXDTLSVAQEVRGNSTVSVKDEARG-----------FHLNNLSYAGPIVMGFGGFIVVAACVMTFEARDSAAKVV... 95
156 9.000e-06UniRef50_A0A1W4YYM1 LOW QUALITY PROTEIN: transmembrane protein 200C-like n=2 Tax=Scleropages formosus TaxID=113540 RepID=A0A1W4YYM1_9TELE  ali  48  117.................................................................QDNAAPQHANKGLHDRNQSSSPATGTLPAAGFFTAFMATHLNSERLKVFGPLTIGIGIFIFICANAVLHENRDRKTKIIDLR 198
157 9.000e-06UniRef50_UPI000523CF1D transmembrane protein 200B n=1 Tax=Chaetura pelagica TaxID=8897 RepID=UPI000523CF1D  ali  46  38.......................................................................................................HLPHGEKLKLIGPVIMGIGLFIFICANTMLYENRDLETRRLMQ. 80
158 9.000e-06UniRef50_A0A1S3M6B3 transmembrane protein 200A-like n=12 Tax=Euteleosteomorpha TaxID=1489388 RepID=A0A1S3M6B3_SALSA  ali  25  85.................................................................QGSGSVDGAGGVRGGGVSEPQSSGWSLGAKSLLTT--ASLIHSERMKLLGPVIMGVGLFILICANTVLYENRDRETQMLLAQ 164
159 1.000e-05UniRef50_UPI000CD5F9F6 transmembrane protein 200C-like n=1 Tax=Paramormyrops kingsleyae TaxID=1676925 RepID=UPI000CD5F9F6  ali  39  14RQDSLHSKNQLEXXXXXXXXXXXXNDVVVVRGKLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKDYPLYQTPKVSGSNSVLNQMYSEFPAPPAVGFFREFLATYLHSDKLKXXXXXXXXXXXXXXXXXXXXLHENRDKKTKIINLR 186
160 3.000e-05UniRef50_UPI000776B614 transmembrane protein 200B isoform X1 n=2 Tax=Coturnix japonica TaxID=93934 RepID=UPI000776B614  ali  47  300.........................................................................................................PHNEKLKLIGPVIMGIGLFIFICANTMLYENRDMETRMLMQK 341
161 3.000e-05UniRef50_A0A2R7VYP9 Uncharacterized protein n=2 Tax=Pentatomomorpha TaxID=33357 RepID=A0A2R7VYP9_ONCFA  ali  30  4.....................................................................YADQLSVVQEMRGNTTIRIKHEARG-----------FHLNNLSYVGPIVMGVGGFIVVAACVMTFEARDSAAKVVP.. 68
162 3.000e-05UniRef50_V9KSW7 Transmembrane protein 200A (Fragment) n=1 Tax=Callorhinchus milii TaxID=7868 RepID=V9KSW7_CALMI  ali  72  1...............................................................................................................KMLGPFTMGIGIFIFICANAILHENRDKETKVIQMR 36
163 3.000e-05UniRef50_A0A1U7RZV8 transmembrane protein 200B n=8 Tax=Sauria TaxID=32561 RepID=A0A1U7RZV8_ALLSI  ali  50  118...........................................................................................................TEKLKLIGPVIMGIGLFIFICANTMLYENRDMETRLLMQK 157
164 6.000e-05UniRef50_A0A1L8H7R3 Uncharacterized protein n=3 Tax=Xenopus TaxID=262014 RepID=A0A1L8H7R3_XENLA  ali  50  85........................................................................................................RPHAERLKLIGPVIMGVGLFVFICANTLLYENRDTETKRL... 124
165 6.000e-05UniRef50_C3ZCW6 Uncharacterized protein n=1 Tax=Branchiostoma floridae TaxID=7739 RepID=C3ZCW6_BRAFL  ali  27  199..............................................................................QVSIGNNNSSSSSTMDGDIGLAFLAHSDFQRTFQLTGPLILGLGVFTMLCGITALLEDRDKKTKRIIIR 267
166 2.000e-04UniRef50_A0A2P4S5Y3 Uncharacterized protein (Fragment) n=2 Tax=Neognathae TaxID=8825 RepID=A0A2P4S5Y3_BAMTH  ali  52  1...............................................................................................................KLIGPVIMGIGLFIFICANTMLYENRDMETRMLMQK 36
