current user: public

If you have questions about the server, please let us know.

Query: PF11047.8; SOPD2_SALTY/1-319; Salmonella outer protein D, from PfamA32U

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .
# E-value Template Links and tools%idFirst MPVTLSFGNRHNYEINHSRLARLMSPDKEEALYMGVWDRFKDCFRTHKKQEVLEVLYTLIHGCERENQAELNVDITGMEKIHAFTQLKEYANPSQQDRFVMRFDMNQTQVLFEIDGKVIDKCNLHRLLNVSENCIFKVMEEDEEELFLKICIKYGEKISRYPELLEGFANKLKDAVNEDDDVKDEVYKLMRSGEDRKMECVEWNGTLTEEEKNKLRCLQMGSFNITTQFFKIGYWELEGEVLFDMVHPTLSYLLQAYKPSLSSDLIETNTMLFSDVLNKDYDDYQNNKREIDAILRRIYRSHNNTLFISEKSSCRNMLILast
1 1.000e-90UniRef50_P40722 Secreted effector protein SopD n=342 Tax=Enterobacteriaceae TaxID=543 RepID=SOPD_SALTY  ali  43  1MPVTLSFGNHQNYTLNESRLAHLLSADKEKAIHMGGWDKVQDHFRAEKKDHALEVLHSIIHGQGRGEPGEMEVNVEDINKIYAFKRLQHLACPAHQDLFTIKMDASQTQFLLMVGDTVISQSNIKDILNISDDAVIESMSREERQLFLQICEVIGSKMTWHPELLQESISTLRKEVTGNAQIKTAVYEMMRPAEAPDHPLVEWQDSLTADEKSMLACINAGNFEPTTQFCKIGYQEVQGEVAFSMMHPCISYLLHSYSP--FSEFKPTNSG-FLKKLNQDYNDYHAKKMFIDVILEKLYLTHERSLHIGKDGCSRNILL 316
2 7.000e-90UniRef50_A0A2R4IEG1 Type III secretion system effector SopD2 n=68 Tax=Salmonella choleraesuis TaxID=28901 RepID=A0A2R4IEG1_SALET  ali  84  1MPVTLSFGNRHNYEVNASRLARLMSPDKEEALYMGLWDRFKDYFRTHKKREVLEVLYTLIHGCERENQAELNVDTIGMEKIYAFAQLKQYANPSQQDRFVMRFDVSQTQVLFEIDDRVIDKCNLHRLLNVSENCIFKVMEEDEEELFFKACIKYGEKIACYPELLENFAFDLRQKVNEDDEIRDEVYKLMRSGENRKMACVEWNGTLTEDEMDKLRCLQMGSFEISTQFCKIGYWELEGEVLFDMVHPTLIYLLHGYIPSLSCDFTEANTMLFSDALNKDYEEYQNNKREIDAILRRIYRSHNNTLFISKNSGCRNMLL 319
3 1.000e-89UniRef50_Q8ZQC8 Secreted effector protein sopD2 n=296 Tax=Enterobacteriaceae TaxID=543 RepID=SOPD2_SALTY  ali  100  1MPVTLSFGNRHNYEINHSRLARLMSPDKEEALYMGVWDRFKDCFRTHKKQEVLEVLYTLIHGCERENQAELNVDITGMEKIHAFTQLKEYANPSQQDRFVMRFDMNQTQVLFEIDGKVIDKCNLHRLLNVSENCIFKVMEEDEEELFLKICIKYGEKISRYPELLEGFANKLKDAVNEDDDVKDEVYKLMRSGEDRKMECVEWNGTLTEEEKNKLRCLQMGSFNITTQFFKIGYWELEGEVLFDMVHPTLSYLLQAYKPSLSSDLIETNTMLFSDVLNKDYDDYQNNKREIDAILRRIYRSHNNTLFISEKSSCRNMLI 319
4 9.000e-70UniRef50_UPI0003BAC529 leucine rich repeat protein n=3 Tax=Salmonella choleraesuis TaxID=28901 RepID=UPI0003BAC529  ali  17  1MPFHIGSGCL-PATISNRRIYRIAWSDT--PPEMSSWEKMKEFFCSTHQTEALECIWTICHPPAGTTREDV---------INRFELLRTLAYAGWEESIHSGQHGENYFCILDEDSQEILSVTLDDAGNYTVNCQ-----GYSETHRLTLDTAQGEEGTGHAEGASGTFRTSFLPATTAPQTPAE-YDAVWSAWRRAAPAEESRGRAAVVQK-MRACLNNGN-------AVLNVGESGLTTLPDCLPAHITTLVIPDNN--LTSLPALPPE--LRTLEVSGNQLTSLPVLPPGLLE-LSIFSNPLTHLP.......... 278
5 3.000e-68UniRef50_UPI0009B18374 E3 ubiquitin-protein ligase SspH2 n=9 Tax=Salmonella choleraesuis TaxID=28901 RepID=UPI0009B18374  ali  17  1MPFHIGSGCL-PATISNRRIYRIAWSDT--PPEMSSWEKMKEFFCSTHQTEALECIWTICHPPAGTTREDV---------VSRFELLRTLAYDGWEESIHSGQHGENYFCILDEDSQEILSVTLDDAGNYTVNCQ-----GYSETHRLTLDTAQGEEGTGHAEGASGTFRTSFLPATTAPQTPAE-YDAVWSAWRRAAPAEESRGRAAVVQK-MRACLNNGN-------AVLNVGESGLTTLPDCLPAHITTLVIPDNN--LTSLPALPPE--LRTLEVSGNQLTSLPVLPPGLLE-LSIFSNPLTHLP.......... 278
6 5.000e-68UniRef50_A0A2X5DFI4 Secreted protein in the Sop family transferred to eukaryotic cells n=9 Tax=Salmonella choleraesuis TaxID=28901 RepID=A0A2X5DFI4_S  ali  39  1......................................................MLHSIIHGQGRGEPGEMEVNVEDINKIYAFKRLQHLACPAHQDLFTIKMDASQTQFLLMVGDTVISQSNIKDILNISDDAVIESMSREERQLFLQICEVIGAKMTWHPELLQESISTLRKEVTGNAQIKAAVYEMMRPAEAPDHPLVEWQDLLTADEKSMLACINAGNFEPTTQFCKIGYQEVQGEVAFSMMHPCISYLLHSYSP--FAEFKPTNSG-FLKKLNQDYNDYHAKKMFIDVILEKLYLTHERSLHIGKDGCSRNILL 262
7 1.000e-64UniRef50_UPI000D0343FC SPI-2 type III secretion system effector E3 ubiquitin transferase SspH2 n=7 Tax=Salmonella choleraesuis TaxID=28901 RepID=UPI0  ali  17  1MPFHIGSGCL-PATISNRRIYRIAWSDT--PPEMSSWEKMKEFFCSTHQTEALECIWAICHPPAGTTREDV---------INRFELLRTLAYAGWEESIHSGQHGENYFCILDEDSQEILSVTLDDAGNYTVNCQ-----GYSETHRLTLDTAQGEEGTGHAEGASGTFRTSFLPATTAPQTPAE-YDAVWSAWRRAAPAEESRGRAAVVQK-MRACLNNGN-------AVLNVGESGLTTLPDCLPAHITTLVIPDNN--LTSLPALPPE--LRTLEVSGNQLTSLPALPPGLLE-LSIFSNPLTHLP.......... 278
8 3.000e-60UniRef50_A0A2T8LEW9 E3 ubiquitin--protein ligase n=9 Tax=Salmonella choleraesuis TaxID=28901 RepID=A0A2T8LEW9_SALET  ali  16  1MPLHVGRGCL-PATITNLRINCIAQSAT--PPEMSLWEKIKEFFCSTHQTEAQECIWTICHPSVGTTREDV---------VSRFEQLRMLTYAGYEESIHSGRHGESHFCILDADNQEILSVTLDDAGNHTVNCQ-----GHNETYRFTMDIEQGEECTEHAEGASGTLQ-VSPLPAPAAPQTPAEYDAVWSEWKGAAPAEELRGRAATVQR-ICTCLNNGSRE-------LNVGESGLTALPDRLPAHITTLVIPH-NNYLTSLPTLPSG--LEVLTVEDNQLTSLPP-LPAGLQMLSVAGNQLTRLP.......... 279
9 2.000e-59UniRef50_UPI000957C5F9 E3 ubiquitin--protein ligase n=3 Tax=Salmonella choleraesuis TaxID=28901 RepID=UPI000957C5F9  ali  17  1MPFYVGSGCR-PATISNRRIYRIAWSDT--PPEMSSWEKCKEFFCSTHQTEALECIRTICHPPAGTTREDV---------VSRFEQLRTLAYAGCEENIHSGLHGENHFCIMDEDNQEILSVTLDDAGNYTVNCQ-----GYSETHHFTMATEPGVERTEHAEGASG---TSCLPATTAPQ-TAAEYDAVWSAWQRAAPKGEARGRAAVVQ-EMRDCLKNGN-------PVLNVGGAGLTTLPDHLPPHITKLIIP-RNNYLTRLSRLPPGLRLQSLSVPGNQLPSLPD-LPSGLRKLWASGNRLTSLS.......... 296
10 5.000e-57UniRef50_A0A2X4TKF5 E3 ubiquitin-protein ligase SspH2 n=29 Tax=Enterobacteriaceae TaxID=543 RepID=A0A2X4TKF5_SALCE  ali  17  1MPFYVGSGCR-PATISNHRIYLIARFDT--PPEMSSWEKSKAFFCSTHQTEALECIRKICHPPAGTTREDV---------VSRFGQLRTLAYAGCEENIHSGLHGENHYCILDEDNQEILSVTLDDAGNYTVNCQ-----GYSETHHLTMATEPGEERTEHAE------GTSCLPATTAPQ-TAAEYYAVWSAWQRAAPEGEARGRAAAVKK-MRDCLKNGN--PVLCVERAD-----LTTLPDHLPPHITILFIPDNN--LTSLPALPSG--LRELSVSYNQLTSLPP-LPSGLWKLSVFNNQLASLP.......... 272
11 1.000e-56UniRef50_A0A124CYK8 Secreted effector protein sopD2 n=4 Tax=Salmonella choleraesuis TaxID=28901 RepID=A0A124CYK8_SALCE  ali  83  1MPVTLSFGNRHHYEINTSRLARLMSPDKEEALYMGVWDRFKEYFRTHKKREVLEVLYTLIHGCERENQAELNVDTVGMEKIYAFAQLKQYANPSQQDRFVMRFDMNQTQVLFEIDGKVIDKCNLHRILNISENCIFKVMEEDEEELFFKVCIKYGEKIACYPELLENFAFDLRQEVNEDDDIKDEVYKLMRSGEDRKMECVEWNGTLTEDEMDKLAVFKWGLLVFIPNFVK........................................................................................ 231
12 2.000e-54UniRef50_A0A100PNL2 E3 ubiquitin-protein ligase sspH2 n=5 Tax=Enterobacterales TaxID=91347 RepID=A0A100PNL2_SALCE  ali  16  1MPLHVGRGCL-PATITNLRINCIAQSAT--PPEMSLWEKIKEFFCSTHQTEAQECIWTICHPSVGTTREDV---------VSRFEQLRMLTYAGYEESIHSGRHGESHFCILDADNQEILSVTLDDAGNHTVNCQ-----GHNETYRFTMDIEQGEECTEHAEGASGTLQ-VSPLPAPAAPQTPAEYDAVWSEWKGAAPAEELRGRAATVQR-ICTCLNNGSRE-------LNVGESGLTALPDRLPAHITTLVIPH-NNYLTSLPTLPSG--LEVLTVEDNQLTSLPESITGL......................... 265
13 2.000e-47UniRef50_UPI0009ACE18D E3 ubiquitin--protein ligase n=6 Tax=Salmonella choleraesuis TaxID=28901 RepID=UPI0009ACE18D  ali  16  25..............................SPEEIVWEKIQVFFPQENYEEAQRCLAELCHPSRGTLPDNISS---------RFEHLKTLTLPVWQDNIQCNREGIHQFCILDADSQEILSATLDDAGNYTISCQ-----EYNETHCLTVDTAQGEECTGHAEGASGTLLTSLRP----ASPTAAEYDAVWSEWEMAATEKESRGRAATVQ-EMRDCLKNGK-------SVLNVGGAGLTTLPDRLPPHITKLVIP-RNNYLTRLPPLPPG--LRKLIVSNNKLTCLPR-LPSGLLSLSVPGNQLTRLPE......... 274
14 1.000e-45UniRef50_D0ZVG2 E3 ubiquitin-protein ligase SspH1 n=785 Tax=Salmonella choleraesuis TaxID=28901 RepID=SSPH1_SALT1  ali  16  25..............................SPEEIVWEKIQVFFPQENYEEAQQCLAELCHPARGMLPDHISSQ---------FARLKALTFPAWEENIQCNRDGINQFCILDAGSKEILSITLDDAGNYTVNCQ-----GYSEAHDFIMDTEPGEECTEFAEGASGTS----LRPATTVSQKAAEYDAVWSKWERDAPAGESPGRAAVVQ-EMRDCLNNGN-------PVLNVGASGLTTLPDRLPPHITTLVIPDNN--LTSLPELPEG--LRELEVSGNLQLTSLPSLPQGLQKLWAYNNWLASLP.......... 273
15 2.000e-39UniRef50_A0A2X5C3R0 Pathogenicity island 1 protein SopD2 n=1 Tax=Salmonella enterica I TaxID=59201 RepID=A0A2X5C3R0_SALET  ali  82  1MPVTLSFGNHHHYDINRSRLVRLMNPDKEEALYMGPWDRFKDYFRAHKKQEVLEVLYTLIHGCERENQAELNVNITGMEKIHAFTQLKQYADPSQQDRFVMRFDMSQTQVVFEIDGQIIDKCNLHRLLNVSENCIFKVMEEDEVELFFKVCIKYGEKNCSLSRIIRR........................................................................................................................................................ 167
16 4.000e-39UniRef50_A0A2X5B8M5 E3 ubiquitin-protein ligase SspH2 n=3 Tax=Salmonella choleraesuis TaxID=28901 RepID=A0A2X5B8M5_SALET  ali  16  1...............................................................................MINRFELLRTLAYAGWEESIHSGQHGENYFCILDEDSQEILSVTLDDAGNYTVNCQ-----GYSETHRLTLDTAQGEEGTGHAEGASGTFRTSFLPATTAPQTPAE-YDAVWSAWRRAAPAEESRGRAAVVQK-MRACLNNGN-------AVLNVGESGLTTLPDCLPAHITTLVIPDNN--LTSLPALPPE--LRTLEVSGNQLTSLPVLPPGLLE-LSIFSNPLTHLP.......... 211
17 4.000e-36UniRef50_A0A2X5BGV3 Pathogenicity island 1 protein SopD2 n=2 Tax=Salmonella enterica I TaxID=59201 RepID=A0A2X5BGV3_SALET  ali  96  2..........................................................................................................................................................EKKIARYPELLEGFANQLKDAVNEDDDVKDEVYKLMRSGEDRKMACVEWNGTLTEEEMNKLRCLQMGSFNITTQFFKIGYWELEGEVLFDMVHPTLSYLLQAYKPSLSSDLIETNTMLFSDVLNKDYDDYQNNKREIDAILRRIYRSHNNTLFISEKSSCRNMLI 166
18 2.000e-34UniRef50_UPI000D25B0B6 hypothetical protein n=2 Tax=Edwardsiella ictaluri TaxID=67780 RepID=UPI000D25B0B6  ali  15  1MPLYVGSG-YFPATISNNRIQRIVSAN--ITPDMSVRENVHEYFNSTHKSEALTCIQEICHPPAGTTRDAV---------VGRFGRLRGLAYPGFADKIKSGDKDNGDNCILDENGQEMLSVILGDDEKYTV-----IYPNGRVTHDLSLPASQGDEG-----LLASCTFATAGPQTAD------EYEAVWLAWERAAPPAEAECRTQTVQK-LRQCMQNDTRLDVSHTPLTSLPPL---------PTGLQSLDISY--TSLTKLPPLPDG--LQSLDVSHTSLTKLPT-LPHGLQSLNVSHTSLIGLP.......... 268
19 4.000e-33UniRef50_A0A2J9SJS7 Uncharacterized protein n=1 Tax=Yersinia enterocolitica TaxID=630 RepID=A0A2J9SJS7_YEREN  ali  17  1MSLNVG-NGYFSAHISAERLSAIRNNT--LPPEMSLWEKIKDFFFSTHQKEALACIYKLYHYRDRG------QEITPNEVRDTFNKLKELASPGWKGNFSLSSNGSYDICNIIIDYETIWSVWENDLLPVGE-ERRNIAVKRMRKCLINNTYNLWLRLTSLPEFLPRNITTLHNRLTYLPALPQMLMDLQACDNQ-----LTYLPALPATMIYLHASNNQLTYLPMTFLNVDNNRLTYLPALPQMLHNQLTYLPAPASNNQLTCLPPLS--GVITFLNVDNNRLTSLP-ELTVTLNFLGANHNQLTCLP.......... 333
20 5.000e-33UniRef50_Q8ZQ79 Secreted effector protein SseI n=173 Tax=root TaxID=1 RepID=SSEI_SALTY  ali  16  1MPFHIGSGCL-PAIISNRRIYRIAWSDT--PPEMSSWEKMKEFFCSTHQAEALECIWTICHPPAGTTREDV---------VSRFELLRTLAYDGWEENIHSGLHGENYFCILDEDSQEILSVTLDDVGNYTVNCQ-----GYSETHHLTMATEPGVERTDYNLTSDIDAAAYLEELKQNPIINNKIMNPVGQCESLMTPVSNFMNE................................................................................................................. 191
21 9.000e-33UniRef50_A0A2X5BES3 E3 ubiquitin-protein ligase SlrP n=1 Tax=Salmonella thompson TaxID=600 RepID=A0A2X5BES3_SALTH  ali  12  13...........HQSISNE-------ASTEVPLKEEIWNKISAFFSSEHQVEAQNCIAYLCHPPETASPEEIKSK---------FECLRMLAFPAYADNIQYSRGGADQYCILSENSQEILSIVFNT-------EGYTVEGGGKSVTYTRVTESEQASSASGSKDAVN-------------------YELIWSEWVKEAPAKEAANREEAVQR-MRDCLKNNKTELRLKI-------LGLTTIPAYIPEQITTLILD--NNELKSLPENLQGN-IKTLYANSNQLTSIPATLPDTIQEMELSINRITELPER........ 259
22 3.000e-32UniRef50_A0A086EY86 Uncharacterized protein n=1 Tax=Pectobacterium carotovorum subsp. brasiliense TaxID=180957 RepID=A0A086EY86_PECCA  ali  11  3.......NFNISPTSSHATANSCHISNVRDPQHQSLWPKMKEWFPQSNQSQAETLLRKFYQP---------ATEISQRERLFNFIQLKTLLSPEYQNNLATERLDGKGETVCTINDAPTLSEDDHNAAQGLIALHKWVCASPDGEAEKRHDAAKWIQACWKNNFTSLNLANLGLTTLPDTLPQRITYLNVENNSLTTLPALPQNITHLYVRDNILTTLPDTLPQEITHLDVSDNP---LTALPDTLPKQIVVLYA--RNNILTTLPASLPQEITR-LNISNNRLETLPASLPQKITHLDVSYNQLTSLP.......... 302
23 7.000e-31UniRef50_A0A2U8I370 Uncharacterized protein n=2 Tax=Enterobacterales TaxID=91347 RepID=A0A2U8I370_9GAMM  ali  19  1MPLTIQGNTPFSRAISDKRIRRVESSSKEEAAYMGVWDKIKDWICRTKKSEALEKLYELTHTDHEPDTE------SALKTMISFYQLKEMTYPGFQNRFQASVTENEYTFTFSIKDGMDERKLVYGNSEKDIRAFSEKQLTNHSEFLNINPVSRESVDAALAKVAYNTDPDKLEGISSSNQKRLYLHLLSGPTKQEMVFDQRLTQRWIALQMK.......................................................................................................... 213
24 1.000e-30UniRef50_A0A0T9X343 Secreted effector protein n=1 Tax=Salmonella enterica subsp. enterica serovar Bovismorbificans TaxID=58097 RepID=A0A0T9X343_SALET  ali  21  1MPFHIGSGCL-PATISNRRIYRIAWSDT--PPEMSSWEKMKEFFCSTHQTEALECIWTICHPPAGTTREDV---------INRFELLRTLAYAGWEESIHSGQHGENYFCILDEDSQEILSVTLDDAGNYTVNCQ........................................................................................................................................................................................ 123
25 2.000e-30UniRef50_A0A080ICF0 Uncharacterized protein n=6 Tax=Escherichia coli TaxID=562 RepID=A0A080ICF0_ECOLX  ali  22  35....LSVGNEEKYSITHKDITNLIAGDRQSFLKLTLWEFILDLFPMYHIKEAKETIVEFVTKTE--------------DKVKRFERIKSLAIPEEKWRF-------STTTEFTVDENKDIIVSRVFKININSKDNHNNAEENTMRSVLSEERNYNSYKHDIHFDEKAFQSGILKMQFPNDNEKLSVYL------KNKIPFENMIIDLSALKKDVLVSLKQCCFKKMTFTGNISYENLNGPVFENCFFEE-------------CNFENVSLVGFDKVTCESYDVLCNVKP.............................. 279
26 1.000e-28UniRef50_A3D3Z6 Uncharacterized protein n=4 Tax=Shewanella TaxID=22 RepID=A3D3Z6_SHEB5  ali  20  1MTVEVALGRQHTYHFNESRLERVLTANTDEAGKMGLLDKILDWFRGGVKLEAIKALYQQVTEPG---------DLTPSQVAKRFCALRNLAVDQHQAKFTLALGDNQWRMLLSIGGRTIYQTD-----NRDIDTHFYQVAAVKTTITASDDLRKMASALTLEKYIEGNIQCMSDNQAVQQALRNSLADPRFSSEL-------FTGVLPNDSEAATFVAQFGDLQWTFSNRAETNGEFRGELLKKALYSGDYKNLGDLAANGFMSSEDNS.................................................. 251
27 2.000e-28UniRef50_A0A090NC50 Uncharacterized protein n=4 Tax=Enterobacteriaceae TaxID=543 RepID=A0A090NC50_SHIDY  ali  21  42....LSVGNEEKYSITHKDITNLIAGDRQSFLKLTLWEFILDLFSMYHIKEAKERIVEFVTKTE--------------DKVKRFEIIKSLAIPEEKWRF-------STTTEFTVDENKDIIVSRVFKININSKDNHNNAKENTMRSVLSEERNYNSYKHDIHFDEKAFQSGILKMQFPNDNEKLSVYL------KNKIPFENMIIDLSALKKDVLVSLKQCCFKKMTFTGNISYENLNGPVFENCFFEG-------------CNFENVSLVGFDKVTCESYDVLCNVKP.............................. 286
28 2.000e-28UniRef50_A0A2A3VTL6 Type III effector protein (Fragment) n=21 Tax=Enterobacteriaceae TaxID=543 RepID=A0A2A3VTL6_ECOLX  ali  22  1....MSVGNEEKYSITHKDITNLIAGDRQSFLKLTLWEFILDLFPMYHIKEAKETIAEFVTKTE--------------DKVKRFERIKYLAIPEEKWRF-------STTTEFTVDENKDIIVSRVFKINVNSKDNHNNAEENTMRSVLSEERNYNSYKHDIHFDEKAFQSGILKMQFPNDNEKLSVYL------KNKIPFENMIIDLSALKKDVLVSLKQCCFKKMTFTGNISYENLNGPVFENCFFEG-------------CNFENVSLVGFDKVTCESYDVLCNVKP.............................. 245
29 3.000e-28UniRef50_A0A0T9YBX8 Secreted protein SopD-like protein n=1 Tax=Salmonella enterica subsp. enterica serovar Bovismorbificans TaxID=58097 RepID=A0A0T9Y  ali  100  1MPVTLSFGNRHNYEINHSRLARLMSPDKEEALYMGVWDRFKDCFRTHKKQEVLEVLYTLIHGCERENQAELNVDITGMEKIHAFTQLKEYANPSQQDRFVMRFDMNQTQVL................................................................................................................................................................................................................ 111
30 7.000e-28UniRef50_UPI00046ACAF9 hypothetical protein n=1 Tax=Morganella morganii TaxID=582 RepID=UPI00046ACAF9  ali  17  1MPFQIG-NRFFSDEISNSRNNAIARSDT--PPEAGLWEKIKAFFCSANKPEAQALIRQICHPPDRTEWETVT---------GKFEQLKTLTYGGFKERVQVGRDGENHACILDENGDEMLSVTVD-------------KEGGETHHLT----------------------------TTAAPRTTQDYEASWSAWEKTAPAGKAPDRAAAVQM-MRDCLHNDGTE-------LNLSYLGLTSLPESIQECLRTLQRSYSDSPFSIVIAN................................................... 208
31 8.000e-28UniRef50_A0A1S1WX98 Uncharacterized protein n=2 Tax=Chromobacterium TaxID=535 RepID=A0A1S1WX98_9NEIS  ali  17  1MAIEIIVGKQQNFNFNESRIDRIISANTAEASKMGLWDKIKDYFQGGVKRQAIETLFNSIHRPSEQNRE-------PLGMLEKFERLTELAHPRHQNDFLVDVHDGKWGYALRIAEHTVYQSMLADTPETPFNDFCVGKIGMEFRQFV----AHHPDSFTLDSYMESNIQCMSDDPDTQQMLRSSLDDSRYGRENLLAVTEH------ADPSKFIARFKTGDL--VLSNRISSNMEFRGDRLKSELWH....................................................................... 235
32 9.000e-28UniRef50_W0HLE4 Uncharacterized protein n=4 Tax=Sodalis TaxID=84565 RepID=W0HLE4_9GAMM  ali  20  1MSIAIKSSPFFNRTISSDKIARAINSDNKDAMALNLWDKIKDWFCGTKTCEVLEKIFVITHGEGNMTTEE------ALSKVIAFHQLQGMAYPIHDDKFHAVVTSNSYRFSFAIAGVMKGQSLCYGKHEGDIRAIQRHALTNDSEFLL---PAHVGDKTVGCALTSITYDKERNEFNGVSQSNQGRLSL----HLLSDAAKERLARHPELAQAWV-SLQMKTFDFYARL.......................................................................................... 221
33 1.000e-27UniRef50_UPI0009A96336 hypothetical protein n=2 Tax=Salmonella choleraesuis TaxID=28901 RepID=UPI0009A96336  ali  16  65MPFYVGSSC-FPACISKQKITEILNSN--IPPKMSLWEKIKEFFFSTHQAEAQDCLYRICHPSAGTTPDDVR---------YLFERLKELAYPGYADNIQSYRYGGKHFCIMDKNGDELLSVIFADDYTVT............................................................................................................................................................................................ 183
34 1.000e-27UniRef50_UPI000BE22CD8 hypothetical protein n=1 Tax=Salmonella choleraesuis TaxID=28901 RepID=UPI000BE22CD8  ali  13  23............................EVSPEKIVWEKFS-FFPQENYEEAQRCLAEICHPTQGTLLDHISSW---------FKHLKALTFSAWEENIQYNRDGIHQFC--------ILGADSKDGLVVGIDSQHCTLEWEGGTVTCSVDTQQTGDVG--------------------APLENREYESIWTAWINDAPPEEIEKRSKAV-DWMRECSKYHCL-------ILDLSDLRLTTLPDHLHEHITFL--AVINNRLTKLPDTLPGGYRQITRI........................................ 225
35 2.000e-27UniRef50_A9MHU6 Uncharacterized protein n=4 Tax=Enterobacterales TaxID=91347 RepID=A9MHU6_SALAR  ali  19  19MPFYVGSNC-FPACISKKKISDILNSDT--LPKMSLWDKFKEFFFSTHQAEAQNCLYRICHPSPGTTPDDVR---------RLFERLKELAYPGYADNIQCYRYGGKSFCIMDNNGDELLSASFGDDYTVT............................................................................................................................................................................................ 137
36 2.000e-27UniRef50_A0A1S1A066 Uncharacterized protein n=10 Tax=Salmonella choleraesuis TaxID=28901 RepID=A0A1S1A066_SALCE  ali  21  19MPFYVGSSC-FPACISKQKITDILNSD--IPLKMSLWDRIKEFFFTTHQAEAQDCLYRICHPSAGTTPDDVR---------KLFERLKELAHPGYADNIQSHRYGGKSFCIMDKNGDELLSVSFADDYTVT............................................................................................................................................................................................ 137
37 5.000e-27UniRef50_W0HWB9 E3 ubiquitin-protein ligase n=3 Tax=Sodalis TaxID=84565 RepID=W0HWB9_9GAMM  ali  13  1MAISIG-NAFFANTLSAARIGKIMENNGESLPTMTLWEKIKDFFFNGDTQKCLFILNELCHPPADITKRDIKI---------YFEQLQGMANCGDRLHFTFTLTDKDFKPVLSLNLQKACYTVQADYQEDADYAYEKTFPFHTPPHLTETTPQAGDKDKAHALLRQPEGESVVTPRRTTPLTPETPLEPMPNPLLCSVNPREALIALNVRGYPDVQC--EGEVPQTVEVFQAT----RIQRLPDHFPPALATLGIIDSPQLADNALDNLAARTPHLLSLKGCDMPRLPQQLPKTLTHVSLS.................. 313
38 5.000e-27UniRef50_A0A1B1V6Y4 Uncharacterized protein n=14 Tax=Vibrio TaxID=662 RepID=A0A1B1V6Y4_9VIBR  ali  17  1..MSLNISGTFDRTISDARIEHVKQANKEEATYMGLWDKIKDWFCGTDKAQALAHLYEITHEIDTETSE------SASKKMEAFCKLNQLAGSGFTNRFQIDNHDGTYSFEFEITDVLEKTRVNYGEVSKEADCILGRELTNHSQYLLEDNVNRNGLQDALDRVSFNDENDTYQGVTSSKQNQLATELLSPQAKNQMSRDSQLAQNWVAVQMKCVD....................................................................................................... 212
39 6.000e-27UniRef50_A0A0T7RQL2 Secreted effector protein n=1 Tax=Salmonella enterica subsp. enterica serovar Bovismorbificans TaxID=58097 RepID=A0A0T7RQL2_SALET  ali  16  2........................................................................................................................SVTLDDAGNYTVNCQ-----GYSETHRLTLDTAQGEEGTGHAEGASGTFRTSFLPATTAPQTPAE-YDAVWSAWRRAAPAEESRGRAAAVQK-MRACLNNGN-------AVLNVGESGLTTLPDCLPAHITTLVIPDNN--LTSLPALPPE--LRTLEVSGNQLTSLPVLPPGLLE-LSIFSNPLTHLP.......... 171
40 6.000e-27UniRef50_A9ML86 Uncharacterized protein n=1 Tax=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) TaxID=41514 RepID=A9ML86_SALAR  ali  17  1.................................MSSWEKCKEFFCSTHQTEALECIRKICHPPAGTTREDV---------VSRFGQLRTLAYAGWEENIHSGQHGENYFCILDEDSQEILSVTLDNAGNYTVNCQ-----GYSETHHLTMATEPGVVRTEHAEGASG---TSCLPATTASQ-TAVEYDAIWSEWESAAPARESRARVAAVESSKLCCVPNSS................................................................................................. 173
41 1.000e-26UniRef50_W0I0J0 Uncharacterized protein n=1 Tax=Sodalis praecaptivus TaxID=1239307 RepID=W0I0J0_9GAMM  ali  16  6.SPPLSIILNSGWALTSSRITRIIQARTDDASHMGLIDRLYDFFRQGGKRAAITRLYRQLSQPGAGEPHDL----TPTTMVARFMQLRAYANSEYRKVFQLSLRYDPWSYLMQIGDYQIYQ---------SPPLDYRLDNHLAEVCTMKVCLSLDDVLAEIREQLERYIQSQIESMADAPAVRQKLHAVLDDPAYGRENLLGITNIVAHYRHDSLAFANRCATHDEFRGSRLDYPNLRALCLVGYMTKEDTLLKYLARPHLL......................................................... 275
42 9.000e-26UniRef50_A0A2A2GZ69 Uncharacterized protein n=1 Tax=Arsenophonus sp. ENCA TaxID=1987579 RepID=A0A2A2GZ69_9GAMM  ali  17  1MSLSIQSNFLFNRTLSDENIQRINSSSKEEATHVGIWEKIKDWFYGTNTSEALGKIYELTHSNDEPDTEFI------LKKVTAFYQLKEMAYPVYQDRFQASITPNEDGFSFSIKDVMDERTLVYGFTEKDIYSLKERELTNNSELLDHNIVIREGLDVALNQVKYDHKQNKLEGITSANQGRINLHLLDEETKQEMAVNQRFAQKWIALQMK.......................................................................................................... 213
43 9.000e-26UniRef50_G5NHG1 SopD protein n=1 Tax=Salmonella enterica subsp. enterica serovar Inverness str. R8-3668 TaxID=913075 RepID=G5NHG1_SALET  ali  42  1......................................................................................................................................MIESMSREERQLFLQICEVIGAKMTWHPELLQESISTLRKEVTGNAQIKAAVYEMMRPAEAPDHPLVEWQDSLTADEKSMLACINAGNFEPTTQFCKIGYQEVQGEVAFSMMHPCISYLLHSYSP--FAEFKPTN.................................................. 133
44 1.000e-25UniRef50_W0HZ64 Uncharacterized protein n=1 Tax=Sodalis praecaptivus TaxID=1239307 RepID=W0HZ64_9GAMM  ali  26  23MAMLIKSETYSSRTISDARINHIKTAKTKDATAMGLWDKIKDWFCGTRKAEALSHLYDLIHHDDTSEPQKV------LQKIKAFHHLSTMAGKAYQDNFQAVITENPWNIAFTIAEILQTTCSLGKILNGEV........................................................................................................................................................................................... 154
45 4.000e-25UniRef50_V5PY94 Uncharacterized protein n=2 Tax=Pandoraea pnomenusa TaxID=93220 RepID=V5PY94_9BURK  ali  19  1MAAPITLAGSTPRTLSAQAIDTCTRARSE-AEVRSLWGRIKDWFLGTHKEDAKLAIFRLANAP------------NAQAQFDAFLELIGYVAPAHRDQLHFCVGENE-APAFRVADHRIEVKDDWRGLTASE----ALAPDDTARLLLSLRYQDLPVVAEFHD----FGVGLLHDRTADSVLNSQWLYLVRSPELVRA--LEWFGLHRNDAEG.......................................................................................................... 189
46 2.000e-24UniRef50_UPI00093BB852 hypothetical protein n=1 Tax=Candidatus Sodalis sp. SoCistrobi TaxID=1922216 RepID=UPI00093BB852  ali  17  6.SLPLSTILNSGFALNSGRIARIIQARTEDASHMGLVDRLFDKFRKGGKRAAIARLYRQISQPGTGEPRDL----SPAAVVARFMQLRAFANSEYRSAFQLALEQAPWSYLLQIGNYRIYQ---------SPPLDYRLDHQFAEVCTMKVCQSLDDALMEVHDQLERYIQSQVESMADAPAVRQKVLAVLDDPAYGRANLVRITDSLAHFRHDVLALANRCATHDEFRGRRLDYVDLRALCRDSYLTKEDALLKYLARPHLL......................................................... 275
47 3.000e-24UniRef50_UPI000509D532 hypothetical protein n=1 Tax=Arsenophonus endosymbiont of Nilaparvata lugens TaxID=1247023 RepID=UPI000509D532  ali  18  1MSTILNLGNNYNYNFSESRLNRVMNAETAEAQNMGLWDRIKDFFHGGVKRQAIEILFDHINQPACH-------DTSPNKQLLKFERLIDLAKPEHKKDFIIDADPGKWNYRLQIAEHTVYQANIVDSSTTSYGAFCAVMTGMAFRQYISDNPDIFGSGNDSND---DYIRASIQCMSDNEKIRQQLEKDLDNPKYSHKNFEEVADSAEFIARFKEGSLEFSNRDNL-------HGEFRGALLKNAL......................................................................... 238
48 3.000e-24UniRef50_W0HZQ1 Putative SopD2 effector protein n=3 Tax=Sodalis TaxID=84565 RepID=W0HZQ1_9GAMM  ali  20  1MAISVKVIGQQPLAINSSRIGRLLSADKDYATHIGIWDRIKDYFRPYNKSEVLEHLYHLIHSDNTPIPQDEEGKFAHLHVLNAFANLKALAKDDDKALFQVK-ENHYRGVDFYIGATCVKSLDKH---------------QPDDSPVSLLAAYYLQQVNRHPEVKSSIGQTVQDILANDTQSGESIIDGQPIFNGVTRMTEEEITDATNRLYHKLTPLQRAALVEVGSQSGFADVNLGLQSFPNAFIEHFALGGISTS............................................................. 262
49 3.000e-24UniRef50_A0A0K3WTN4 Putative type III effector protein n=2 Tax=Escherichia TaxID=561 RepID=A0A0K3WTN4_ECOLX  ali  19  33..IYLSVANVGKYSVTHKDITNIIAGDSQSFLKLTLWEFILDLFPMYHIKEAKETMVDFVTKTE--------------DKVKRFERIKYLAIPEEKWRFSA-------TTEFTVDENKDIIVSRVFKININSKDNHNEAEENKMHSVFSEVLSLDIYKHDIQFDEKALQSGILKMQFPNDNEKLSVYL------KNQIPLENMTIDLSVLEKDALSSLKQCYFKEVTFTGDISYENLNGPVFENCFFEG-------------CNFENVSLVGFDKVTCKDYAYVCRVKP.............................. 279
50 5.000e-24UniRef50_A0A2A2GZN5 Uncharacterized protein n=1 Tax=Arsenophonus sp. ENCA TaxID=1987579 RepID=A0A2A2GZN5_9GAMM  ali  17  1MSTILNLGNNYNYNFSESRLNRVMNAETAEAQNMGLWDRIKDFFHGGVKRQAIEILFDHINQPACH-------DTSPNKQLLKFERLIDLAKPEHKKDFTIDVDPRNWNYRLQIAEHTVYQANIVDSPTTSYGAFCAVMTGMAFRQYISDNPDIFGSGNDSND---DYIRASIQCMSDNEKIRQQLEKDLDNPKYSHKNFEEVADSAKFIAHFKEAVAKAHVID............................................................................................... 223
51 7.000e-24UniRef50_A0A0T9RMY1 Secreted effector protein sifA n=5 Tax=Enterobacterales TaxID=91347 RepID=A0A0T9RMY1_9GAMM  ali  14  1MGISIGSS-YLTASISNDRINEMLI--THAPPHMSIWGKIKDFFFATGEREALDYLFKLCNPTPDLTSSEIE---------DTFFRLKALCSPGYKERFCHNHIDSSSTGKLHIKDE-----NGDDLLYIEMNGEVCNYNILGKLFVFEDNIKPWFTQEHETNINGLSITKSQSLVDNIVWMKNDFYHVSYESNNFQLDFKVFYDDVINYLTSVNKSNNFHLWREE............................................................................................. 213
52 8.000e-24UniRef50_C4K4U2 Uncharacterized protein n=5 Tax=Candidatus Hamiltonella defensa TaxID=138072 RepID=C4K4U2_HAMD5  ali  20  9....FSQNTCFTYPLSHKRLNRILKSDSKEAQFMGLIDRLFDFFRNGQKRETIIKLYEQIACPPNEEKTFEE--MPYFNMALRFDKLRQLANEEYQQDFKILINDNDYSFSFVICDDVIF-ESDWLSREKNANCFQGIC-TLQVTQQFEDDLYQYPQYLDTDKLIKLRIQTMSDEPEVQRMLEDNLKNPAFSGEIKDLPSEEGRGNVAEFNDGKLKLSNR--RATVGEFRAEPLKQALLKRDFDNLECSLGLGLMTKENPLLSPIIAFSEMNLKQRLNIEISDHHHNLDFLKTLL........................ 310
53 1.000e-23UniRef50_C4K614 Conserved hypothetical phage protein n=3 Tax=Candidatus Hamiltonella defensa TaxID=138072 RepID=C4K614_HAMD5  ali  23  23...........HRAIRNKYINAIKSSSKEEATRIEIWEKIKDWFCGTNTIEALGKLYDLTHHNDKSDTE------SAFKKVSAFYQLKKMACPGHQDKFWADIADNEYTFSFSIEDVIDEFKVVYGNTEDDISAIKKRELTNDSEILEKNTVIGKVKYDREQNKLEGISSANQRRVGLHLLDESVKQKMA................................................................................................................................. 199
54 3.000e-23UniRef50_A0A0D8L9K2 Uncharacterized protein n=1 Tax=Morganella morganii TaxID=582 RepID=A0A0D8L9K2_MORMO  ali  19  5MDIHLTGRFRYHCAITENDISACITANHEKE-VTSLWGKIADWFRGTQKEAAKLALFRLVRAD------------TAAQQLASFAELKQYVAPAWQDSLTWQFDNNNGSC-FKIGDSEIRC---HDTTQDIVPENHSAVNPGDVCHLLLSMKYAGNDI--VSELHHYFAVGSEPDRTADSVLSKENEFLKQNPALLGA--LKLIGLNQNDGQG.......................................................................................................... 196
55 8.000e-23UniRef50_A0A2U8I5E0 Uncharacterized protein n=2 Tax=Candidatus Fukatsuia symbiotica TaxID=1878942 RepID=A0A2U8I5E0_9GAMM  ali  18  1MATSLNVNG-SVFICSDTRMVRMINGDRKTAIYMGIFDRFFDLFRKESKREKIEKLYDELHQDLSDESKITTSRRYSINQLIIFSKIRDMATFDQQDKFTVSVQEE--KMDFFMAGSLIYTQSISKFTGKFIKCLYANQTMREKEQLTTLVERHKNKIKNYFNLHREKLKKIKRDLGLDKDFSITKYKGFCKAHRGRTYYFHVGDKYPVL------YAPPKEKEDDMSYLEGNYKQV------DAMDERFVVLVPKDNNNKLVDFDRSN--------NESNLDLAGIKTLIPG.......................... 279
56 9.000e-23UniRef50_UPI00061CC6A2 hypothetical protein n=1 Tax=Yersinia bercovieri TaxID=634 RepID=UPI00061CC6A2  ali  17  1MSFFVGHGFLSS-EISNSTIDTIQRADS--PPHLSLWEKIKDFFFSTHQEEALQLLFDLYHPKKETVREDVEA---------TWERLKKLASPGYETCFTIYSNPDTNNFTIERASLTITIDSQENQYTIANGDIESRFTFNVYKPEKAVNT------LNSDEIASNVKVKTSTEKEKASAIKIQRYYMSFKSNLREIESKN------EEFTKMVYNGSEKNINGRVYYFSRNYRPV-------------------YKPTKSCEIDSNKKGGFKHVISED....................................... 238
57 1.000e-22UniRef50_A0A0U2WJ40 Uncharacterized protein n=1 Tax=Pandoraea norimbergensis TaxID=93219 RepID=A0A0U2WJ40_9BURK  ali  16  1MSTAITIGNYDYRTLDAANIRLCVSA-KYERDVTSLWGRIKDYFLGTCKEDAKVTLFRLAH------------AETAADQFEAFRRLTDLIAPSRDDLLTWHVCETP-SCAFQIGDFTLPAK--QDWMSFAQFGDPGLNLEDKARLLLSMRYNGHHVATHFHE----FGVGTVLDRTADSVLRAQSAFLANSPALCHALAV--LGLHCNDEQGIFAEDLNQTVERVLDKTVND...................................................................................... 216
58 2.000e-22UniRef50_D2U081 Secreted protein SopD n=2 Tax=Arsenophonus nasoniae TaxID=638 RepID=D2U081_9GAMM  ali  25  9MSTILNLGHNHNYNFNESRLNRVMNAETAEAQYMGLWDRIKDFFQGGVKRQAIEALFDQINQPARH-------DASPNKQLEKFERLIDLAKSEQQTKFTVEVNPREWSFQFKIGQYNIYQSNIPDQAETSYDSFCSVKTEMEHRQFIRQNAELLEQVNDFFQDEMKSQALEKLFQIYHPSS......................................................................................................................................... 189
59 3.000e-22UniRef50_UPI0008371A9F hypothetical protein n=1 Tax=Pseudovibrio hongkongensis TaxID=1647556 RepID=UPI0008371A9F  ali  18  1MTAAIHSGQRFHSHIGSNEIRDIRQSTDREHIATRLWDRITDWFCGTHKVEAKKLIFDMCTHKTTETRKEA-----------AFVKLQELVSPGFQRNF-VEREDQLHRSLAIYDGQTKLYEMRQDVNYVSLSCIENTSDHEESTLDSMIRAAVKELAVRGRNLATEQFQKDFERRA------ELTYQLDDSPVTDIGSYFEA--AISDEQRTVVFALCNQSIFPVVTACATDLKELNYKVYPNA.......................................................................... 239
60 4.000e-22UniRef50_Q2NRU4 Uncharacterized protein n=1 Tax=Sodalis glossinidius (strain morsitans) TaxID=343509 RepID=Q2NRU4_SODGM  ali  17  1MAMTIKSNTLPSETISDARIAYVKNMTKEDATVMRIWDKIKDWFCGTRKKEALGHIYDLTHQGNLSKPQF------ALQCIKAFHSLSTMVGAAYQDKFKALITENPWDLEFIIEGALRVECSLDQEQNKDSALSLDLMKPNASHKTLENNDTFLNTEKEERQTSETSNREKHYDNALFFSHVHDFLNEINIPHLDAALHQPAMARLAALK-------NFDVMPIKSRASWVNIANLISDKIPDD---NILVLKKEFPSNLHFSFDDENKVKQSARLTKYAADAASYLRNLP........................... 287
61 5.000e-22UniRef50_A0A0T9LN96 Secreted protein sopD n=2 Tax=Yersinia TaxID=444888 RepID=A0A0T9LN96_9GAMM  ali  26  1MSIAVTIGTR-SVLVSESRLERMISQDKDHATHLGLWDKIMDYFRPEKKQDVMNELYRLTHAHGTSAS------ITLRDRVETFNKLKLMSEPVYRNLFRVEDHPNKDNITFFIGEQDIYSQDRHTLL-------LEEKQFLSYYNMERINTDQDLKIDFAAAIKRYIFGDLRVQGNN............................................................................................................................................. 164
62 9.000e-22UniRef50_UPI0004691E02 hypothetical protein n=2 Tax=Enterobacterales TaxID=91347 RepID=UPI0004691E02  ali  16  1MLFHVGS-RYFHASISHDQINNILKS--PILPEMSIWEKIKDFFCFTHQTDALKCIHQLCHPPAGTTIDNVKT---------LFERLQKLAHPGDAGNIQIFRDRLNHFSITDKAGKEILSVVFADDYTVT............................................................................................................................................................................................ 119
63 3.000e-21UniRef50_UPI000B3FC7F9 hypothetical protein n=2 Tax=Pandoraea TaxID=93217 RepID=UPI000B3FC7F9  ali  18  1MSTAITFGNPDYRTLDAAQIRLCVSA-KYERDVTSLWGRIKDYFLGTCKEDAKVTLFRLAH------------AETGADQFEAFRRLTDLVAPSRDDLLTWHVSEKP-SCAFQIGDFTLPAK--QDWMSFAQFGDPGLTLEDKARLLLLMRYNGQQVVTHFHE----FGVGAMLDRNADSVLHAQSVFLANAPELCHALAVHRNDEHGNFADDLNQTVER................................................................................................... 208
64 6.000e-21UniRef50_A0A0T9TFR1 Putative antigenic leucine-rich repeat protein n=1 Tax=Yersinia kristensenii TaxID=28152 RepID=A0A0T9TFR1_YERKR  ali  14  16.....................TCTQSTNTPLSEMNVWAGIKEFFFSPNQEEAQACLIKLY-PFSEFSREE-------------FNRLRELAAPGAKQYFSIDTNGSYDLCTIRVNGEILLSKTIDKLDYKAIWSAWQKEAPPDEVEFRQTTVERLHECLENNAKLSSLPEYLPEHIKILDVSNNALTKLPELPESLKHMRVHSNQLLPELPKTLINSSNQLTRLPELKLIDLNVSTNQLTRVPELPKKLIDLNVNANQLTRLPELPKTLKYMKVHSLSANDNQLTNLPM-LPAKLTSLSASSNQLTRLPE......... 322
65 6.000e-21UniRef50_A0A2I8DH04 Uncharacterized protein n=1 Tax=Achromobacter sp. AONIH1 TaxID=1758194 RepID=A0A2I8DH04_9BURK  ali  16  1MSIDVAQ-RHPAYSLSPSRLGRIFQAKSEDASAMNLLDRIIDYFRSNAKRDSIRKVYAIVAAQRDAPIADAECA-----RIGAFLLLRGMAQPRYRDMFELNLTEHPNGYALIIDGQALARRDIHDQQEIA-RLRQACQRMKVDDYLLSLQQHKDDAMSLIPAGEPLSIKQGKSILNSAEITERGALRLTFNANIHMGRQKLLRGESPELAKVLADRFEIHNLKKKGYALALENGRLQVDISPSRLRRIIDHPRSASTNSLMVKILEHLAGNLMQNSNRDSIDAHNQRAD............................. 319
66 7.000e-21UniRef50_G2H1M5 Secreted effector protein n=1 Tax=Candidatus Regiella insecticola 5.15 TaxID=1005043 RepID=G2H1M5_9ENTR  ali  25  9...........HRAIRNKYINAIKSSSKEEATRIEIWEKIKDWFCGTNTIEALGKLYDLTHHNDKSDTE------SAFKKVSAFYQLKKMACPGHQDKFWADIADNEYTFSFSIEDVIDEFKVVYGNTEDDISAIKK...................................................................................................................................................................................... 132
67 7.000e-21UniRef50_H3RGA5 Translocated effector protein n=2 Tax=Enterobacterales TaxID=91347 RepID=H3RGA5_PANSE  ali  15  1MSISFGSS-YLTASISKDRINEMLISHT--PPHMTIWEKIKDFFFTTGEREALDCLFELCNPTPDLTSSEIE---------DIFFRLKALCSPAYKERFCHNHFDSSYKGRLHIQDE-----NGNDILYVEINREVCNYNILGKSFIFEKNITPGIVKDHETSIPDLSITNSKKSFESIAWMKDNIYQLSYKNNNLELDFTVFYDDIFNHITSFNKGDHFYLWREEEKETYIS------SIINKEIDNQLSTKKINLSKNYYKDYIFNRLKNELGTYNVKLNSKSAQSSIKHAVLTSLMRNRSFNEFIRENANDMNI.. 298
68 8.000e-21UniRef50_B7LP66 Uncharacterized protein n=4 Tax=Escherichia fergusonii TaxID=564 RepID=B7LP66_ESCF3  ali  30  2MSLTLNVNHGSACTLNDSRVKRMMSGNHDTAVHMGLWDRFKDWFRIEKKAEALENLYKLLYPTPEDTAVDNNEGKKYTSSLYAFRKLKALISDQSVSNWTISLDVNNCKTTFHFGNVVIEHQAIQ.................................................................................................................................................................................................. 140
69 2.000e-20UniRef50_UPI00046CD2C5 hypothetical protein n=1 Tax=Candidatus Sodalis pierantonius TaxID=1486991 RepID=UPI00046CD2C5  ali  18  7.PPPLSIILNSGWALTSSRITRIIQARTDDASHMGLIDRLYDFFRQGGKCAAITRLYRQLSQPGAGEPHDL----TPTTMVARFMQLRAYANSEYRKVFQLSLEQAPWSYLMQIGDYQIYQ---------SPPLDYRLDNHFAEVCTMKVCQSLDDVLAEIREQLERYIQSQIESMADVPAVRQKIHAVLDDPAYGRENLLGITN.................................................................................................................. 206