167 3.000e-04UniRef50_UPI000B90C48A uncharacterized protein LOC110988170 n=1 Tax=Acanthaster planci TaxID=133434 RepID=UPI000B90C48A  ali  30  62..................................KHCTTVLACLLVGVMITLGSVAMTVCGYFAMNIASETVRSENSTTVLIDE------------------ELHENLNKFRTFGPVMIGFGSFLIMCACVLLCEEKDKKTK..... 151
168 5.000e-04UniRef50_A0A0K2UEU5 Uncharacterized protein n=2 Tax=Lepeophtheirus salmonis TaxID=72036 RepID=A0A0K2UEU5_LEPSM  ali  40  18.......................................................................................................NSFKLNNLSFAGPVVMGFGGFLIVAACVMTFENKDNAAKIGP.. 59
169 5.000e-04UniRef50_H0W7T3 Transmembrane protein 200B n=15 Tax=Theria TaxID=722675 RepID=H0W7T3_CAVPO  ali  30  50.........................................................................SPSGAFAALGALVGTAPGPRVSELRREGRGHGPH-ERLRLLGPVIMGVGLFVFICANTLLYENRDLETRRL... 119
170 5.000e-04UniRef50_UPI00094E76E3 transmembrane protein 200B-like n=1 Tax=Hippocampus comes TaxID=109280 RepID=UPI00094E76E3  ali  30  6.ARGATSLSPSRRRRPRFTLRARKKKDGAIRGKLRLRXX--------XXXXXXXXXXXXXXXXXXXXXXXRMSRWSIAGAAEGNGVPEPAGNRSRGAQGFLSSV---SERMKLLGPVIMGVGLFILICANTVLYENRDRETQVLLAQ 140
171 6.000e-04UniRef50_UPI000742580F uncharacterized protein LOC107102234 n=1 Tax=Cyprinodon variegatus TaxID=28743 RepID=UPI000742580F  ali  48  81..........................................................................................................HADRMKLAGPVVMGVGLFIFICAASLLFENRDKENPPCD.. 119
172 8.000e-04UniRef50_A0A1S3S002 uncharacterized protein LOC106605954 n=7 Tax=Protacanthopterygii TaxID=41705 RepID=A0A1S3S002_SALSA  ali  50  92..........................................................................................................HSERMKLLGPVVMGFGLFIFICAGTLLYENRDRENR..... 127
173 1.000e-03UniRef50_UPI00094792D5 uncharacterized protein LOC109469808 n=1 Tax=Branchiostoma belcheri TaxID=7741 RepID=UPI00094792D5  ali  34  253..................................................................................................LGLLTDRDFLHTFRLAGPLILGLGVFSMLCGITALLEDRDKKTKRIIIR 301
174 1.000e-03UniRef50_A0A1W4ZHY4 uncharacterized protein LOC108931788 n=1 Tax=Scleropages formosus TaxID=113540 RepID=A0A1W4ZHY4_9TELE  ali  46  62......................................................................................................SGVGHHDRMRLLGPVIMGVGLFILICANTVLYENRDHDTRL.... 102
175 1.000e-03UniRef50_UPI00085470EA transmembrane protein 200B n=1 Tax=Nanorana parkeri TaxID=125878 RepID=UPI00085470EA  ali  52  89............................................................................................................EKLKLIGPVLMGFGLFVFICANTLLYENRDMETRRL... 124
176 1.000e-03UniRef50_A0A287D009 Transmembrane protein 200B n=3 Tax=Boreoeutheria TaxID=1437010 RepID=A0A287D009_ICTTR  ali  48  76...........................................................................................................HERLRLLGPVIMGVGLFVFICANTLLYENRDLETRRL... 112
177 1.000e-03UniRef50_UPI0008146FF6 transmembrane protein 200A-like n=5 Tax=Otophysi TaxID=186626 RepID=UPI0008146FF6  ali  55  80...........................................................................................................AEKLKLVGPIIMGVGLFIFICANTLLYEN........... 108