70 2.000e-20UniRef50_A0A0C5K2I6 Uncharacterized protein n=1 Tax=Pandoraea vervacti TaxID=656178 RepID=A0A0C5K2I6_9BURK  ali  17  7.SITLNLSGGYGCMLDATTLEKCTTTHDADAL-TSLWGKIKDWFFGTHAEAAKRALHQLAHPT------------SPEAQFDAFARLLEYVAPQDRGKLTWHVEENKAPC-FRVDDYSFDAPQDWRAQQWTEKA-----APDMARLLLSLHYRGKPCLNALAERAMRMSGTDDVALNAETIFESLRWDLIQKPALIHA--LELIGMQWNDERDGLA....................................................................................................... 211
71 3.000e-20UniRef50_E0WUR3 Uncharacterized protein n=2 Tax=Candidatus Regiella insecticola TaxID=138073 RepID=E0WUR3_9ENTR  ali  18  9.......GNYFNTTLNLRRIRRVIKATSQEATKMGLFDKIFDKFRNGGKRKRIIELYQQLTEPDSCESSE----NTPIKMASKFNKLREIANEDYKHDFQIAIHPDRWSYSFSIEKYLIYQSEPLDYYENNFNELCALKIGNDFENDFDECKEHLSQENFIASRIQSVIEKIHKELDNPNYAKDKLLGLFDAENSDDIFFVHFKSDLPELSRHVLELSNRGNENGEFRGSLLKYKNLRELCSHGFMTKDDSLLVYFSTPHKF......................................................... 281
72 4.000e-20UniRef50_A0A0T9UZS5 Secreted effector protein sseJ n=1 Tax=Yersinia frederiksenii TaxID=29484 RepID=A0A0T9UZS5_YERFR  ali  20  1MPFPVGSGFL-TAEISGLQINNMWSED--VLPHLSLWEKIKDFFFSTHQEEALQLLFDLYHPSPNTTPQRVK---------EIWEQLRQLASPGYESCFG-CTDSNPNPNHFTINGTNLSLQIGTDGYEVTNDFTLALKYKYQ................................................................................................................................................................................ 130
73 6.000e-20UniRef50_A0A0T9LKU9 E3 ubiquitin-protein ligase sspH2 n=12 Tax=Yersinia TaxID=444888 RepID=A0A0T9LKU9_YERIN  ali  30  1MGIRVG-NHLFSTEISHSVIANIAQNTT--SPLMSLWERIKDFFCCTHQAEALDCLYQLYHPLNNTDGMNLEEIRSNIAK--TFNQLKQFAAPGYKDRFSQPKGSNNQEQHFTITGE-----NSEFILNISID.......................................................................................................................................................................................... 123
74 7.000e-20UniRef50_UPI0008343EE5 hypothetical protein n=1 Tax=Pseudovibrio stylochi TaxID=1807766 RepID=UPI0008343EE5  ali  17  1MVSSISIGSRFNTEINTSDIRNIAKSTDRDSSASRLWDKMVDWFCGTDRAEAKKLVFDMVSPRSQTSR-----------KVDAFMQLSEIATGGIRNNFTVHEDALSKSYRISDQGNVLLELNLDEKYTNEIKSAFSEEISKTKSDMASLTEKGLKNPNQFNADLPRFGLNAFSFDGETVTSRDEFFNKLSVEEQASVFTLCHQGVFAELIGQKICFAPSNDIE--IAFSRNDSGELEITAYFE........................................................................... 239
75 1.000e-19UniRef50_A0A0A8BVR7 Uncharacterized protein n=3 Tax=Pandoraea pulmonicola TaxID=93221 RepID=A0A0A8BVR7_9BURK  ali  18  1MDIHIS-GSWYSRSIDKKGIQACLNAQREK-DVVSLWGRIADWFLGTKTEAAKVALFRLAHSD------------TLAQQLSSFSELKQYAAPARQDSLTWQISDN-GSPVFRIGDFDI-RCHAATENTMANLPPFNLDER--SRLLSSMYYSGENVVAEFHRFAGESSSLTKSDRSADAVLADQERFLTLTPSLLRA......................................................................................................................... 180
76 1.000e-19UniRef50_Q9LAM4 SPI-2 type III secretion system effector SifB n=113 Tax=Salmonella choleraesuis TaxID=28901 RepID=Q9LAM4_SALEN  ali  16  1MPITIGRGFLKSEMFSQSAI-------SQRSFFTLLWERIKDFFCDTQRSTADQYIKELC---------DVASPPDAQRLFDLFCALYELSSPSCRGNFHFQHYKDQYTNLFIKDGEDIPLCIVYDIMNRTVLCVDTQPAHLKRYSDITITYVCEELCCLFPERLLLSLSGGITFPVDLKNIKETLIAMAEKGNLCDWKEQERKAAIS............................................................................................................... 205
77 1.000e-19UniRef50_E0WQC8 Uncharacterized protein n=2 Tax=Candidatus Regiella insecticola TaxID=138073 RepID=E0WQC8_9ENTR  ali  13  1.................................MGVWGKIKDWVCRNKKSKALKKIYDLTHNDHEPDTE------SALKTITSFYQLKEMIYPGFQDRFQASVTENEYTFAFSIKDAMDERKLVYGNFEKDVHAFSARKLTNNSEFLDTSNVSREGVDAALAKVAYNVALDKLEGISSPNQDRLYLHLLSERTKQKMGFDQRLAQEWIALQRSSLDSIEGMDLTKTIET--ENEWIYNFARSMSSIKRNIQKPLAEKFNNKTNRLYDEPIYAEITDLKAVHSERTDKP............................... 260
78 3.000e-19UniRef50_A0A1S0ZV56 Uncharacterized protein n=14 Tax=Salmonella choleraesuis TaxID=28901 RepID=A0A1S0ZV56_SALCE  ali  15  1MGISVGHS-YFTATISSETINKMLSSD--ELPHMTIWECIKDFFFDTGQREALNCLHKLCNPTP---------DLKDTDITSCFFRLKELASPGYQERFIHDFAEESSTGSLYLKDN--YGDVFLYIEMSEGLCNYTILGKTFIFNTSQMPHSQQECETSTPELSIIFQESESQSSSDSIWLKDGCYLASYGIGEFNLDFNGFYQSVLNFITSVQKGDNFRLWQNE............................................................................................. 213
79 3.000e-19UniRef50_A0A1E3LD94 Uncharacterized protein n=1 Tax=Pandoraea sp. ISTKB TaxID=1586708 RepID=A0A1E3LD94_9BURK  ali  16  1MSTPLSLIGHVPRSLDAETVKACATAGSDSQIA-TLWERIKDWFFGTHKVDAKLAIYQMANAQ------------TAYEQLGAFIRLTHYVELQHFHQLQWCVDKDSQ-LSFKIGDHAFASNAQW-----ASQMPLMLDMEDMSRLLLSLRYDGLDVADAFRELHEAAASAAASGSGQAVDINADSLLTMQQQYLREAPALEIIGLHRNDEGDMAYRLRQ................................................................................................... 212
80 4.000e-19UniRef50_G5QX60 Leucine-rich repeat protein n=1 Tax=Salmonella enterica subsp. enterica serovar Senftenberg str. A4-543 TaxID=913082 RepID=G5QX60_SAL  ali  12  2..............................PLKEEIWNKISAFFSSEHQVEAQSCIAYLCHPPETASPEEIKSK---------FECLRMLAFPAYADNIQYSRGGADQYCILSENSQEILSIVFNT-------EGYTVEGGGKSVTYTRVTESEQASSASGSKDAVN-------------------YELIWSEWVKAAPAEEAANREEAVQR-MRDCLKNNKTELRLKI-------LGLTTIPACIPEQITTLILD--NNELKSFPENSPGEFRKIYRE........................................ 209
81 6.000e-19UniRef50_Q9KIB9 Secreted effector protein SifB n=200 Tax=Salmonella choleraesuis TaxID=28901 RepID=SIFB_SALTY  ali  14  1MPITIGRGFLKSEMFSQSAI-------SQRSFFTLLWEKIKDFFCDTQRSTADQYIKELC---------DVASPPDAQRLFDLFCKLYELSSPSCRGNFHFQHYKDQYTNLCIKDGEDIPLCIMYEIMNRTVLCVDTQSAHLKRYSDINITYVCEPLCCLFPERLQLSLSGGITFSVDLKNIEETLIAMAEKGNLCDWKEQERKAAIS............................................................................................................... 205
82 7.000e-19UniRef50_A0A166D618 Uncharacterized protein n=1 Tax=Pseudovibrio sp. WM33 TaxID=1735585 RepID=A0A166D618_9RHOB  ali  15  1MNPLIGSGTLFDTSLTAGNINTIKAASDRDNPATRLWDKIADWFCGTDREAAKKLVFDLYDP-----------RVTDEKKYDAFQNLRALAGANFTDNFSIIRSDKD--VTYKVGDDYTLKLDLQEPHTDQV-------ARQRIELDLALCILEQATAGKYDQQLKADFERSLDPTNDGPIKVSKNYKINGQPVSDIREFRRFTPEHLN.............................................................................................................. 193
83 1.000e-18UniRef50_G8PK87 Uncharacterized protein n=13 Tax=Pseudovibrio TaxID=258255 RepID=G8PK87_PSEUV  ali  15  1MSSSVGLTTRIHPQISSGDLQSIKGASDRENPATRLWDKVVDWFCGTDRVNAKKLVFDLYSP-----------SVTDQNKVKAFEQLREMAGANFQENFKVYDGPRFQSYS-VLDFKLEFDVRSPDPDNVEGTLKNDIMMEG-----VRIPEQQGRQFLEDFKRRQERTFTFDSKPIDDMSF----FDQFSPQERATVFAVCHQGLFPLLSGPVMCMSNHQ--EMRFDISKPGPDDLRIQAY............................................................................. 223
84 2.000e-18UniRef50_T1H9K8 Uncharacterized protein n=1 Tax=Rhodnius prolixus TaxID=13249 RepID=T1H9K8_RHOPR  ali  15  298....IYQSHREETTISLNEIKEIKNAKKPSEIK-RLWDRIADWFCGTDKENAKKTLFELLNNDDANI------------KIDAFNQLKAMASPAFKKAFTYTTTAINDT-AFTVNLSIGALFSTGDIST----AGETINLIDHIKTFTERCFNQDNDTNNFTQLRKDIPRSKIYFYNANDEKTQFKIEDLSIFENTISEKQKKSLNVALSQIGAIDIIQQIN................................................................................................. 497
85 4.000e-18UniRef50_A0A2U8I7C9 Uncharacterized protein n=1 Tax=Candidatus Fukatsuia symbiotica TaxID=1878942 RepID=A0A2U8I7C9_9GAMM  ali  18  8.SSLLSDSLGGGFKLNDRRIGTIMEAASNEAAKMGLIDTIIDFFRNGAKRERIIALYEQLVVPDLCPSNE----RTPIIMAYKFNKLREMADEEHRHHFQIRINQNMWSYSFSIRKDTIFQ---------SEPLDYRYENYYNEVCTLKICNDFDDDLYEFREVLSQSALTEIQTMSDDESVREEIREKLDDPRYAKEQFSHLSGAFAHFTSGKLELSNRGNETGEFRGNLLKNKIEGKDSKYQNLRELCSYGFMTKDDSRLVYVSAPHRTHLNNYIDEDNSILVNIQRIL............................ 299
86 4.000e-18UniRef50_UPI0009081387 hypothetical protein n=2 Tax=Leclercia TaxID=83654 RepID=UPI0009081387  ali  19  1MSLYIGSSFL-PACISSQTIHKIHLSD--ASPALSLWEKIKEFFFNNQHDKAIDCLFKLCHPHQGISREEVE---------GLFFQLRELAAPGYKNNFVVESNSSLEKCYYRITNKNGDDILLVFHGTIRVN.......................................................................................................................................................................................... 121
87 4.000e-18UniRef50_A0A0J6RHS8 Uncharacterized protein n=3 Tax=Chromobacterium TaxID=535 RepID=A0A0J6RHS8_9NEIS  ali  30  1MSSSISFSGGPAFSLSNERVARMMSGDRQTATHMGLWDKFKDVFRAEKKQDALNTLFKLV------------DSQSPARSFDIFNRLAQLATPSNRTLFTVAVAPEQGKISYCINGQPLKT...................................................................................................................................................................................................... 112
88 4.000e-18UniRef50_A0A1B7JF03 Uncharacterized protein n=1 Tax=Proteus hauseri ATCC 700826 TaxID=1354271 RepID=A0A1B7JF03_PROHU  ali  18  4..........SNASISQKKINKL--ANNSPSSVMSIWEKIKDWFGLSQEKKVLTLIYNIYFNQEATI----------LEKSRDFFSLKKLAGEQYKNEFKHIVDGNDIQYIIDFKDSSILFRSDPFIENIKNELNFDLQNESNKFLEIFINDYYDYDAEDYKKKVISFRTALMKHINKKKNYPNEKNFSLDIFEQKKSFNDKYNYLKENSEKYSVSINKDKLIEKLYNPLSLDKQELRKQVEVDIPRCDLKYDDENITDINSLESKLALPNEKDIIL.......................................... 264
89 6.000e-18UniRef50_A0A0T9T9B0 Secreted effector protein sifA n=7 Tax=Yersinia frederiksenii TaxID=29484 RepID=A0A0T9T9B0_YERFR  ali  14  1MSFTVG-NSFFTANISDNKINELF--TKDSMPHMTLWEKIVNYFFPTGQGEALLCLHKLCNPTIDLTNKDIE---------EIFFRLKELASPGYKDRFCNDHIDSSTTGKLHIKGDG-----GDDLLYIEQNGELCNYTILDQTFIFDTPLIKASQETHFDNEVLSVTFNHWPQPSPNPNVKFMINEKACISYQGRDITLNYTDIYDKLIRDVKNINQGDKFDMWKKEERTTY..................................................................................... 218
90 8.000e-18UniRef50_A0A246NNV1 Type III effector (Fragment) n=5 Tax=Escherichia coli TaxID=562 RepID=A0A246NNV1_ECOLX  ali  17  37......SINDKKYNVNSKDIENILDGKGDLFKKRTLWEFVRDLFPGSHIKEVKGLIYEFVTKVDN--------------KAEVFDKIKSLAKKEQQWRFSTKTD-----FTTNENNEVIVSRSFNLYTGATSNDNEKKQVSSER---LTLDNYLDDLHFDNSPLMRLTFDDYSVKLATLIK--------------NKIPIINTTINLSSLSKDVLNSLKYCSFKNVIFSGEIKSVDLKGPVFENCYFEDCKFNIQLYEPVDNTVGSENNK................................................. 265
91 9.000e-18UniRef50_E0WUM8 Uncharacterized protein n=1 Tax=Candidatus Regiella insecticola LSR1 TaxID=663321 RepID=E0WUM8_9ENTR  ali  15  18........SPFEVTISGDDIKKVANSSKQEATRTSIWEQIKNWLCGTNKKEIKGKIYDLTHNNENLSVK------SVLEKIDIFYDIKRQIEPVYHNEFKMSFEEGEYTFSFFIGDHTVYGNAKNDLDNIKEYKLTNGSQFLDKEIVGESHDTNEALKKALEQVKYYIDNEGTYRFTDVSSSNQKRLNTESLEDNVKDKMVND----PSLAQKWL-SLNMKAFDYY............................................................................................. 230
92 1.000e-17UniRef50_A0A2G3K6V1 Uncharacterized protein n=1 Tax=Chitinimonas sp. BJB300 TaxID=1559339 RepID=A0A2G3K6V1_9BURK  ali  17  1MSELILEGSRASRSISMEEINSIAAAKTEK-DVESLWGRIADWFFGTHKEEAKKMLFRLLNP-----------SISDKECVNAFNKLKELVSEPYKDRFIERNSNITKEGRFEISLQVQGTEVFSRSLDVEGQDFLLGDEQIKSQISNALEARIKEDHTNEPKDPFKQFKKDINRMSYQIINGGVVEYSTAAPGLEGVSTEQRNNDMSRLLQFAQESGLTDNQNKTLEVVLTQTGIIEGKNALATYRPDLAFVGNPD.............................................................. 252
93 2.000e-17UniRef50_E0WUW1 Uncharacterized protein n=1 Tax=Candidatus Regiella insecticola LSR1 TaxID=663321 RepID=E0WUW1_9ENTR  ali  26  49......FKNNAFNKLSAERLGKLMEADREKAICMGLWDRFKDLFRYKKKQEVLKQLYSLIHLDNDQASSSTSEMGTATSLVKAFMALKQLAHEADQNLFKIEKSDDSEDINFVIGTKIIYQHTLSTGLMDKNPDIVKLTAYLDEFVTKTNALWHKACDGDGKKVCDQQARRDFNRDVLNEQLCKELRDCSFQEKDRMLENL...................................................................................................................... 255
94 2.000e-17UniRef50_A0A014NIM1 Uncharacterized protein n=1 Tax=Erwinia mallotivora TaxID=69222 RepID=A0A014NIM1_9GAMM  ali  21  5.......GSRVNAHISLSEIDRIQKATNKN-DVPSLWGKIKDWFCGTKTEKAKICLYEIYN-----------EATDNKQKLNAFFTLINLVSPAYKNRFKFSLDDNSIKIKIDVDGREIELPEDQHGLLDSINERFGHYSSEESIRGLKQDINRADYKFSFYDKEYDFDHRDKSKYQELYNLESKE..................................................................................................................................... 174
95 2.000e-17UniRef50_V1GWP6 Secreted effector protein SifB n=20 Tax=Enterobacteriaceae TaxID=543 RepID=V1GWP6_SALCE  ali  15  1MPITIGKGFLKSEMFPQRTI-------SQRSFFSLLWEKIKDFFCDTRRSAADQYLKELC---------DLTSPPGAQRLFDLFCALYELSSPACKEKFHFQHYQDQYTNLYIKDGAEIPLCIVYNVKGKTVICIDTYPVPLKTYPDVNITYVCEPLCCLFPERLLLSLPGDLTFSIDLSEIKETLIDMVENGELYHWKEQERKAAIS............................................................................................................... 205
96 2.000e-17UniRef50_A0A2X6R151 Putative type III effector protein n=10 Tax=Escherichia coli TaxID=562 RepID=A0A2X6R151_ECOLX  ali  17  37......SINDKKYNVNSKDIENILDGKGDLFKKRTLWEFVRDLFPGSHIKEVKGLIYEFVTKVDN--------------KAEVFDKIKSLAKKEQQWRFSTKTD-----FTTNENNEVIVSRSFNLYTGATSNDNEKKQVSSER---LTLDNYIDDLHFDNSPLKRFMFDDYAVKLTTLIK--------------NKIPIINTTINLSSLSKDVLNSLKYCSFKNVVFSGVINSPNLEGPVFENCYFEDCKFNNI................................................................ 249
97 4.000e-17UniRef50_UPI000250CD71 hypothetical protein n=3 Tax=Escherichia coli TaxID=562 RepID=UPI000250CD71  ali  17  37......SINDKKYNVNSKDIENILDGKGDLFKKRTLWEFVRDLFPGSHIKEVKGLIYEFVTKVDN--------------KAEVFDKIKSLAKKEQQWRFSTKTD-----FTTNENNEVIVSRSFNLYTGATSNDNEKKQVSSER---LTLDNYLDDLHFDNSPLVRLTFDNYSVKLATLIK--------------NKIPIINTTINLSSLSKDVLNSLKYCSFKNVIFSGVINSPNLEGPVFENCYFDDCKFNNI................................................................ 249
98 4.000e-17UniRef50_D2U3A6 Uncharacterized protein n=2 Tax=Arsenophonus TaxID=637 RepID=D2U3A6_9GAMM  ali  12  1..MAISFSSTTPLTISDNKFNQILGANTKIKNVSDFIDSIIDWFKGGVKRQKIEQLFDTIQDVKNSAVSNPES-----NRLEKFIELRKMALPKYHNQFKLEITPEDWGYQLKVGDFTLYNCDKVFEKTRSIDERDQLANFHVKNISMKLEEALSVENHDIQQLLNFTIRCLAGSEKEQNSLREKLDDRAYSKDNY---LGIKNSNKPNELIAAFKNNKQLVFSIRTGELENNLKNTLASKEYNNLREMFFNQYTSISDSLFIDILQQTKADVYDVITQDS...................................... 281
99 5.000e-17UniRef50_A0A0E3YFK3 Uncharacterized protein n=3 Tax=Pandoraea TaxID=93217 RepID=A0A0E3YFK3_9BURK  ali  14  19.............SLSAKHLNECKNARTEKDLE-SLWGRIKDWFFGTHRVDAKLALYRMLNAETTDVMQT------------SYLELLRYVEPEHRQQLAW-LIGEHERPAFQIGGYIVASKVDWASQAPSEPPPSVA---DMAKLLLSLRYKGLPVLETLGEVREQAFPEAKAEVNADRMLEAQQWFLGRSPSLVDA--LELIGLHRNDDDGELAYQLRLAVEKALGGEDDDKAAVMSRNAENLM-CLVTDMFHDREHLKRSALSVNLPANPL............................................. 268
100 5.000e-17UniRef50_UPI0003D1022D E3 ubiquitin-protein ligase sspH1 n=2 Tax=Salmonella typhimurium (strain 14028s / SGSC 2262) TaxID=588858 RepID=UPI0003D1022D  ali  15  2........................................................................................................................................................................................AEYDAVWSKWERDAPAGESPGRAAVVQ-EMRDCLNNGN-------PVLNVGASGLTTLPDRLPPHITTLVIPDNN--LTSLPELPEG--LRELEVSGNLQLTSLPSLPQGLQKLWAYNNWLASLP.......... 114
101 6.000e-17UniRef50_A0A0C5K0Y5 Uncharacterized protein n=2 Tax=Pandoraea TaxID=93217 RepID=A0A0C5K0Y5_9BURK  ali  15  1MSVSIGLLGLVPRSLSADTVAACTKNDIQYQLN-TLWERIKDWFLGTHKVAATTAIHTM------------ATTTSVSAQIGAFLDLIGHVRPEHRDQLKWCAGEGEAPY-FMIGDTVIASAKDW-----SARTPMELSPPDMARMLLATHHRETPLLLTFLQIDVSAAPQARATITPEDEDDVVYVDMAHTDFLRDAPALEFIGMHRNDEDFKMSR...................................................................................................... 208
102 7.000e-17UniRef50_A0A2A2H065 Uncharacterized protein n=1 Tax=Arsenophonus sp. ENCA TaxID=1987579 RepID=A0A2A2H065_9GAMM  ali  25  2.............EINESRVKRLLSGNKDYATYMGILDKIKDLFRTEKKSVAIERLYDFIHNHEQSHVEEVENSDSFKEIIDAFDKLKSLSNENDRNLFRIEKN-HYNGIDFHIGSVLIKSLDNCLPSYHLYNLNNNSEIKKSISEAVQKEIIPNEHNSSIRNLVIDMIRQGRNSAIDGKLLSNN...................................................................................................................................... 173
103 8.000e-17UniRef50_A0A0U1HVP7 Secreted effector protein sseI n=3 Tax=Yersinia rohdei TaxID=29485 RepID=A0A0U1HVP7_YERRO  ali  17  1MSFLVGSFPLFTSGISQSHINGMHL--DGSPPHLSLWEKIKDFFCLTHKEEALQCIFDLHHLDGKTTREEIESICK---------KLEEFAAPGYKSNISLIDSDGNY--------LNIKDNNGRDVLSVKIDAD-----GYMLKCGLVEHSYHYTPPDKYPALHQYTLF..................................................................................................................................................... 146
104 1.000e-16UniRef50_A0A2X5CYI7 Secreted effector protein n=2 Tax=Salmonella choleraesuis TaxID=28901 RepID=A0A2X5CYI7_SALCE  ali  18  1MPITIGRGFLKSEIFSQSPL-------SQRSFFTLLWEKIKDFFCNTRKAEADQYINELC---------DLASPPDAQRLFDLFCALYGLSSPSCREKFHFQHYESQYTNLYIKDGAEIPLCIVYNIMGKTVICIDTYPEPLKTYPDINITYVCEPLCCLFPERLLLSLSSDITFSIDLKQIK........................................................................................................................................ 180
105 1.000e-16UniRef50_UPI000A2638E5 pathogenicity island 2 effector protein SseJ n=1 Tax=Lonsdalea iberica TaxID=1082703 RepID=UPI000A2638E5  ali  21  1MSLNIGSG-LLSAHISRDRLQAI--ANNITPPEMSLWERIKEFFFSTHQKEALECIYTLYH--------HANIQISAEEVHHAFTRLRELASPGCKEQFSNSYGCDLYGEI----QYTILGKSGEALLSVTVHSEESLQAPLTPSEYSRIGPPKYPLFNLAAEIQKLYLTKAQNDLSHIDRI......................................................................................................................................... 170
106 2.000e-16UniRef50_G5SBQ9 Secreted effector SifB n=1 Tax=Salmonella enterica subsp. enterica serovar Wandsworth str. A4-580 TaxID=913086 RepID=G5SBQ9_SALET  ali  18  5MPITIGRGFLKSEMFSQSAI-------SQRSFFTLLWERIKDFFCDTQRSTADQYIKELC---------DVASPPDAQRLFDLFCALYELSSPSCRGNFHFQHYKDQYTNLFIKDGEDIPLCIVYDIMNRTVLCVDTQSAHLKRYSDITI......................................................................................................................................................................... 148
107 4.000e-16UniRef50_A0A024KRK8 Putative type III secreted effector n=443 Tax=root TaxID=1 RepID=A0A024KRK8_ECOLX  ali  17  37......SINDKKYNVNSKDIENILDGKGDLFKKRTLWEFVRDLFPGSHIKEVKGLIYEFVTKVDN--------------KAEVFDKIKSLAKTEQQWRFSTKTD-----FTTNENNEVIVSRSFNLYTGATPNDNEKKQVSSER---LTLDNYLDDLHFDNSPLMRLTFDDYSVKLATLIK--------------NKIPIINTTINLSSLSKDVLNSLKYCSFKNVIFSGEIKSVDLKGPVFENCYFEDCKFNIQLYEPVDNTVGSENNK................................................. 265
108 5.000e-16UniRef50_UPI00040D7165 hypothetical protein n=1 Tax=Arsenophonus nasoniae TaxID=638 RepID=UPI00040D7165  ali  17  1MSITFST-PDINLALNESKLNQVLTANTEEATRLNLIDKIIDWFNGGVKHETIKDLFFAIQDIKNEDTISPE-----FNRLEKFIELRKLANPEHQSKFTLEISEDDWGYKLKIDDFTLYSCDKVFEKTKSYEERAKLPFFCAKKTMIEVEGVYNKFKDTLEDQESDSFKRIITENIEHYQITQNKYHLNEEEKKVFHEELSYI................................................................................................................... 207
109 7.000e-16UniRef50_S5NDM4 Invasion plasmid antigen / internalinputative n=8 Tax=Salmonella bongori TaxID=54736 RepID=S5NDM4_SALBN  ali  15  366..............................................................................................................................................AIQQLQRLTSTPDYRGPQLYFSMSEPAASHSAAHTCEPRQHAEEYEADWSEWITSAPPEEGGNRRIAVER-MRQYLENGAF-------NLDLSHLGLTTLPDYLPENVDFLVISR--NQLSRLPETLPKN-LRQLYVSYNQLTTLPERLPESLRVLNASNNQLARLPER........ 523
110 9.000e-16UniRef50_A0A0J5VXX5 Uncharacterized protein n=2 Tax=Burkholderia cepacia TaxID=292 RepID=A0A0J5VXX5_BURCE  ali  20  1......................MMSGDQKISTHMGLWDKFKDLFRVEKKQDALDRLFKLMN------------VESPLNAFHSFNLLAQLATASNRTLFTTVTTQNQDNCSFCIDGVVVMQVSAQEKSLILLDLGESTDASYVQTQASSLEDYQLYVTPENLALLVDSFGGVHKRFNADTGVLQAQDDVGCADFEREKQVAEYTCNREHLQRYV......................................................................................................... 187
111 1.000e-15UniRef50_A0A2D3TG45 Uncharacterized protein n=2 Tax=Candidatus Hamiltonella defensa TaxID=138072 RepID=A0A2D3TG45_9ENTR  ali  17  38MSLPIQINPLFNTSLRHKNINPFIKTFTKEKPNPIQIEN----FFGIHTPQAIEKINELTHLNEASDTE------SALKKVAAFYELKEMVWPAYQHKFQAQKEDQTYTFSFSIEGII-----------DTCTCFFGQGEKKRASIEKAKWNHHDVKYDGIPEKPQRTFFANQKR................................................................................................................................................ 194
112 1.000e-15UniRef50_V5PYF5 Uncharacterized protein n=4 Tax=Pandoraea pnomenusa TaxID=93220 RepID=V5PYF5_9BURK  ali  17  3.PSHIALAGHFERTIDSDKIGRYASAPSEKELA-SLWGRIKDFFMGTHKEDAKLAIFRLANAQDTET------------QFRAFADLTRYVSPEHGSVLKWNI-ASAHGLDFQIGGDRIMMQTDAEALSIEDSCRVLMTLTHDDHRVIE.......................................................................................................................................................................... 143
113 1.000e-15UniRef50_A0A1E3LDF0 Uncharacterized protein n=1 Tax=Pandoraea sp. ISTKB TaxID=1586708 RepID=A0A1E3LDF0_9BURK  ali  13  1MTISISSIGTSSRTLSAATIQRCASVLHADELN-SFWGRVKDYFLGTHNEDAKRAIFRL------------ATAENARQQCSAFAQLAACIEPTQSHLLRWNLSAD-DAIDFQIGDRRFPMKDVAEFMQQAAPLSF-----DDSCRLLMALKLNDHDVLSESEQFGLPLNVLARHPDDPAYSSVCISAAMGVPALLDALHVLGLDSAVNDSQLALDVA..................................................................................................... 203
114 1.000e-15UniRef50_UPI00073B57B2 hypothetical protein n=2 Tax=Proteus mirabilis TaxID=584 RepID=UPI00073B57B2  ali  16  2MSVKINQN-----DISTSQILRISQGEKAK-DVMSLWAKIKDWFQSNKREKALKTI-------ENIVVEEKSDDKNHFKMLYHVLMLKSMASDAYKERIKINVNDENKDITILIDNYSIFIKDIDNEQLNKISTIINIFNRHSSVFSNEIALKCLYEKLDQNEINDQLFAELYLELDNKISSGEIDLKLSKSNFNQ........................................................................................................................... 189
115 2.000e-15UniRef50_A0A209AS37 Uncharacterized protein n=2 Tax=Yersinia frederiksenii TaxID=29484 RepID=A0A209AS37_YERFR  ali  16  1MNFTVGNSFL-TTNINNEKIHELM--TKNSIPQMSLWEKIKDYFFETGQNEALKCLYELFHPATSLTSNDVE---------GIFFKLKELASPIYKERFCSNHIDSSTTGKLHIKGD-----DSSDLLCIEQKGKLCNYTILDKKFIFDIPLIESSAKESQFGTKNLSIFRNRPHSQFNPNIKWMINEKACISYQGKNINLDYTNLYDRFMREVRSINKGDDFATWKKGERTTY..................................................................................... 218
116 2.000e-15UniRef50_Q56061 Secreted effector protein SifA n=354 Tax=Enterobacteriaceae TaxID=543 RepID=SIFA_SALTY  ali  19  1MPITIGNGFLKSEILTNS------PRNTKEAWWKVLWEKIKDFFFSTGKAKADRCLHEMLFAERAPTRERLT---------EIFFELKELACASQRDRFQVHNHENDATIILRIMDQNEENELLRITQNT---DTFSCEVMGNLYFLMKDRPDILKSHPQMTAMIKRRYSEIVDYP............................................................................................................................................... 159
117 2.000e-15UniRef50_A0A2X5ETF0 Pathogenicity island 2 effector protein SseJ n=2 Tax=Salmonella choleraesuis TaxID=28901 RepID=A0A2X5ETF0_SALET  ali  18  1MPLSVGQG-YFTSSISAERFNVIKESAR--PPELSLWEKIKAYFFTTYHAEALECIFKLYH--------YQELNLTPVQVRGAYIKLRALASQGCKEQFIIESQEQADKLIIKDDNGE-------NILSIEVECHPE...................................................................................................................................................................................... 119
118 2.000e-15UniRef50_A0A1X3RQT9 Uncharacterized protein n=3 Tax=Lonsdalea iberica TaxID=1082703 RepID=A0A1X3RQT9_9GAMM  ali  21  1.................................MTLWEQIKAFFCSTHQAEALDDLFKLCHPQPEVTRNEIE---------NVFHRLKELAAPGCKSYFHIENDEVNQNTTYRITDSSGANLLSVFYGTVTVK.......................................................................................................................................................................................... 91
119 2.000e-15UniRef50_B4ETU9 Uncharacterized protein n=43 Tax=Proteus TaxID=210425 RepID=B4ETU9_PROMH  ali  18  2MSVKINHN-----DISSLQILRISQGEK-TKDVMSLWDKIKDWFQSNKREKALKIV-------ENIVVEEKFDDKNNFKMLYHVLMLKTMASDAYKERIKINTNDNDKNITISIDNYNISITDIDNEQLNKMSTIINAFNRHSLIFSNEIALKCLYEKLDKNELNDQIFAELYIELDNKIRSGEIDLKLNKSNFNQ........................................................................................................................... 184
120 3.000e-15UniRef50_A0A239SC20 Uncharacterized protein n=2 Tax=Pandoraea sputorum TaxID=93222 RepID=A0A239SC20_9BURK  ali  19  10...PLPRSGHVACTSSEEAIQTCRDAESEYAL-ISIWGQVKDFFRGTHKEVAQRALFRLAHP------------KTMDEQVAAFAELLRYAAPEDMHRLHWHLS-SHEVIGFQVGDDVVDYMKHTTWMDFEDSCHLLLSLRFDGHHVLT.......................................................................................................................................................................... 148
121 3.000e-15UniRef50_A0A1S0ZVJ5 SET domain-containing protein-lysine N-methyltransferase n=42 Tax=Salmonella TaxID=590 RepID=A0A1S0ZVJ5_SALCE  ali  14  16.........................SSAPCPDFSGMWNSIRDWFSLPVQDEAALCFHVFYQPDEGTSLPD---------RLKHFLRLKALASPGRQDNFTAERILGTGETICMIASGK-SSDLPSVTLHLSDQEWHTAQPQEAVAPLAEATESPGRGPTGPPITRTQIQTWLDLPQEAKSD.......................................................................................................................................... 161
122 3.000e-15UniRef50_C4K563 Uncharacterized protein n=2 Tax=Candidatus Hamiltonella defensa TaxID=138072 RepID=C4K563_HAMD5  ali  22  1MATEIRLGALLNRAINDYDISKIQSATNK-SDVESLWGKITDWFCGTRKEEAKKALFDVIHND------------NPDRKIECFNQLRDMVSPAYKDKFTYKITEVNDN-LFTVNLLITDILSIENLST.............................................................................................................................................................................................. 116
123 4.000e-15UniRef50_UPI000BFF9853 hypothetical protein n=1 Tax=Proteus alimentorum TaxID=1973495 RepID=UPI000BFF9853  ali  16  2MSVKIDRN-----DISTSQILKISQG-KKTKDVMSLWAKIKDWFQSNKREKALKII-------ENIVSKEQIDDKNHFEMAYHVLMLKSMASDAYKERIKITIDDNNKDITILIDDYNIFMKDIDNKQLNKISTIINVFNRHSSVFSNETALKCLYEKLEQNESKSNDLLFAELYLELDKKISSGEIDLELNKSNFN.......................................................................................................................... 190
124 5.000e-15UniRef50_UPI00098F54D4 hypothetical protein n=1 Tax=Salmonella choleraesuis TaxID=28901 RepID=UPI00098F54D4  ali  13  16.........................SSAPCPDFSGMWNSIRDWFSLPVQDEAALCFHVFYQPDEGTSLPD---------RLKHFLRLKALASPGRQGNFTAERILGTGETICMIASGK-SSDLPSVTLHLSDQEWHTAQPQEAVAPLAEATESPGRGPTGPPITRTQIQTWLDLPQEAKSD.......................................................................................................................................... 161
125 5.000e-15UniRef50_A0A261SPZ6 Uncharacterized protein n=2 Tax=Bordetella genomosp. 1 TaxID=1395607 RepID=A0A261SPZ6_9BORD  ali  16  1MSPTVNFNG---VTLNASRLDTIANAATDQAQRMGVFDSIKDLFRGGVKKEAIKQAFEALHPPARDDYATPAAHE---NLLLHYGVLQQALRPEHAGACQLQVAADPWSYRIEVDGQPLASAHDGDGYTLAAFQDHALLTGLAQHLHQQLGADVAPMTTLLAEQFRES....................................................................................................................................................... 170
126 5.000e-15UniRef50_G2GWI6 SopD n=1 Tax=Candidatus Regiella insecticola 5.15 TaxID=1005043 RepID=G2GWI6_9ENTR  ali  18  1MTISLNLAS-SVFVCSNARLVRMIEGDPKRAMHMGFLDSFLDIFRSESKREKVNELYQKLHN--NDSDPTLSCRNYSVNKLITFSKIRDLADFNKQDQFTVLVQDG--KMNFLIYGFSIYHQSISNFASRFIQCKCTMREKEQLEILLKADKELAASKIQNTFRAHKIILEGKKKKAIRKGKEFAITKYKNKEGIKRAYYFHVNNEYPVV............................................................................................................. 210
127 7.000e-15UniRef50_C5BBF9 Uncharacterized protein n=16 Tax=Proteobacteria TaxID=1224 RepID=C5BBF9_EDWI9  ali  17  1MKVNIGT---TPLQLSNERVTKIMRGDKETATHRGLWARFKDSFNTEKRQDALNGLFDLVTDGQEGVSSYM-----------IFQKLSGLTAPHHRPLFTIAIEPEQYKISYCISGHPVKSEILS--SEKKALLLTQLGLQHDKEPVFSLEGYRKEISDSQLAQLTDDAGGVHKRFEPKTGVLQARDQTGCADFDCEGRVQGYADDNAELQQYI......................................................................................................... 207
128 8.000e-15UniRef50_A0A1E3LDB8 Uncharacterized protein n=1 Tax=Pandoraea sp. ISTKB TaxID=1586708 RepID=A0A1E3LDB8_9BURK  ali  17  1MSLPIALEGHFTRSLSNATIQRCANATSKKDLK-NVWSEIKDLVLGTHKCAAEAALYDLSH------------AKTTREQLDAFNALTYYVEPGDRHKLAWKLDVSEFQG-FQIGEHRFPVPDDARDMTTSASCRLLNTLHLNDHHVLLSSPQFGLDLGPLSNIPTDN....................................................................................................................................................... 163
129 9.000e-15UniRef50_A0A0C5K2A7 Uncharacterized protein n=1 Tax=Pandoraea vervacti TaxID=656178 RepID=A0A0C5K2A7_9BURK  ali  17  8....ISPNGNHTRSLSDETIEKCMFAANEKSLD-SLWSRVKDYFLGTHKSDVKHAIYTLANATE------------FSDQAKAFNVVVSCIDPGDLHRVSWMLDANK-VVGFQIGENHFPATSDTQDFMKDV----MPLNLDAMCRLLRTIRVGEFQALATPEHFGLNIDQVTSSPKSDEEMQARDAEMRGLPALRDTLQV--IGLHRETPEDVADKLKE................................................................................................... 206
130 1.000e-14UniRef50_UPI000D692D9C hypothetical protein n=1 Tax=Proteus genomosp. 6 TaxID=1311820 RepID=UPI000D692D9C  ali  17  1....MNSITIGNSKLTSAQINSVLSGEKVNK-VMTIWDKIKDFFHISDKKQVMTLLYDVYYNPK----------VSFLDKIGKFQELRNLSLSDYKDTFNIKIDNNYFEINFIQDGTHIFEQNENIINNQSIKSLFNQLPQDDINHIVSIVVDKVDKINKNTEEKIELIRSSLSLLLNDDNYRDNELDSLKKGKSKLNEVASKKNCSGMTKKYVMDKIWEIIKENSNEEYNDSYTSLLLNNIFNDKFYSTYNIIHSY.............................................................. 254
131 1.000e-14UniRef50_A0A0U1HTD2 Secreted effector protein sseI n=4 Tax=Yersinia rohdei TaxID=29485 RepID=A0A0U1HTD2_YERRO  ali  20  1MKIPL-VSTLFSTHISKLTIENM--AKSKDLPYMSIWEKIKDFFLSSHKAEALGHLHSICHLPYDATNKNNPNDVIKIAE-GHFEELKKLMPADYECSF............................................................................................................................................................................................................................ 95
132 1.000e-14UniRef50_G5LNN5 Secreted effector J SseJ n=1 Tax=Salmonella enterica subsp. enterica serovar Alachua str. R6-377 TaxID=913241 RepID=G5LNN5_SALET  ali  18  1MPLSVGQG-YFTSSISAERFNVIKESAR--PPELSLWEKIKAYFFTTYYAEALECIFKLYH--------YQELNLTPVQVRGAYIKLRALASQGCKEQFIIESQEHADKLIIKDDNGE-------NILSIEVECHPE...................................................................................................................................................................................... 119
133 2.000e-14UniRef50_A0A0E3YDZ3 Uncharacterized protein n=1 Tax=Pandoraea oxalativorans TaxID=573737 RepID=A0A0E3YDZ3_9BURK  ali  15  13.....QLTGHFASTLSEETIQKCRDAESEKA-RMSFWGQVGDFFPGAHKEAAQRALFRLADP------------KTMDEQVAAFAELLRYVAREDMHRLHWHIS-SHEVIGFQVGDDVVDYMKHSTWMDFEDSCHLLLSLRLDGHHVLT.......................................................................................................................................................................... 149
134 2.000e-14UniRef50_UPI0002BA0FA2 SET domain-containing protein-lysine N-methyltransferase n=2 Tax=Salmonella choleraesuis TaxID=28901 RepID=UPI0002BA0FA2  ali  14  16.........................SSAPSPDVSERWNSIRDWFSLPVQDEAAQCFRAFYQPDEAMTPSD---------RLKNFLKLKALASPGRQDNFTTERILGTGETICMIASGKN-SDFPSFTLHLSDQEWHMTQSQEETADCTVLPLNAGNPAATTAEESAGASRKGSRITNTQIQ---AWRDLSPEAKREAGGWKTW.................................................................................................................... 180
135 2.000e-14UniRef50_V6MJX1 Uncharacterized protein n=1 Tax=Proteus hauseri ZMd44 TaxID=1312367 RepID=V6MJX1_PROHU  ali  15  1MNVKINKN-----DISTSQILRISQG-KEIKDVMSLWAKIKDWFQSNKREKALKII-------ENIVSKAQSDDKNHFKMAYHILMLKAMSSDAYKERIKISIDDNNKNITILIDDYNIFIKDVDNEQLSKISKIINIFNRHSSVFSNEIALKCLYEKLDQNESESKDNDRIFAELELDKKISSGEIDLALNKSNFN.......................................................................................................................... 191
136 2.000e-14UniRef50_UPI00031817F5 hypothetical protein n=1 Tax=Candidatus Hamiltonella defensa TaxID=138072 RepID=UPI00031817F5  ali  15  1MSLSIQINPLFNTSLRHKNINPFIKTCTKEKPNPVQIEN----FPGIHTPQAIEKMNELTNLNQASDTE------SALKKVAAFYELKEMVCPAYQHKFQAQKEDQTYTFSFSIEGIIDTSTFVCGQGGKKRASIKKAKL-----------NQHDLKYNDIPEKPQRTFFANQKR................................................................................................................................................ 157
137 3.000e-14UniRef50_A0A0H5GFG7 Secreted protein sopD n=3 Tax=Yersinia enterocolitica TaxID=630 RepID=A0A0H5GFG7_YEREN  ali  26  1..MKITSPSYKEVSINNYR-NLLKYTDKERSTALNLWEKFCDLFRSNKKKDVINTLYNLITPPKN-----ENLNSDLKFKLHRFEQLKCLANPSHRDQFKIHVHSQETN-------------KNKYTLSIKNNDVYSFIAENNWEPLSQIPFAQLPLIENYSSIVKNYAKDHQDSFNKRYPTTKITAKL.................................................................................................................................. 168
138 5.000e-14UniRef50_Q9FD10 Secreted effector protein SseJ n=320 Tax=Enterobacterales TaxID=91347 RepID=SSEJ_SALTY  ali  17  1MPLSVGQG-YFTSSISSEKFNAIKESAR--LPELSLWEKIKAYFFTTHHAEALECIFNLYH--------HQELNLTPVQVRGAYIKLRALASQGCKEQFIIESQEHADKLIIKDDNGE-------NILSIEVECHPE...................................................................................................................................................................................... 119
139 9.000e-14UniRef50_A0A2U8I3T8 Uncharacterized protein n=2 Tax=Candidatus Fukatsuia symbiotica TaxID=1878942 RepID=A0A2U8I3T8_9GAMM  ali  20  1MPILVSFKEYSHIHLTSERVARLIRGGKKEAMYLGPLDRTKEIFRKTKKRGMLLALHEFLHQLQQKDKTDLDLNHNPYSKVNSFNRFVELLPPDNQPLCKIKHDINANSSEFIINNEML--CVVHNLTTDYLLCCEERLNCDEKALSSSINKDYNTTIESKKNNNNQQLFADICRASYYIDGNRMLIDDQLTCCQKKKNTENFLKKLTPEQRIAVDILCTQTLSAHIIELLDENSETHI................................................................................ 245
140 9.000e-14UniRef50_A0A2X6BDC4 Salmonella outer protein D n=1 Tax=Escherichia coli TaxID=562 RepID=A0A2X6BDC4_ECOLX  ali  26  1MSINLTINSTNSTTISESRAQRFLSGNKEVALYMGLWDKIADFFRAEKKADAMALAWEFLFPVSDDTT---TTSDPFKETINVFNRMKAISHPEAFDLGKVRTSP...................................................................................................................................................................................................................... 106