178 1.000e-03UniRef50_UPI000BBD7B1F transmembrane protein 200A-like n=1 Tax=Astyanax mexicanus TaxID=7994 RepID=UPI000BBD7B1F  ali  42  75.....................................................................................................PTGRTAAEKLRLVGPIIMGVGLFIFICANTLLYEN........... 109
179 0.002UniRef50_J9KKN5 Uncharacterized protein n=1 Tax=Acyrthosiphon pisum TaxID=7029 RepID=J9KKN5_ACYPI  ali  34  95..........................................................................................................HIYKLSYAGPIVMGVGGFIVVAACVMTFEARDRAAKFM... 132
180 0.002UniRef50_D3Z0P8 Transmembrane protein 200B n=5 Tax=Muroidea TaxID=337687 RepID=D3Z0P8_MOUSE  ali  45  90........................................................................................................HGPHERLRLLGPVIMGVGLFVFICANTLLYENRDLETRRL... 129
181 0.002UniRef50_UPI0007043EC7 LOW QUALITY PROTEIN: transmembrane protein 200B n=3 Tax=Boreoeutheria TaxID=1437010 RepID=UPI0007043EC7  ali  48  5........................................................................................................HGPQERLRLLGPVIMGVGLFVFICANTLLYENRDLET...... 41
182 0.003UniRef50_E2R1P3 Transmembrane protein 200B n=54 Tax=Eutheria TaxID=9347 RepID=E2R1P3_CANLF  ali  36  87...................................................................................ANASAPPPSELRREGRGAGRAHGPHERLRLLGPVVMGVGLFVFICANTLLYENRDLETRRL... 147
183 0.003UniRef50_A0A1S3GFI0 transmembrane protein 200B n=16 Tax=Eutheria TaxID=9347 RepID=A0A1S3GFI0_DIPOR  ali  51  10.............................................................................................................RLRLLGPVIMGVGLFVFICANTLLYENRDLETRRL... 44
184 0.004UniRef50_Q69YZ2 Transmembrane protein 200B n=20 Tax=Boreoeutheria TaxID=1437010 RepID=T200B_HUMAN  ali  28  77.........................................................................HRAGAPGSRAANASSPQMSELRREGRGGGRAHGPHERLRLLGPVIMGVGLFVFICANTLLYENRDLETRRL... 147
185 0.004UniRef50_S9XC90 Uncharacterized protein n=1 Tax=Camelus ferus TaxID=419612 RepID=S9XC90_CAMFR  ali  62  1......................................................................................................................MGVGLFVFICANTLLYENRDLETR..... 24
186 0.004UniRef50_G9KVX0 Transmembrane protein TTMA-like protein (Fragment) n=1 Tax=Mustela putorius furo TaxID=9669 RepID=G9KVX0_MUSPF  ali  48  24KQDPLRPPTLVPKRKRKAKKRR-KNDVVVVKGKLKLCSISGLIALCGILV................................................................................................. 72
187 0.005UniRef50_A0A2S2NQZ1 Uncharacterized protein n=5 Tax=Aphididae TaxID=27482 RepID=A0A2S2NQZ1_SCHGA  ali  34  95..........................................................................................................HIYKLSYAGPIVMGVGGFIVVAACVMTFEARDRAAKFM... 132
188 0.005UniRef50_A0A1V4KG64 Transmembrane protein 200C n=1 Tax=Patagioenas fasciata monilis TaxID=372326 RepID=A0A1V4KG64_PATFA  ali  100  1......................................................................................................................MGIGIFLFICANAVLHENRDKKTKIINLR 29

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 0 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35