141 1.000e-13UniRef50_UPI000D6E2A43 hypothetical protein n=1 Tax=Proteus sp. CA142267 TaxID=2050965 RepID=UPI000D6E2A43  ali  14  1MNMKINKN-----DISTSQILRISQG-KKIKDVMSLWDKIKDWFQSNKREKALKIV-------ENIVSKEQSNDKNYFKMAYDFLMLKAMSSDAYKEKIGIRIDDNKKNITILIDDYNIFIKDVDDKQISKILKIINIFNRHSSIFSNEVALKCLYEKLEQNERESKNDEFAELYLELDKKISSGEIDLELNKINFNQVDFYAISRLINVNETIDKNDPNLDIKKALRN.......................................................................................... 221
142 2.000e-13UniRef50_A0A1D7XTK9 Uncharacterized protein n=3 Tax=Flavobacteriaceae TaxID=49546 RepID=A0A1D7XTK9_9FLAO  ali  13  112..........................................YFGPSKKKQNKFSLFEQVLLDVNATPEQLSISGIYTDKINDWARLFHQISPEAQQLAKVIPNDVENFKSLVYTDFEQFSKNIQAIDSTAIASEFSKSLFGTTQEIGSMETSKGIAIALHSIDISASRELLLGFQEKAKIFRSVPIDSIFKNSFGKLLPKLASTRYTILDHYLVFSDQEKILEDVISDY-TNKNSLNSSKAFQNTIETLSDEASFQKTLDTKDLATTLNELLDTNFSEDLNAYKNSVVQIDDEVVHLNAEIVNFRPATKQNSVREVF. 394
143 2.000e-13UniRef50_A0A1J6Y6Z9 SET domain-containing protein-lysine N-methyltransferase n=50 Tax=Salmonella TaxID=590 RepID=A0A1J6Y6Z9_SALHO  ali  14  14.......................TDSSMPSPDLSGRWNSIRDWFSLPVQDEAAQCFRVFYQPDEATSPSD---------RLKNFLKLKALASPGRQDNFATERILGTGETICMIASGKN-SDFPPVTLHLSDQEWHMTQSQEETADCTVLPLSAGNPAATTAEESAGASRKGSRITNTQIQ---AWRDLSPEAKRKAGGWKIW.................................................................................................................... 180
144 2.000e-13UniRef50_A0A1Y6J0J2 Inositol polyphosphate kinase n=1 Tax=Vibrio mangrovi TaxID=474394 RepID=A0A1Y6J0J2_9VIBR  ali  17  1MSIS-TVNHAKPTGIRPEDVTR---NNKQHSIEDIAWQKIRHSFCSTEKKAAVACLHDIMYNTENISVNG---------KLIAFERLQRMAGEGHKSRFQSEIDPHKHQLTLRLDDMVILSYKKHGEPSFKIAAGHKLDFSYDQGALYKIVSDTELKYNVIPEGKEYHSSGLSKAETIPEGLRTPK..................................................................................................................................... 180
145 2.000e-13UniRef50_A0A0A7A1Q2 Uncharacterized protein n=2 Tax=Shigella TaxID=620 RepID=A0A0A7A1Q2_SHIDY  ali  21  10....LSVGNEEKYSITHKDITNLIAGDRQSFLKLTLWEFILDLFSMYHIKEAKERIVEFVTKTE--------------DKVKRFEIIKSLAIPEEKWRF-------STTTEFTVDENKDIIVSRVFKININSKDNHNNAKENTMRSVLSEERNYNSYKHDIHFDEKAFQSGILKMQFPNDNEKLSVYLKNKSP.............................................................................................................................. 177
146 3.000e-13UniRef50_UPI0009AAAC08 SET domain-containing protein-lysine N-methyltransferase n=4 Tax=Salmonella TaxID=590 RepID=UPI0009AAAC08  ali  13  16.........................SSEPLPDFSGMWNSIRDWFTLPAQDEAAQCFRVFYQPDEATSSPD---------RLKCFLKLKALASPGRQDNFTAERILGTDETICMIA-------SGKNSDFPPVTLHLNDQEWHSIRHQEEAVDSPLSSESDNNQTEERDAAPLESFPITRAQIKA-WHDLSPEAKCEAGGWKVW.................................................................................................................... 182
147 5.000e-13UniRef50_A0A0G4Q9L1 Uncharacterized protein n=1 Tax=Proteus vulgaris TaxID=585 RepID=A0A0G4Q9L1_PROVU  ali  15  1MNVRINKN-----DISTSQILRISQG-KKIKDVMSLWDKIKDWFQSNKREKALKI-------TENIVSKTKSDDKNYFNMVYHVLTLKAMSSDAYKERIKISIADNHKNLTILIDNYNIFIKDVDTEQISKISKIINIFNRHLSVFSNEIALKCLYEKLDKNERESKIFAELYLELDNKISSGEIDLELNKSNFNQ........................................................................................................................... 190
148 6.000e-13UniRef50_A0A2J9SJQ0 Uncharacterized protein n=1 Tax=Yersinia enterocolitica TaxID=630 RepID=A0A2J9SJQ0_YEREN  ali  18  6..MQLNVGTR-SVNMDENRLNQVLKANSAREAYAGLWAKFCDFFCLGNDRKAIKSLFESITNAQSGT--------DPLYQLERFQRLSSFANAEHANEFGATVSQSPWEYSLLIGNAPIF----------ESGPITESAEKHKPFLLAQAVWGVKQDMAKFNALSIGTEGYVQGQIQCISDIESPV------------------GSLEEEGTSRVY-LQMHLYDP--RFCKENFTEIRKPRLFDAIFHCD..................................................................... 226
149 6.000e-13UniRef50_UPI0009A95926 SET domain-containing protein-lysine N-methyltransferase n=3 Tax=Salmonella choleraesuis TaxID=28901 RepID=UPI0009A95926  ali  13  16.........................SSEPLPDFSGMWNSIRDWFTLPAQDEAAQCFRVFYQPDEATSSPD---------RLKCFLKLKALASPGRQDNFTAERILGTGETICMIA-------SGKNSDFPPVTLHLNDQEWHSIRHQEEAVDSPLSSESDNNQTEERDAAPLESFPITRAQIKA-WHDLSPEAKCEAGGWKVW.................................................................................................................... 182
150 7.000e-13UniRef50_V1GUS0 Uncharacterized protein n=20 Tax=Salmonella choleraesuis TaxID=28901 RepID=V1GUS0_SALCE  ali  13  16.........................SSEPLPDFSGMWNSIRDWFTLPAQDEAAQCFRVFYQPDEATSSPD---------RLKCFLKLKALASPGRQDNFTAERILGTGETICMIA-------SGKNSDFPPVTLHLNDQEWHSIRHQEEAVDSPLSSESDNNQTEERDAAPLESFPITRAQIKA-WHDLSPEAKCEAGGWKVW.................................................................................................................... 182
151 8.000e-13UniRef50_A0A1U7FK42 SET domain-containing protein-lysine N-methyltransferase n=100 Tax=Salmonella TaxID=590 RepID=A0A1U7FK42_SALET  ali  13  16.........................GSTSAPDFSGMWSSIRDWFALSAQDEAAQCFRAFYQPDEGMSPPD---------RLKHFLRLKALASPGRQANFTAERILGTGETICMIA-------SGKNSDFPSVTLHLSDQEWHSTQHQKEAVDSPRSSVSDDNQTA.......................................................................................................................................................... 139
152 8.000e-13UniRef50_A0A0J6M2U6 Uncharacterized protein n=3 Tax=Enterobacterales TaxID=91347 RepID=A0A0J6M2U6_9ENTR  ali  23  1MTIMVGKGC-FPVVIDDSAILDTVKNDAPVAL--SIWQKIKEFFCRTNHTEAMLCLHKLCHPRPEVTQSDTKA---------LFLNLRELASPGFEDFFLVDESDG..................................................................................................................................................................................................................... 94
153 8.000e-13UniRef50_A0A1D3DL07 Uncharacterized protein n=3 Tax=Enterobacterales TaxID=91347 RepID=A0A1D3DL07_9ENTR  ali  14  4..........SNANISQEKINKL--ADNSPSDVMTIWEKIKDWFGFSQEKKVLTLIHNIYFSQETTV----------LEKNRDFFHLKKLAGEQYRNNFQYELNNNNIDYCIDFNGEIIKSSSDVTPLVNAIKNELNLNLKNEELGEFINNSYKLSTLSNDDNDFGEKFSAFRKILTECLNDEDSSLDNQRFDSNAFDAKESFNDKYENSKKYLVNIDTEQLVKNIYDSTESSYEKLREQVENDISRYDLKFNGEKISDIAL......................................................... 251
154 1.000e-12UniRef50_A0A2X5ZVJ5 Salmonella outer protein D 2 n=1 Tax=Escherichia coli TaxID=562 RepID=A0A2X5ZVJ5_ECOLX  ali  29  8..VSVADSRITSFHLSENRLKRIMSGDKEQALYMGFWDRTAEFFRSEKKADVLAQLWTMMYPTDNSSAPVSKLDK-FKVQMDAFQSLVSMVDEEAVKKFTANSDVNTDNINFT.............................................................................................................................................................................................................. 126
155 2.000e-12UniRef50_A0A1J7C8D5 Uncharacterized protein n=1 Tax=Sodalis sp. TME1 TaxID=1912097 RepID=A0A1J7C8D5_9GAMM  ali  20  1.................................MGLIDRLYDFFRQGGKRAAITRLYRQLSQPGAREPHDL----TPTTMVARFMQLRAYANSEYRKLFQLSLEQAPWSYLMQIGDYQIYQ---------SPPLDYRLDNHFAEVCTMKVCQSLDDVLAEIREQLERYIQSQIESMAGAAK.......................................................................................................................................... 143
156 2.000e-12UniRef50_UPI000C7C3E7A hypothetical protein n=1 Tax=Proteus mirabilis TaxID=584 RepID=UPI000C7C3E7A  ali  17  1....MNSITIGNSKLTSAQVDRVLSGEKVNK-VMTIWDKIKDFFHISDKKQVMTLFYDVYYNPK----------VSFLDKIDKFQELRNLSLNDYKDTFNIKIDDN--VFYFEIGDIQDEEQNENIINNQSIKSLFNQSPQNDIDNIVSIVVDKIDRINKMTEEKIELIRSTLSLLLNDDNYRDKELDSFKKGKSKLNEIASKKNCSGMTEKYVMD----KIWKIIKENGNEKYNDYYTSLLIDNIFNDRFYSTYNIIYSYL......................................................... 259
157 2.000e-12UniRef50_B4ETY6 Uncharacterized protein n=25 Tax=Proteus TaxID=210425 RepID=B4ETY6_PROMH  ali  19  10.............NISTSQINKLSHASKAR-DAMSIWEKIKDWFNHGQKEHVLNLLYHTYFNPKN----------SIFDKVDSFAELYSMTGAQYKDNFHLYLKDGYDKMKFVIKNVYNGEVSLDNLINPSIKEDIENIRSYIKKRLHEIPNEANYDINQYNVYLSQIKNDLL.................................................................................................................................................. 169
158 5.000e-12UniRef50_A0A2X4WNF9 SopD-like protein n=5 Tax=Salmonella choleraesuis TaxID=28901 RepID=A0A2X4WNF9_SALDZ  ali  83  1MPVTLSFGNHHNYEINASRLAHLMSSDKQEALYMGVWDRFKDNFRTQKKQEAI.......................................................................................................................................................................................................................................................................... 53
159 7.000e-12UniRef50_UPI00071DA024 hypothetical protein n=1 Tax=Salmonella choleraesuis TaxID=28901 RepID=UPI00071DA024  ali  10  2........................................................................................................................................................NGKTYEFWKQNVVQIIFTCVDTQQTGDAPLENREYESIWTAWINDAPPEEIEKRSKAV-DWMRECSKYHCL-------ILDLSDLRLTTLPDHLHEHITFL--AVINNRLTKLPDTLPGGYRQITRI........................................ 120
160 8.000e-12UniRef50_UPI000666E397 hypothetical protein n=2 Tax=Proteus mirabilis TaxID=584 RepID=UPI000666E397  ali  19  10.............NISTSQINKLSHASKAR-DAMSIWEKIKDWFNHGQKEHVLKLLYHTYFNPKN----------SIFDKVDCFAELYSMTGEQYKDNFHLYLKDDYDKMKFVIKNVYNGEVSLDNLINPSIKEDIENIRSYIKKRLHEIPNEANYDINQYNVYLSQIKNDLL.................................................................................................................................................. 169
161 8.000e-12UniRef50_A0A2U8I8E8 Uncharacterized protein n=1 Tax=Candidatus Fukatsuia symbiotica TaxID=1878942 RepID=A0A2U8I8E8_9GAMM  ali  17  17MEVYLSSRWGGEKVISSDVVEKIKN---DESVTMGIWEKIKDWFFDTHRADAYKHLRTFLHATSTT------------EKIHAFLSLKSLAPEGRRSFFKIEIFKIEKSAGLNSFDLSIETKDNADSVKQTISFSNYSESSSFNKSKFRENLFKEDS----PDLLGEYITCISVEEKIKLAEEYILYSLKNDD.............................................................................................................................. 190
162 9.000e-12UniRef50_A0A2X5CVU7 Phage-like protein n=2 Tax=Salmonella choleraesuis TaxID=28901 RepID=A0A2X5CVU7_SALCE  ali  18  16.........................SSVPSSDFSGMWNSIRDWFSLPAQDEAAECFRAFYQPDEGTSSPD---------RLKYFLKLKALASPGRQANFTAERILGTGETICMIAS........................................................................................................................................................................................................... 97
163 9.000e-12UniRef50_UPI00033427F6 pathogenicity island 1 protein SopD2 n=1 Tax=Yersinia enterocolitica TaxID=630 RepID=UPI00033427F6  ali  29  1..MKITSPSYKEVSINNYR-NLLKYTDKERSTALNLWEKFCDLFRSNKKKDVINTLYNLITPPKN-----ENLNSDLKFKLHRFEQLKCLANPSHRDQFKIHVHSNKNKYTLSIKKTMMYI...................................................................................................................................................................................................... 116
164 9.000e-12UniRef50_UPI0004271989 hypothetical protein n=1 Tax=Ottowia thiooxydans TaxID=219182 RepID=UPI0004271989  ali  16  1MIGDISAKHSFLGNLNNQDLANVRIAADKGLDRLGIFERIFDWVFHTDRMQCKQCLLTFCSQ-----------KSTGVEKFAAFIRLQELTKPTYKDRFNFD-SKDPDNIKLSIDVDLPFFNHLSFTASRDSLLAEQISKWSPQLNLEELTSLLSELYSSTTTVAEKYFAFSELKSNIGDEFASAFSEDIFPD.............................................................................................................................. 185
165 1.000e-11UniRef50_A0A0H3X3G2 Uncharacterized protein n=1 Tax=Pandoraea faecigallinarum TaxID=656179 RepID=A0A0H3X3G2_9BURK  ali  16  29.PILLRGNWLADGQISETEVDHAADATDANPIYKSFWDHVKDMFCTTRRIEAKGYLNDMMAQ-----------GKSDQKRIESLLNLFGMASSAQLSRFNAYCDPTDHRYIISIDQSPISIRVLRRVL-------LEQAHYDPEYCRLSLAEHLKELGAATGFDPKDATTTLTQHLAEQRAPVSQVWDTME-----GWFLKCEAPRAKE---YLEDFLSLSTCATTKRHCFTKMREMALGQYKSHFRRQDTY................................................................... 258
166 1.000e-11UniRef50_A0A2J0QKZ0 Uncharacterized protein (Fragment) n=567 Tax=root TaxID=1 RepID=A0A2J0QKZ0_ECOLX  ali  23  1....MSVGNEEKYSITHKDITNLIAGDRQSFLKLTLWEFILDLFPMYHIKEAKETIVEFVTKTE--------------DKVKRFERIKSLAIPEEKWRF-------STTTEFTVDENKDIIVSRVFKININSKDNHNNAEENTMRSVLS.......................................................................................................................................................................... 124
167 1.000e-11UniRef50_UPI0002FE827E hypothetical protein n=1 Tax=Sodalis glossinidius TaxID=63612 RepID=UPI0002FE827E  ali  37  1MSLSLKVIGQHSLAINPSRIGRLLSPDKDYATHLGIWDRIKNFFRPYNKSDALDCLYRLIHSDNLPEPRAVKANP.................................................................................................................................................................................................................................................... 76
168 2.000e-11UniRef50_Q2NVS5 Uncharacterized protein n=3 Tax=Sodalis glossinidius TaxID=63612 RepID=Q2NVS5_SODGM  ali  21  39MNIPLGTLLNRGFALNSRRIARIIHARMEDASHMELVDRLFDKFRQGGKRTAIARLYRQISQPGAGEPRDL----SPVTMVARFMQLRAFADGEYRGVFQLALLYDRWNRHCLICYKSVIIGSINRRLWITVW.......................................................................................................................................................................................... 174
169 2.000e-11UniRef50_C5B790 Pentapeptide repeat family protein n=3 Tax=Edwardsiella ictaluri TaxID=67780 RepID=C5B790_EDWI9  ali  14  2..LPLPHSGLFSRNLSRNDISLVKNATHIGSRFNRIVNKVLDWCCNTKKTEAMEQLFIVMNQDHNQ---------SNKARCEAFDQLQELVGSAHSDRFTKKYDVVDNCIKFNIDFITLTKDDFFEGLNLSGADLTDISLQNGKLGYVDLSGAKLDHANLTGAQLS-FANLSGATLDHADLTGAQLSFAKLSGASLNNATLNQADMDNADLSN--ATLNQAVLKNVNLSSAI....................................................................................... 228
170 3.000e-11UniRef50_UPI0009A98017 SET domain-containing protein-lysine N-methyltransferase n=6 Tax=Salmonella choleraesuis TaxID=28901 RepID=UPI0009A98017  ali  12  16.........................SSVPSPDFSGMWNSIRDWFSLPAQDEAAQCLRIFYQPDEGTSSPD---------RLKCFLKLKALASPGRQANFTAERILGTGETICMIASGKN-SDFPPVTLHLNDQEWPTAQPQESA-----------------PTTETRGGPGSKGIPITSAQM-QTWLDLSPEAKRSAGGWRKWAQAQGVTLGSASLCLTNTGLTPYGRERLHPLKERGMPIAVDQI......................................................................... 208
171 4.000e-11UniRef50_A0A0F8EVZ5 Uncharacterized protein (Fragment) n=1 Tax=Methanosarcina mazei TaxID=2209 RepID=A0A0F8EVZ5_METMZ  ali  37  1.......................MSGDREKALYMGLWDRFRDLFREQKKADVLEAFWKLMHPEENDIQKQKTVSEEMKEALDAFHKLMDLADESQLGLFDICVTTKRSRRYLD.............................................................................................................................................................................................................. 91
172 1.000e-10UniRef50_S2KFH3 Uncharacterized protein n=2 Tax=Pseudomonas plecoglossicida TaxID=70775 RepID=S2KFH3_9PSED  ali  25  20..............FSAVDIERSKNATSEQATEMTCWESIKDWFGGGVQRRALTELYTFFHGVSD-------------EKEQAFDFLKGNCEKKYAGNFEEKIDIATQSRRLIIN............................................................................................................................................................................................................ 108
173 1.000e-10UniRef50_A0A2J9SJM0 DUF1127 domain-containing protein n=1 Tax=Yersinia enterocolitica TaxID=630 RepID=A0A2J9SJM0_YEREN  ali  21  1MRIKLKIG-RKIFTINNSDVMKILDQNREDAIKVGRSDKFKDLFREVKRNQSLSFIYDVL--RKNNELIDKNPQNIELTTLILFRRLKSLTINGKQKLFKEEYSIDNKQLKLSVGKKIIKTLKVGEQKENKE-EEYSVLTVDDINPRANIWSRLWLKANEY.............................................................................................................................................................. 157
174 1.000e-10UniRef50_A0A2X5CVG3 Phage-like protein n=2 Tax=Salmonella choleraesuis TaxID=28901 RepID=A0A2X5CVG3_SALCE  ali  12  20.............................SPDFSGMWNSIRDWFSLPAQDEAAQCFRIFYQPDEGTSSP---------ERLKCFLKLKALASPGRQANFTAERICGTGETICMIASGKN-SDLPPVTLHLNDQEWPAAQPQESA-----------------PTTETRGGPGSKGIPITSAQM-QTWLDLSPEAKRSAGGWRKWAQAQGVTLGSASLCLTNTGLTPYGRERLHPLKERGMPIAVDQI......................................................................... 208
175 2.000e-10UniRef50_S0V3V2 Uncharacterized protein n=11 Tax=Enterobacteriaceae TaxID=543 RepID=S0V3V2_ECOLX  ali  17  37..IGLSVDDVGKYSVTHKDITNILAGDSQSFLKRSLWEFILDLFPMYHIKEAKQAIIDFVSETG--------------DKADIFNKIKSLADQDQQWRF-------NATTEFIVDENKDIIVSRVFKININAQDHHIDAEKKTMHSLFQ.......................................................................................................................................................................... 162
176 2.000e-10UniRef50_A0A261TQY2 Uncharacterized protein n=2 Tax=Bordetella genomosp. 5 TaxID=1395608 RepID=A0A261TQY2_9BORD  ali  18  2.............NLSQSRMDHIAQAETGEAQRMGVFDSIKDFFRGGAKKEAIKQAFDALHTPPQGAAGDLAAHE---DLLVHLSNLQQALEPAHTALARLDVAENPWSYSISVNDKPL........................................................................................................................................................................................................ 109
177 2.000e-10UniRef50_UPI0009B7BCE0 hypothetical protein n=1 Tax=Rhizobium meliloti TaxID=382 RepID=UPI0009B7BCE0  ali  11  104..................................................................................................................GLSTLPAEFPAGLQRLNVDCNQLTKLPGEFPVELQTLNVRYNRLTSLPETLPAGLQTIEASYNRLTRLPDVLSNAL---------------RWLGVGENQLTSLPDNLPAGLQTLNADAN---QLTNIPASLPAGLQTLNAD--GNRLTSLPDNLPEG-LQTLNASGNQLTNLPAKLPAGLQTLGAADNRLTGLPKD........ 279
178 2.000e-10UniRef50_UPI000BAED4A5 hypothetical protein n=3 Tax=Escherichia coli TaxID=562 RepID=UPI000BAED4A5  ali  22  10MPDA---GRYCKLSLSEKRMRGLINGDRDSALNMGLIDKICDFFRPEKKADVLAQIWTMMNPEDSQVQP-VTIRDKFKVQLEAFQTLVSMVDKDALDIVNNGVNPLSLTC................................................................................................................................................................................................................. 115
179 2.000e-10UniRef50_A0A0V2EZX4 Pathogenicity island 2 effector protein SseJ (Fragment) n=1 Tax=Salmonella enterica subsp. enterica serovar Newport str. S09097 T  ali  22  1MPLSVGQG-YFTSSISSEKFNAIKESAR--LPELSLWEKIKAYFFTTHHAEALECIFNLYHHQE............................................................................................................................................................................................................................................................... 61
180 2.000e-10UniRef50_A0A2U3Q991 Type III secretion system effector, E3 ubiquitin ligase YopM/NopM family n=2 Tax=Bradyrhizobium TaxID=374 RepID=A0A2U3Q991_9BRAD  ali  15  240........................................................................................................................................NSENTGSRSLDLSSLALTALPAALPPRLLELRARHNALSRLPAMFPPGLQHLLISHNRLTSLPNLPATISELEVADNSLTSLPANLPAG---LEILNANDNRLSSLPRALPSGLTSL--AVSGNQLTDLPESLPSWLIE-LNVSGNQLANLPDPLPSTLQSLNVSGNQLTSLPE......... 408
181 3.000e-10UniRef50_A0A094TKN9 Uncharacterized protein n=6 Tax=Proteus TaxID=210425 RepID=A0A094TKN9_PROVU  ali  16  8...........NTTIDREKIIKLGNTQKPSS-VMSLWERLKDLFGLSNEGKVLPLIKTVYFDQAASVS----------EKNSAFFTLKRIAGDGYKNNFKYSVNDSKITYSIEFIGDPIESDHDPFFEEIKNELSIDLEEYSSDSVIAFINNYIKNDDKNYEEKFIAFRAILMEPRNKGNIFSINDFNKIGSFEEKKEYIEKHSHNYTANLSPTRLIDN-----IYQSVKQGNYEELRSQVEKDISRYKLQYNNKDISDSSLEEKLKNLNKKDVMIIFELLNQ.................................... 271
182 3.000e-10UniRef50_A0A0K3ZMW0 Putative type III effector protein n=4 Tax=Escherichia coli TaxID=562 RepID=A0A0K3ZMW0_ECOLX  ali  20  37......SINKKKYTINSKDIKNILDGKGDLFKKRTLWEFVRDLFPGSHIKEVKGLIYEFVTKVDN--------------KAEVFDKIKSLAKTEQQWRFSTKTD-----FTTNENNEVIVCRSFNLYTGATANDYEKT..................................................................................................................................................................................... 149
183 5.000e-10UniRef50_A0A2K0JHB3 SET domain-containing protein-lysine N-methyltransferase n=27 Tax=Salmonella TaxID=590 RepID=A0A2K0JHB3_SALHO  ali  14  14.......................TDSSIPSPDLSGRWNSIRDWLSLPVQDEAALCFRVFYQPDEAMPPSD---------RLKNFLKLKALASPGRQDNFTTERILGTGETICMIASGKN-SDLPSVTLHLSDQEWHMTQSQE................................................................................................................................................................................. 122
184 8.000e-10UniRef50_A0A2S3YT35 Uncharacterized protein n=5 Tax=Sinorhizobium/Ensifer group TaxID=227292 RepID=A0A2S3YT35_9RHIZ  ali  11  16..................................................................................................................GLSTLPAEFPAGLQRLNVDCNQLTKLPGEFPVELQTLNVRYNRLTSLPETLPAGLQTIEASYNRLTRLPDVLSNTL---------------RWLGVGENQLTSLPDNLPAGLQTLNADAN---QLTNIPASLPAGLQTLNAD--GNRLTSLPDNLPDG-LQTLNASGNQLTNLPAKLPAGLQTLGAAANRLTGLPKD........ 191
185 1.000e-09UniRef50_UPI000577CFD1 E3 ubiquitin--protein ligase n=1 Tax=Bradyrhizobium japonicum TaxID=375 RepID=UPI000577CFD1  ali  15  10.......................................................................................................................................................................................................................................LNASDNRLTSLPDALPSRLTSL--AVSGNQLTDLPDYLPSGLIE-LDVSCNQLADLPAPLPSTLQSLNLSGNRLTSLPED........ 86
186 1.000e-09UniRef50_A0A2X2IX76 SopD-like protein n=2 Tax=Salmonella choleraesuis TaxID=28901 RepID=A0A2X2IX76_SALTI  ali  86  1MPVTLSFGNRHNYEVNTSRLTRLMSPNKEEALYMGVWDRFKDCFRTHKKKRC........................................................................................................................................................................................................................................................................... 52
187 1.000e-09UniRef50_W0HYR7 Uncharacterized protein n=3 Tax=Sodalis TaxID=84565 RepID=W0HYR7_9GAMM  ali  17  1MPIVFSMPNR-HILLSDQKVAQVLNANTQEATRINFVSGIIDWFRGTQKKEIIALFHSL------QESQYGATAMPEYRRLEKFIQLRRLALPEYQSQFQLQIARYDWGYALKVNGQTLFQCDNVIAKSKNGDA......................................................................................................................................................................................... 137
188 2.000e-09UniRef50_A0A2U8I374 Uncharacterized protein n=1 Tax=Candidatus Fukatsuia symbiotica TaxID=1878942 RepID=A0A2U8I374_9GAMM  ali  22  6..FSVGTG-YFPTTV---RIEEIL--NDDRHIYMTLWEKIKEFFFFHGHKEAQECLKKLCHPVHNITLDEVE---------KILFKLKELASPAYKERFCYDFGSTDNLLQMKDNGNDIFSININ.................................................................................................................................................................................................. 114
189 2.000e-09UniRef50_A0A193QKT1 Uncharacterized protein n=1 Tax=Sodalis glossinidius (strain morsitans) TaxID=343509 RepID=A0A193QKT1_SODGM  ali  16  1MSFVIG-NKFFSNTLSTDRIREYAANKHKSPLVMTLWERVKDFFFGGETKNCIRLLNDTCHPPIAST............................................................................................................................................................................................................................................................ 66
190 2.000e-09UniRef50_A0A2A2GZF3 Uncharacterized protein n=1 Tax=Arsenophonus sp. ENCA TaxID=1987579 RepID=A0A2A2GZF3_9GAMM  ali  15  1MDISFSLPKTTSLTISDSKFNQILAANTKIKNVSDFIDSIMDWFKGGVRRQKIEQLFETIQDVKNTDVSNPES-----TRLEKFIQLRKLALPKHYNQFKSRVSHRHIKF................................................................................................................................................................................................................. 110
191 4.000e-09UniRef50_A0A2X5BXP2 Effector protein SifA n=10 Tax=Salmonella choleraesuis TaxID=28901 RepID=A0A2X5BXP2_SALTH  ali  20  1MPITIGNGFLKSEILTNS------PRNTKEAWWKVLWEKIKDFFFSTGKAKADRCLHEMLFAERAPTRERLTE...................................................................................................................................................................................................................................................... 67
192 4.000e-09UniRef50_G5MMN1 Putative secreted protein n=2 Tax=Salmonella enterica I TaxID=59201 RepID=G5MMN1_SALET  ali  39  3...............................................................................................................................................................................................................................................................................GFLKKLNQDYNDYHAKKMFIDVILEKLYLTHERSLHIGKDGCSRNILL 50
193 5.000e-09UniRef50_A0A0D8DCR4 Uncharacterized protein n=1 Tax=Thalassomonas viridans TaxID=137584 RepID=A0A0D8DCR4_9GAMM  ali  23  1MSMTLNNNIYAPLESLNKKVEVPLTNSNKNATQMVFSDTIQNYF---KHSAALRLLDKLIRNNSSTSA--------GTNKHRAFLKLRSLAHPEHQHKFTIATSLNDIRMAFQINNKIIAEVNFSFE................................................................................................................................................................................................ 119
194 5.000e-09UniRef50_UPI00041D8343 hypothetical protein n=1 Tax=Ottowia thiooxydans TaxID=219182 RepID=UPI00041D8343  ali  14  1MTDQIGSSNFSPHSISSRTLDQVKIAQDRGSTFSRAWDAIKDFFSTPYRAEAKRCLFDLYSQ-----------STSDQEKLVSFERLKELSGDGHAHCFDTGISPKRDGGFFKVYDLKIGENLEAFAFHMEGDCVEAEEIISAYAPLISDESKDAFAKCKLYKSPEALFLEESNKLGSIAIPAQILWNICRNNSACAVKVDIVTGIIPEVFKAAMSKIKTKKEENQRELRELIVANSPAPIFIDQKNESRVLLQYVDSNEKLFDVPNFPITENSELYNQSSDLFERDNSMIIAIDNEIWSSHSKETFKPEKS....... 336
195 6.000e-09UniRef50_D2U1H3 Secreted effector protein n=2 Tax=Arsenophonus TaxID=637 RepID=D2U1H3_9GAMM  ali  13  1MSLSIGKNFFIREKISIGDIKEIQKNNS--PIQLTLWEKIKDFFFSTGKEKAYSCIAKL---------NNALTELNSIEAKKHFLTLKDLASEEYKNHFLEYCYHDNYGEKIKV............................................................................................................................................................................................................. 103
196 7.000e-09UniRef50_G5QXY0 Uncharacterized protein (Fragment) n=5 Tax=Enterobacterales TaxID=91347 RepID=G5QXY0_SALSE  ali  14  3...................................................................................................................................................................................................................QEMRDCLNNGN-------PVLNVGASGLTTLPDRLPPHITTLVIPDNN--LTSLPELPEG--LRELEVSGNLQLTSLPSLPQGLQKLWA................... 80
197 1.000e-08UniRef50_A0A2R3QFJ9 Uncharacterized protein n=2 Tax=Comamonadaceae TaxID=80864 RepID=A0A2R3QFJ9_9BURK  ali  21  1MDISVNLGPSQSLALSESRIKNFLAGDNAAAQKMGWFDSVRDLFNAGAKQAALEKL------------AQEFDASQGLTAFDKFERLAQYAAPADRSQFTVTVSGEHEAPQLEY--RIKDTAVKHDQVTASAWNVIETRLGH................................................................................................................................................................................. 130
198 2.000e-08UniRef50_V1GY80 E3 ubiquitin-protein ligase SlrP n=17 Tax=Enterobacteriaceae TaxID=543 RepID=V1GY80_SALCE  ali  12  299................................................................................................................................................................................TDLMSQNIPAYEAAWSSWIESAPTTEAANRRIAVDR-MRDYLHNG-------GNHLDLGNLYLTSLPDALPENVTFLIISVQRNSLNALPDTLP-ESLRILMASDNHLSSLPEHVPPGLLRLDVSSNRLIHLPE......... 442
199 4.000e-08UniRef50_A0A1X2T2V1 Uncharacterized protein (Fragment) n=1 Tax=Salmonella enterica subsp. arizonae serovar 50:r:z TaxID=1974320 RepID=A0A1X2T2V1_SALC  ali  18  16.........................GSTSVPDFSGMWNSISDWFTLSAQDEAAQCFRAFYQPDEGMSPPD---------RLKHFLRLKALASPG................................................................................................................................................................................................................................. 75
200 4.000e-08UniRef50_G5RHV4 Secreted effector protein n=1 Tax=Salmonella enterica subsp. enterica serovar Uganda str. R8-3404 TaxID=913083 RepID=G5RHV4_SALET  ali  23  1MPFHIGSGCL-PATISNRRIYRIAWSDT--PPEMSSWEKMKEFFCSTHQNEGIFLL....................................................................................................................................................................................................................................................................... 57
201 6.000e-08UniRef50_UPI0009A991C7 hypothetical protein n=2 Tax=Salmonella bongori TaxID=54736 RepID=UPI0009A991C7  ali  11  1...............................................................................................MENIQRNREGLNQFCILDADSKEALVVMIEPEHYLIEWEGVTIMYGYDQERL----------------------YGAHAMSGATSLAQPEAYDAIWSEWQANAPPEEARNCSQAVER-MRDCL-------ATSKAVLDLSGLQLTTLPALLPEHITVL--TVINNCLT........................................................ 136
202 7.000e-08UniRef50_A0A0G4Q1T9 Uncharacterized protein n=1 Tax=Proteus vulgaris TaxID=585 RepID=A0A0G4Q1T9_PROVU  ali  14  8..............IHHDRMEQIKNTE-EPLNVRTLWEKIKNWFGFGKE----GIVFPLIKET------FFDKKINDFEKIKGFCKLRNLTGDAYKENFRIEKKDNEINFSILLDGN-FDGEKISFIHNINEDGSDEIKPIKDIILSLEKNGLDDLLFYAIDKAIELKKKEIESNEIKKEVIRELIIDNKSRFKKAKFDPELFTDRLKELIKNEKESIEDNIEKSIKKGITPTYMTL-LEKIEDELFRDLSRMKININSTPIADMENKP.................................................. 266
203 9.000e-08UniRef50_A0A1V5EGF3 Uncharacterized protein n=1 Tax=Bradyrhizobium sp. BR10280 TaxID=1399419 RepID=A0A1V5EGF3_9BRAD  ali  12  3.........................................................................................................................................................................................EYPNVSHNDLTNLPALPAGLQSLNASDNRLASLPEVLSPALQHLDVSDNQSLN---VPEVLPAAL--LSLDVSHNQLTSLPENLPAM-LHALAVSGNQSTSLPEALPPGLVLLDAGHNQLTSLSED........ 122
204 1.000e-07UniRef50_A0A193QNU4 Uncharacterized protein n=2 Tax=Sodalis glossinidius TaxID=63612 RepID=A0A193QNU4_SODGM  ali  18  17....................NTLSIKNDNDVHVSALWENIKHLFHHDKINDAQRLVYDLCYPNDN--------DASFKKSMKCFLKLRRMARDEYKTQFVYRKDTDESKKICEIDNKGYPLITIAKGINDSDSLYKYTIAGIESTFL............................................................................................................................................................................ 136
205 1.000e-07UniRef50_Q8ZQQ2 E3 ubiquitin-protein ligase SlrP n=395 Tax=Enterobacteriaceae TaxID=543 RepID=SLRP_SALTY  ali  10  175.....................................................................................................CLKNNKTELRLKIGLTTIPAYIPEQITTLILDNNELKSLPENLQGNIKTLYANSNQLTSIPATLPDTIQEMELSINRITELPERLPSALQSLDLFHNKISCLPENLPEELRYLSVYDNSIRTLPAHLPSGITHLNVQLTALPETLPPGLKTLEAGE--NALTSLPASLPPE-LQVLDVSKNQITVLPETLPPTITTLDVSRNALTNLPEN........ 385
206 2.000e-07UniRef50_UPI00096CC720 restriction endonuclease n=1 Tax=Salmonella choleraesuis TaxID=28901 RepID=UPI00096CC720  ali  26  1MPFHIGSGCL-PATISNRRIYRIAWSDT--PPEMSSWEKMKEFF................................................................................................................................................................................................................................................................................... 41
207 2.000e-07UniRef50_A0A2X6Z3G9 Non-LEE-encoded type III effector n=6 Tax=Escherichia coli TaxID=562 RepID=A0A2X6Z3G9_ECOLX  ali  19  8MPVTL-------LNMSKNDIYKMVSGDKKMNIFQRLWETLRHLFWSDKQTEAYKLLFNFVNNQTGTGAINENEREKFINSLELFNKLKTCAKNPDKGNMRWTFGDIELSVTFFIEKNKICTQTLQ.................................................................................................................................................................................................. 143
208 2.000e-07UniRef50_G2GWC7 Uncharacterized protein n=1 Tax=Candidatus Regiella insecticola 5.15 TaxID=1005043 RepID=G2GWC7_9ENTR  ali  32  1MSLIIQGATYFNIVISEKRLKRIYGSSKEDAIKMGVWGKIKDWVCRNKKSKSTEE........................................................................................................................................................................................................................................................................ 58
209 2.000e-07UniRef50_A0A2X2GJ06 E3 ubiquitin-protein ligase SlrP n=16 Tax=Salmonella choleraesuis TaxID=28901 RepID=A0A2X2GJ06_SALTI  ali  11  4.....................................................................................................CLKNNKTELRLKIGLTTIPACIPEQITTLILDNNELKSLPENLQGNIKTLYASSNQLTSIPATLPDTIQKMELSINRITELPERLPSALQSLDLFHNKISSLPENLPEELRYLSVYDNRIRTLPEHLPSGITHLNVQLTALPETLPPGLKNLEAGE--NALTSLPASLPPE-LQFLDVSKNQITVLPETLPPTITTLDVSRNALSNLPEN........ 214
210 3.000e-07UniRef50_P39220 Putative uncharacterized protein YabP n=327 Tax=root TaxID=1 RepID=YABP_ECOLI  ali  19  8MPVTL-------LNMSKNDIYKMVSGDKKMNIFQRLWETLRHLFWSDKQTEAYKLLFNFVNNQTGTGAINENEREKFINSLELFNKLKTCAKNPDKGNMRWTFGDIELSVTFFIEKNKICTQTLQ.................................................................................................................................................................................................. 143
211 3.000e-07UniRef50_A0A2X2C2W0 Uncharacterized protein n=1 Tax=Proteus mirabilis TaxID=584 RepID=A0A2X2C2W0_PROMI  ali  18  8......................................KIKDWFNHGQKEHVLKLLYHTYFNPKN----------SIFDKVDCFAELYSMTGAQYKDNFHLYLKDGYDKMKFVINGEVLLDNLIKDMMNPSIEKDIGNIRSYIRRRLHEIPNYVNYDINQYNFYLSQIKNDLL.................................................................................................................................................. 143
212 4.000e-07UniRef50_UPI0008EF9F01 hypothetical protein n=1 Tax=[Clostridium] citroniae TaxID=358743 RepID=UPI0008EF9F01  ali  13  552......................................................................................................................................................................NNLDCSSNQLTELPDLPVGLINLDCSSNQLT----ELLDLPVNLIT--MTCDNNQLTELPDLPAALDYLENQLTELPD-LPDSLTLLGCRY--NQLTELPDSLPAE-LKTLGCSNNQLDSLPDSLPAGLTYMECSSNQLTELPD......... 688
213 4.000e-07UniRef50_A0A0G3IBT5 Uncharacterized protein n=1 Tax=Pandoraea oxalativorans TaxID=573737 RepID=A0A0G3IBT5_9BURK  ali  18  13.PISLRGNWLVDGQISAAEVDHAERTKGAKPIDRGFWDDLKNMFCTTRRAEATGYLNAMMAPDKSDE-----------NRIESLLSLFGMASNAQLSRFQAHCDPDHHDYIISIDQTPISIRV.................................................................................................................................................................................................... 128
214 4.000e-07UniRef50_A0A1J0E1X3 Uncharacterized protein n=2 Tax=Providencia rettgeri TaxID=587 RepID=A0A1J0E1X3_PRORE  ali  11  27..................................TLWQAIEECFPPETHERANEHFNNL----------FSNARLQPNEQLAIFLTLQSLASPSTQSNFRIGYYSGTNTVTCTID-----TFRQNGSMCMDIPLIERDYHAEHLNFALNSWVNNAPIGENRNEAADIIRRCFAQNSDNIDLSNQNISSLLPPNLRSLNVANNQLTSLPIFSDSLITLNLSHNQLTSLSSLPEDLERLNINQLTNLPRLPLYMVSLQANNNQLTNMPMLPYA--LSDLNVSNNQLTYLQTSQTPLIT-LDISHNQFTQLP.......... 288
215 4.000e-07UniRef50_UPI0009703AEB hypothetical protein n=1 Tax=Vibrio ostreicida TaxID=526588 RepID=UPI0009703AEB  ali  15  16........SNDSVSLTSDRVRKLLGDDQNLATSTSFRSKIADLFKPEFKQKVFQSLYDMIHKPD-------EAKQSPTETFHRFSLLSAMAHRNNHALFTVQTEPTTYTVRYLVAEEAIKQEKVDEVTRDAINACLGCTNEEHFGHTLTKPATTINHYKVVPDPKERDRLTDQSF................................................................................................................................................ 192
216 4.000e-07UniRef50_A0A248KAE5 E3 ubiquitin--protein ligase n=7 Tax=Salmonella bongori TaxID=54736 RepID=A0A248KAE5_SALBN  ali  12  308.......................................................................................................................................................YVDENRITDLPETLPPELKELDVRQNRLTALPEILPDGLKRLDVAFNRLTHLPERLPSGLKKLNVSGNLLTTLPETLPSKLNASVNQLTALAEALPSGLEELDASI--NQLTVLPETLPSG-LKKLDASVNQLTALPETLPSGLEVLNVEYNQLTTFPE......... 466
217 6.000e-07UniRef50_A0A068Z5Y5 E3 ubiquitin-protein ligase ipaH9.8 (Modular protein) n=8 Tax=Serratia symbiotica TaxID=138074 RepID=A0A068Z5Y5_9GAMM  ali  1..................................................................................................................................................MLPVNNNPDLPVQTYLRSTGDAPSSSSVSQTATVPLRPDEYYALWAEWEENALPGMGEKRDIAVAR-MRECLETGRKF-------LDLVELQLSSLPNFLPPEINLLHVSC--NHLCKLPDNLPET-LTVIDASDNELTEIPVNLPRDIIYLVFKKNQVENIPSN........ 154
218 7.000e-07UniRef50_UPI0008936CA5 hypothetical protein n=1 Tax=Burkholderia sp. JS23 TaxID=1770053 RepID=UPI0008936CA5  ali  12  1..................................................................................................................................................MLRTTWTDIEYPQPMDPLRRSLSPNPHVRSLDQGPSNRAEYLESWARWRRDAPADEVEARAIAFER-VREFPNNNRLEAENE---LDLRCLGLTTLPDRFPDTLGCLR--VNHNRLSRLPDELPESLLTVLSVPYNLLDSLPNPLPGNLRELCLDGNRLRALP.......... 177
219 1.000e-06UniRef50_A0A1W9SCH4 Uncharacterized protein n=1 Tax=Rickettsiaceae bacterium 4572_127 TaxID=1971637 RepID=A0A1W9SCH4_9RICK  ali  160.........................................................................................................GQTSCNCYIGNSRVAKQNGAFSPTTEQVGTNCEDRIKAIAKYNTENSSKGAGLSNNTKKEESSTLTKFMADSNNSALIGYLKTNCGENGKKAEDVNLFSKKNFNKEYGLTGICSQTQLPGVIAYIETNCSTLGLTELPANLPSGL--LKLYVYENYLTELPANLPSGLEHLL-VSDNQLTSLPANLPSGLEHLLVSDNQLTSLPAN........ 370
220 1.000e-06UniRef50_A0A2X1PD26 Non-LEE-encoded type III effector n=3 Tax=Escherichia coli TaxID=562 RepID=A0A2X1PD26_ECOLX  ali  19  8MPVTL-------LNMSKNDIYKMVSGDKKMNIFQRLWETLRHLFWSDKQTEAYKLLFNFVNNQTGTGAINENEREKFINSLELFNKLKTCAKNPDKGNMRWTFGDIELSVTFFIEKNKICTQTLQ.................................................................................................................................................................................................. 143
221 1.000e-06UniRef50_A0A1I7MAB2 Type III secretion system effector, E3 ubiquitin ligase YopM/NopM family n=10 Tax=Bradyrhizobiaceae TaxID=41294 RepID=A0A1I7MAB2_  ali  14  318.............................................................................................................................................................................................................................................RLTSLPNTLPPEIQELEAD--GNRLTSLPDTLPVE-LQVLFARDNQLDSLPETLPPDLQRLHVGGNRLTSLPDN........ 388
222 1.000e-06UniRef50_A0A2T8TEG4 Uncharacterized protein n=1 Tax=Salmonella choleraesuis TaxID=28901 RepID=A0A2T8TEG4_SALCE  ali  63  1MPVTLSFGNHQNYTLNESRLAHLLSADKEKAIHMGGWDKVQDHF................................................................................................................................................................................................................................................................................... 44
223 2.000e-06UniRef50_A0A1C3XGY4 Uncharacterized protein n=2 Tax=Bradyrhizobium TaxID=374 RepID=A0A1C3XGY4_9BRAD  ali  15  11.....................................................................................................................................................................................................................................................PTPSKTVQELDARGNRLTHLPRLPAG--LQRLNVEYNQLADLPEPLPAEFEWLSASHNRLTSLPE......... 73
224 2.000e-06UniRef50_UPI0009E0677C hypothetical protein n=1 Tax=Glycomyces sp. NRRL B-16210 TaxID=1463821 RepID=UPI0009E0677C  ali  14  33...........................................................................................................................................................PELATLTNLSRLYLSDNRLTTLPDSIGNLTQLTRLYVEGNQLTTLPESIGNLTQLTRLYLNGNRLTSFDNITKLTNLDLSSNRLTTLPDSIGNLNRLNRLNLEGNQLTTLPESINLTQLNQLNLDNNRLTTLPESIGNLLTRLYVEGNQLTTLPE......... 191
225 2.000e-06UniRef50_A0A2A7VJF2 Uncharacterized protein n=3 Tax=Yersinia pseudotuberculosis TaxID=633 RepID=A0A2A7VJF2_YERPU  ali  12  27..................................................................................................................................................................................ATALTQADYHAIWEKWESEASPRAKGQRGQAVARMKECLENNADY--------LDLYSLGLTSLPDTLPPCNELNIMA---NNLTELPTTLPDN-LQKLNAAYNQLRTLPDTLPTSLLSLKVFMNQLERLPE......... 146
226 2.000e-06UniRef50_G2GWC8 Uncharacterized protein n=1 Tax=Candidatus Regiella insecticola 5.15 TaxID=1005043 RepID=G2GWC8_9ENTR  ali  15  2.................................................................THSDHEPDTESALKTITSFYQLKEMIYPGFQDRFQASVTENEYTFTFSIKDAMDERKLVYGNAEKDVHAFSARTLTNNSEFLDTSNVSREGVDTSLAKVAYNIA...................................................................................................................................................... 108
227 2.000e-06UniRef50_A0A1E3V5B7 Uncharacterized protein n=2 Tax=Ensifer TaxID=106591 RepID=A0A1E3V5B7_9RHIZ  ali  18  116......................................................................................................................................................................................................................LVCLPYK-LPPGLQTLQASYNRLNS--LPGALPVGLQTLGAAY--NQLTSLPDNLPAG-LQALNVVGNQLTKLPASLPPELRDFIAKYNRLSTLPD......... 205
228 2.000e-06UniRef50_UPI0009756C06 hypothetical protein n=2 Tax=Bradyrhizobium TaxID=374 RepID=UPI0009756C06  ali  15  133.............................................................................................................................................................................................................................................QLTGLPNPLPTDL--LVLAASDNRLTSLPDPLPAG-LRLLYAMRNQLNNLPAPLPAGLLRLNVQGNQLTSLPD......... 202
229 2.000e-06UniRef50_A0A1C3XSE9 Type III secretion system effector, E3 ubiquitin ligase YopM/NopM family n=42 Tax=Rhizobiales TaxID=356 RepID=A0A1C3XSE9_9BRAD :_  ali  11  44................................................................................................................................................................................SGDSAHAEENEDEVLENWAAETEVGPLEDREEAVRR----------VNARGEATRLDLESLSLTSLP-RLPTSIVVLDVPF--NRLTTLPDSLPA-SLQRLDVRGNQLTSLPA-LPTELRGLDASSNRLRSLPE......... 162
230 2.000e-06UniRef50_C4PL85 NopM protein n=3 Tax=Bradyrhizobium TaxID=374 RepID=C4PL85_BRAEL  ali  13  105....................................................................................................................................................................................................................................LRRLNVDDNQLNSLPGNLPVSLQWL--SASNNRLTGLPELPNGLL--QLDVISNGLTNLPAQLPPGLLRLRVDNNQLTSLPDR........ 183
231 2.000e-06UniRef50_A0A0H1R357 E3 ubiquitin--protein ligase n=29 Tax=Rhizobiales TaxID=356 RepID=A0A0H1R357_9RHIZ  ali  16  57.....................................................................................................................................................................................................WAAEEAQGEDENRQEAVLRTSAWRQAADLDEPLDLSSRSL--TVLSAALPPELRRL--NVNSNQLSGLPNLPAD--LQRLYASDNRLTSLPD-LPAGLQRLYVNSNRLTSLPAD........ 163
232 2.000e-06UniRef50_A0A241SCU6 Uncharacterized protein n=1 Tax=Salmonella enterica subsp. salamae serovar 55:k:z39 str. 1315K TaxID=1243602 RepID=A0A241SCU6_SAL  ali  12  435...........................................................................................................................................................PLPDGITELNVRGNSLSALPDNLPASLE--ILDVSYNELSIMPERLPAGLRELTLHKNTLTKLPEDLPQG---LEVLNVSKNKLTRLPETLPEKLRKLYVDE--NSITDLPATLPPG-LKELHVKSNRLKALPDTLPNGLKKLFVAFNDLTHLPERLPSR.... 586
233 2.000e-06UniRef50_A0A2C9NXC8 Uncharacterized protein n=1 Tax=Salmonella enterica subsp. enterica serovar Macclesfield str. S-1643 TaxID=1242107 RepID=A0A2C9NX  ali  35  1................................................................................................................................................................................................................................................................................................MFIDLILEKLYLTHERSLQIGKDGCSRNILL 31
234 3.000e-06UniRef50_UPI0009334A42 hypothetical protein n=1 Tax=Candidatus Fukatsuia symbiotica TaxID=1878942 RepID=UPI0009334A42  ali  11  49..............................................................................................................................................MKYLMTKEYHQVWHKWANEAVKEGEKRQEALLKMKNCLEKNDAVLWLSDLKLSSLPNLLPPSIKTLNLFYNKLTSLPDNLP---VSLTILDVSDNQLIALPDNLPVSLTTLWVF--NNQLTSLPDNLPA-SLTTLDVSDNELTVLPDNLPVSLIILWVFDNQLTSLP.......... 209
235 4.000e-06UniRef50_L1JS33 Uncharacterized protein (Fragment) n=2 Tax=Guillardia theta CCMP2712 TaxID=905079 RepID=L1JS33_GUITH  ali  17  26.................................................................................................................................................................................................................LSSNKLTSLPAGIFAGLTSLGSLSINSNQLTSLPAGIFAGLTSLWSLSINNQLTSLPAGIFAGLTSSLSINSNQLTSLPAGIFAGLTSLDLSSNKLTSLP.......... 131
236 4.000e-06UniRef50_A0A1B9YZ82 E3 ubiquitin--protein ligase n=10 Tax=Bradyrhizobiaceae TaxID=41294 RepID=A0A1B9YZ82_9BRAD  ali  15  108...................................................................................................................................................................................................................................RLLELSARHNELSSLPATFPPGLQHLLISH--NRLTSLPDALPATLS-LLEVADNSLTSLPANLPAGLEILNANDNRLRSLPDSLPSR.... 192
237 5.000e-06UniRef50_A0A1S2S9B6 Uncharacterized protein n=1 Tax=Bradyrhizobium elkanii TaxID=29448 RepID=A0A1S2S9B6_BRAEL  ali  15  53.............................................................................................................................................................................................................RQLALTSLALTVLSPPSLPAWLALQRINVSDNQLTHLPE-LPPSLSEL--DARLNRLTSLPALP--NTLRRLTVFGNQLTSLPDRLPATLRWLHAHNNRLTSVPEN........ 153
238 5.000e-06UniRef50_A0A2T8SVH7 Uncharacterized protein n=2 Tax=Salmonella choleraesuis TaxID=28901 RepID=A0A2T8SVH7_SALCE  ali  13  28...........................................................................................................................................................................................DPSSENEKYIKAWQEWKNSAPEGGRESRELAVNGLYDCLQQAYRLELVNLELSCLP-VLPTHITTL--DVSHNRLTALPDLPSS--LTSLEADENQLTALPASLPERLEILRCDYNLLETLPKTLSS..... 150
239 5.000e-06UniRef50_A0A1S2SN96 E3 ubiquitin--protein ligase n=12 Tax=Rhizobiales TaxID=356 RepID=A0A1S2SN96_BRAEL  ali  18  114.............................................................................................................................................................................................................................................ELSSLPAMLPPGLQHLLISH--NRLTGLPDALPATLS-WLEVADNSLTSLPANLPAGLEMLNANDNRLSSLPDALPSR.... 188
240 6.000e-06UniRef50_E9Z117 Leucine-rich n=1 Tax=Escherichia coli M863 TaxID=656420 RepID=E9Z117_ECOLX  ali  16  29.......................................................................................................................................................................................................................................LDVSNNQLSGLP-ALPAGLVTL--DVRFNLMSSLPELP--GYMRTLNVSNNQLIHLPV-LPVRLKVLDVSNNQLTSLPDR........ 102
241 6.000e-06UniRef50_A0A1Y6KAD4 Putative E3 ubiquitin-protein ligase (NopM) n=2 Tax=Bradyrhizobium sp. ORS 285 TaxID=115808 RepID=A0A1Y6KAD4_9BRAD  ali  12  349..............................................................................................................................................................................................................LPTELRFLDASSNRLRSLPAVIPAELEFLDLHLQELPEVLPASLETL--NVSHNQLTNLPEVLPTM-LEFLYASENQLTRLPQQLPASLVRLDVGQNQLSSLPDD........ 453
242 7.000e-06UniRef50_UPI000C1FC389 hypothetical protein n=1 Tax=Escherichia TaxID=561 RepID=UPI000C1FC389  ali  16  96.......................................................................................................................................................................................................................................LDVSNNQLSGLP-ALPAGLVTL--DVRFNLMSSLPELP--GYMRTLNVSNNQLIHLPV-LPVRLKVLDVSNNQLTSLPDR........ 169
243 7.000e-06UniRef50_A0A193GCW1 Uncharacterized protein n=2 Tax=Bordetella flabilis TaxID=463014 RepID=A0A193GCW1_9BORD  ali  911..............................................................................................................TLIVNNNPITDWSRLPRNLTTLKAAHTRNISLLLRYLPPRLLELDLSNNHLTSIAGHRLPRSLTHLTANTEIPDNLPDGLLCLSLENNMLTRWPKALPGSLRQLRVSHNQFDRLPRNMPPDLEHLDLAGNIFPDTLPPHLKILNLTNNDTRLSSLPAALPRSLMQ-LHAPGLGLNRLPDSLPQGLTVLDLSNNRLTELP.......... 1135
244 7.000e-06UniRef50_A0A2U8I547 Uncharacterized protein n=1 Tax=Candidatus Fukatsuia symbiotica TaxID=1878942 RepID=A0A2U8I547_9GAMM  ali  11  2..........................................................................................................................................................................................................................................SDNQLIALPDNLPVSLTTLWVF--NNQLTSLPDNLPA-SLTTLDVSDNELTVLPDNLPVSLIILWVFDNQLTSLP.......... 73
245 8.000e-06UniRef50_C4K6M1 Uncharacterized protein n=8 Tax=aphid secondary symbionts TaxID=146507 RepID=C4K6M1_HAMD5  ali  25  1MSLSIQSNGLSQKVLNERNIEAIKNLSKKNTTDMGVWETIKGFFCRTKKTQVLEKVHELTHQN................................................................................................................................................................................................................................................................ 66
246 9.000e-06UniRef50_A0A2X2N3P2 Secreted protein sopD n=2 Tax=Yersinia enterocolitica TaxID=630 RepID=A0A2X2N3P2_YEREN  ali  22  1.........................................................................................MANPSHRDQFKIHVHSQETN-------------KNKYTLSIKNNDVYSFIAENNWEPLSQIPFAQLPLIENYSSIVKNYAKDHQDSFNK............................................................................................................................................. 76
247 1.000e-05UniRef50_A0A0R3CA03 Uncharacterized protein n=2 Tax=Bradyrhizobium pachyrhizi TaxID=280333 RepID=A0A0R3CA03_9BRAD  ali  16  5.......................................................................................................................................................................................................................................LNASDNRLASLPEALPPALQFLDVSY--NELPNLPEILS-DSLQYLEVSDNQLTSLQEGLPAMLRTLAVRRNQLTSLPEN........ 81
248 1.000e-05UniRef50_I6DGZ6 E3 ubiquitin-protein ligase ipaH3 n=12 Tax=Shigella TaxID=620 RepID=I6DGZ6_SHIBO  ali  17  24........................................................................................................................................................................................ADYFSAWDKWEKQALPGENRNEA-------VSLLKECLIN---QFSELQLNRLNLSSLPDNLPPQITVLEITQNDNHLSTLPELPAS--LKHLDVDNNQLTMLP-ELPALLEYINADNNQLTMLPELPTSLEVL. 162
249 1.000e-05UniRef50_F3WPV7 Uncharacterized protein n=2 Tax=Enterobacteriaceae TaxID=543 RepID=F3WPV7_9ENTR  ali  19  37......SINKKKYNINSKDIENILDGKGDLFKKRTLWEFVRDLFPGSHIKEVKGLIYEFVTKVDN--------------KAEVFDKIKSLAK................................................................................................................................................................................................................................... 108
250 1.000e-05UniRef50_UPI0004AD4811 hypothetical protein n=2 Tax=Bradyrhizobium TaxID=374 RepID=UPI0004AD4811  ali  15  6.............................................................................................................................................................................................................RQLALTSLALTVLSPPSLPAWLALQRINVSDNQLTHLPE-LPPSLSEL--DARLNRLTSLPALP--NTLRRLTVFGNQLTSLPDRLPATLRWLHAHNNRLTSVPEN........ 106
251 1.000e-05UniRef50_A9V9L0 Predicted protein n=1 Tax=Monosiga brevicollis TaxID=81824 RepID=A9V9L0_MONBE  ali  18  394................................................................................................................................................................................................................HLNKNGLAALPTSVFQDATQLRKLNLEENVLTTLPDGVFSTTLHLTVTLNNNHLTSIPAGLNTGELQSIKLDNNRLTVLPDRTFGLLQRLSLTYNRLTRIEANG....... 503
252 1.000e-05UniRef50_L1I8L9 Uncharacterized protein n=1 Tax=Guillardia theta CCMP2712 TaxID=905079 RepID=L1I8L9_GUITH  ali  13  118..........................................................................................................................................YLYLSSNKLTSIPETVFAGLASIRVLILSGNELTSVPETVFAGLASLQYLYLDNNKLTSVPATVFNGLASYLSSNKLTSVPETVFNGLASLRSLYLDNNELTSVPETVFAGLASLQTLYLDNELTSIPATVFAGLLQTLYLSYNKLTSVPETVFDGLRSLYLSYNELTSVPE......... 299
253 1.000e-05UniRef50_A0A261UI88 Uncharacterized protein n=2 Tax=Bordetella genomosp. 11 TaxID=1416808 RepID=A0A261UI88_9BORD  ali  14 1054.......................................IEDWRHLPKK---LRVLHAD-HTGMTKLPANLSIDLEELNVSGNFLRDASLALPPKLKRLEIAGNNLKTAPALSLEELVIYDNAIQELQRLDVSGNALTRVPNEWPSSLRQLYLANNRLTDLPDLSHTGLLELDVSSNNLQTLASLPDTLVELDASGNALT-ELIIDLPRDLRLMRVDRNRLTRVPRTRLEQVDFSDNSIETLP-ALPDTLRTLVAD--GNLLSELSAGLPRG-LKVIRVSGNQLRRLPDDLPTGLTILSLERNLLGRLP.......... 1327
254 1.000e-05UniRef50_F3VEE7 Uncharacterized protein n=1 Tax=Shigella dysenteriae 155-74 TaxID=766142 RepID=F3VEE7_SHIDY  ali  16  11.................................................................................................................................................................................DQKAFQSGMLKMQFPNDNEKIPFKNITIDLSALEKEALASLKYCNFKKVKFTGAISYENLNGSVFGNCFFEGCIFENVSLVSSR-CRVKPNN.................................................. 109
255 2.000e-05UniRef50_A0A2W4EQ60 E3 ubiquitin-protein ligase SspH2 n=74 Tax=Salmonella choleraesuis TaxID=28901 RepID=A0A2W4EQ60_SALDE  ali  13  77.................................................................................................................................................................................................................LRRLLVAGNQLTSLPPLPAGLQLSVSDNQLTSLP-LLPAGLELLTLE-RNPQLVRLPPLPEG--LQTLSVDANPQLTRLPALPSGLQRLYARNNQLTRLPE......... 174
256 2.000e-05UniRef50_I0QXT2 Antigenic leucine-rich repeat protein n=1 Tax=Serratia sp. M24T3 TaxID=932213 RepID=I0QXT2_9GAMM  ali  15  7.....................................................................................QLNNQISPQALECFQAECSSKAKNCKTMLDYSAVWKEWGKNALELAIRRLEDCMQRGSIELDLSALGLSELPPILPPKIVKLFANNNKIETLPQTWPPKLNYLKISNNRLTMLT------SLPSDLKTLLAKFNQIHTLPAIQLRHIDLSNNNINQLPDKLPESLRSLL--VSHNLLRSLPEQFP-ESLTVIKANNNRLVNIQAVYPVMLQMLNCNDNQLSNLPEN........ 235
257 2.000e-05UniRef50_I6E5C5 E3 ubiquitin-protein ligase ipaH3 n=33 Tax=Enterobacteriaceae TaxID=543 RepID=I6E5C5_SHIBO  ali  17  24........................................................................................................................................................................................ADYFSAWDKWEKQALPGENRNEA-------VSLLKECLIN---QFSELQLNRLNLSSLPDNLPPQITVLEITQNDNHLSTLPELPAS--LKHLDVDNNQLTMLP-ELPALLEYINADNNQLTMLPELPTSLEVL. 162
258 2.000e-05UniRef50_A0A182FJ01 Uncharacterized protein n=1 Tax=Anopheles albimanus TaxID=7167 RepID=A0A182FJ01_ANOAL  ali  14  634.............................................................................................................................................LDRLKLLNLRGNRLTRIADEAFQNLPELEKLDLAYNELSSFDFDFFDQVRPAEQSLMRLELQHNRLGAVTRDLLGTMPHLHWLDLSANRIA-------EVEYDALRSLRKLQVLKLSGNALTELPAELFRGVLRVLELAHNTLKYLPDGLSEGLERLDVSHNQLTKIP.......... 798
259 2.000e-05UniRef50_A0A0G4GTC4 Uncharacterized protein n=1 Tax=Chromera velia CCMP2878 TaxID=1169474 RepID=A0A0G4GTC4_9ALVE  ali  13  218....................................................................................................................................................................................DLSFNLIRDLPGDWQCHPVLQSFTADHNHLSR-----LSNAWITQMSSLREISISYNKLERLPTNIGQCLSLESIRVNGNLIQELPESLCELSLRILDVEGNKLETLPEKFGELLEFLDVSKNNLRSLPESGNCRRL.. 353
260 2.000e-05UniRef50_A0A2X7E8C5 Putative type III effector protein n=2 Tax=Escherichia coli TaxID=562 RepID=A0A2X7E8C5_ECOLX  ali  19  8MPVTL-------LNMSKNDIYKMVSGDKKMNIFQRLWETLRHLFWSDKQTEAYKLLFNFVNNQTGTGAINENEREKFINSLELFNKLKTCAK................................................................................................................................................................................................................................... 103
261 2.000e-05UniRef50_A0A2B4RRD2 Leucine-rich repeat-containing protein 1 n=1 Tax=Stylophora pistillata TaxID=50429 RepID=A0A2B4RRD2_STYPI  ali  12  87......................................................................................................................................................................................KLKWLDISWNEWLTTGEMEELEILFLKENQLTVLSSSITQLKKLKELYITGNK---LTTIPDAIGEMVGLEVLELNYNKLTELSPAIKQLKLKVLSISQNQLTTIPDSIGEMLEKLDLSHNQLTVLSSN........ 218
262 2.000e-05UniRef50_A0A2M8R0V1 Uncharacterized protein n=2 Tax=Bradyrhizobium TaxID=374 RepID=A0A2M8R0V1_9BRAD  ali  12  85...................................................................................................................................................................................................................................ETTTLDLGSLSLTSLP-RLPNAVVALDVPF--NRLTTLPDSLPA-SLQRLDVRGNQLTSLPA-LPTELRGLDASSNRLRSLPE......... 162
263 2.000e-05UniRef50_A0A2L0HBJ0 Uncharacterized protein n=2 Tax=Rhizobium fredii TaxID=380 RepID=A0A2L0HBJ0_RHIFR  ali  15  265.............................................................................................................................................................................................................................................RLTSLPDNLPSGLQTL--NANGNQLTKLPAKLPAA-LQTLGAADNRLTGLPNDLPVGLRRLNARCNLLISLPDK........ 335
264 2.000e-05UniRef50_A0A1Y6K9X8 Putative E3 ubiquitin-protein ligase (NopM) n=13 Tax=Bradyrhizobium TaxID=374 RepID=A0A1Y6K9X8_9BRAD  ali  11  213..............................................................................................................................EQTLDAWACESGQAEGEDRQEAVRRILAWGEDGDV--YARLDLSNLSLTTLPDAFPAGVKSLNVSQNELVHLPDQLPSGLRTLDASNLLTSLPETLPEGLQS---LSLGSNRLAALPETLPENLWTLTVTTNLLT--SLPDALPVG-LQDLDVRGNRLTSLPDALPSGLRSLAVGSNRLASLPE......... 389
265 2.000e-05UniRef50_A0A1L3LTY5 E3 ubiquitin-protein ligase n=3 Tax=Sinorhizobium/Ensifer group TaxID=227292 RepID=A0A1L3LTY5_9RHIZ  ali  14  245.......................................................................................................................................................................................................................................LNVDGNRLTNLPDNLPSGLQTL--NANGNELTNLPHKLPAG-LQTLGAADNRLAGLPNDLPSGLRRLNARCNLLISLPDK........ 321
266 2.000e-05UniRef50_A0A1G8CEW6 Type III secretion system effector, E3 ubiquitin ligase YopM/NopM family n=4 Tax=Bradyrhizobium TaxID=374 RepID=A0A1G8CEW6_9BRAD  ali  15  98..................................................................................................................................................................................................................................................PAALPPRL--LGLRAMHNELSSLPAGLPPGLNQLL-ISHNQLTSLPDALPASLSHLDVSDNRLTTLPDN........ 163
267 2.000e-05UniRef50_A0A2X5BGF2 Leucine-rich repeat protein n=3 Tax=Salmonella choleraesuis TaxID=28901 RepID=A0A2X5BGF2_SALET  ali  13  287.................................................................................................................................................................................................................LRRLLVAGNQLTSLPPLPAGLQLSVSDNQLTSLP-LLPAGLELLTLE-RNPQLVRLPPLPEG--LQTLSVDANPQLTRLPALPSGLQRLYARNNQLTRLPE......... 384
268 3.000e-05UniRef50_E9CMD0 Leucine-rich repeat protein (Fragment) n=2 Tax=Serratia symbiotica TaxID=138074 RepID=E9CMD0_9GAMM  ali  13  75.....................................................................................................................................................................................................................MRACLETGKR-------ALRLVELHLSSLPERLPPNITSL--NVSGNHLCKLPDNLPETVTDLIVSDNNQLENIPGNLPDTIEALDLADNRLSTLPD......... 182
269 3.000e-05UniRef50_UPI00055F3C81 hypothetical protein n=2 Tax=Sinorhizobium americanum TaxID=194963 RepID=UPI00055F3C81  ali  14  9......................................................................................................................................................................................................................................VLDLSFLRLSTLPAELPAGLHRLNVDC--NHLAHLPGELPAE-LQALNARYNRLSSLPGTLPRELQILEVSYNRLISLPD......... 85
270 4.000e-05UniRef50_A0A1J0M1B4 Uncharacterized protein n=2 Tax=Pandoraea pulmonicola TaxID=93221 RepID=A0A1J0M1B4_9BURK  ali  13  102..................................................................................................................NDAETLADALADLHLEKVCGDESRYLSPVHVQLAHDVLAAFDIRVDAHKLLSKLIENLPESHGGNDNGVDELYRSALCAWVAIEPPESGGKRVRGIARD--RILNMVD-------GKLNLSRLGLGRLPE-LPAGLAAL--DARDNQLTELPALPAGLSLTSLNVHDNQLTQLP-ELPASLAHLWVYDNQLTELPE......... 302
271 4.000e-05UniRef50_A0A0L7ADE5 Leucine rich repeat protein n=26 Tax=Enterobacteriaceae TaxID=543 RepID=A0A0L7ADE5_ECOLX  ali  16  398.......................................................................................................................................................................................................................................LDVSNNQLSGLP-ALPAGLVTL--DVRFNLMSSLPELP--GYMRTLNVSNNQLIHLPV-LPVRLKVLDVSNNQLTSLPDR........ 471
272 4.000e-05UniRef50_A0A1E3EDK1 Uncharacterized protein n=2 Tax=Bradyrhizobium TaxID=374 RepID=A0A1E3EDK1_BRAEL  ali  17  11.......................................................................................................................................................................................................................................LNASDNRLASLPEALPPALQFLDVSY--NELPNLPEILS-DALQYLEVSDNQLTSPQEGLPAMLRTLAVRRNQLTSLPE......... 86
273 4.000e-05UniRef50_A0A0G3IG50 Uncharacterized protein n=1 Tax=Pandoraea oxalativorans TaxID=573737 RepID=A0A0G3IG50_9BURK  ali  15  4.PILLRGNWLVEDKISGPEVDRAAGVEDAAPICKSLWDAVKDMFCKTRWEEATGYINDMTKP-----------GMSDQERFDGLLSVFGMAAPAQLRRFTARCDPDNHKNIISIDQSPISIRVPRRMLEQTRYDPGCFPSRMLADHLKELGAETGFDPKDTTTTFAQHLKEL................................................................................................................................................... 169
274 4.000e-05UniRef50_A0A2N1V8G0 Uncharacterized protein n=1 Tax=Ignavibacteriae bacterium HGW-Ignavibacteriae-4 TaxID=2013811 RepID=A0A2N1V8G0_9BACT  ali  14  484.........................................................................................................................................................................KSLQEIPNCIENLNNLERILLSDNQLISLP--ESIGNLQNLRGLELNSNQLTTIPESINLANLNLGYNKLTTLPESFDNLQSLLTVSFENNNLSSLPNGLEGGRLQELNLNYNQLTTLPESIGNLLQTLNLHKNQLTSLPE......... 629
275 4.000e-05UniRef50_UPI000D11B25E hypothetical protein n=2 Tax=Escherichia coli TaxID=562 RepID=UPI000D11B25E  ali  16  438.......................................................................................................................................................................................................................................LDVSNNQLSGLP-ALPAGLVTL--DVRFNLMSSLPELP--GYMRTLNVSNNQLIHLPV-LPVRLKVLDVSNNQLTSLPDR........ 511
276 4.000e-05UniRef50_UPI000977BE9B hypothetical protein n=1 Tax=Bradyrhizobium mercantei TaxID=1904807 RepID=UPI000977BE9B  ali  11  15..............................................................................................................................................ESSLDEMLDAWASADGQSETEDRQEAARRTRTWRAAGNVDEALNLSRLSLTAVPTALPEELRDL--NVGNNRLTSLPA-ALPAVLQTLRCNVDQIVG--APSYLPAPLRSL--SANHNALSSPPDVLPAG-LQELDVRANHLTGLPDTLPAQLARLVVGNNRLTSLP.......... 173
277 5.000e-05UniRef50_A0A2A2H340 Uncharacterized protein n=1 Tax=Arsenophonus sp. ENCA TaxID=1987579 RepID=A0A2A2H340_9GAMM  ali  11  91.....................................................................................................NFYIHRNKLVFLPNNLPVDLKHLDFHSNLIVQLPEKLPNFL--QFLSASNNKLKILPNNLPDSLQQDISGNQLSILPDHLPQKLKILLVDNNYLTTLP-----DNLPVDLNVINAHNNQLAKIPAYLPFKLTNLDLSYNKLTNFLTNLSSYLTLDISNNQLTELPKNLP-DKLEKLSVHNNQLTSLPDKLPNSLTTLNVSNNQLVSLPDN........ 294
278 5.000e-05UniRef50_R1EIG7 Miro domain-containing protein n=1 Tax=Emiliania huxleyi TaxID=2903 RepID=R1EIG7_EMIHU  ali  15  177................................................................................................................................................................................................................................KLVTLQKLDVSRNQLRALPEAIGKLVKLQRLDVEHNQLGALPEALDQLVLQYLDVSYNQLCALPKEITQLLQELDVSNNQLRALPE......... 265
279 5.000e-05UniRef50_UPI000ABC77BC hypothetical protein n=1 Tax=Candidatus Thiosymbion oneisti TaxID=589554 RepID=UPI000ABC77BC  ali  3...........................................................................................................HGTAYHNAERKIEDALHNQATELDLSLDHDT---EDSLRLTELPESLWLERLDLSENRLTTVPASVSRLTQLRVLDSGNRLTVLPESLSRLTRLEWLHLSWNRLTTLPESLSR-----LTRLEFLDLSENQLTTVPESLSRLTQLELLSLSRNRLTALPESLIQLQLQALFLSGNRLTTLPESLSRLLELLHLSKNQLTALP.......... 204
280 5.000e-05UniRef50_A0A2X5BNJ4 E3 ubiquitin-protein ligase SlrP n=6 Tax=Salmonella choleraesuis TaxID=28901 RepID=A0A2X5BNJ4_SALET  ali  15  220..................................................................................................................GNIKTLYASCNQLTSIPASLPDTIQEME-----LSINRITELPERLPSALQSLDLFHNKISFLPENLPEELRYLSVYDNRIRTLPEHLPSGIIRNVQSNSLTALPETLPPGLKNLEA---GENALTSLPASLPPELQVL--DVSKNQITVLPETLPPT-ITTLDVSRNALSNLPENLPAALQIMQASRNNLVRLPE......... 405
281 5.000e-05UniRef50_A0A2X5C4K7 E3 ubiquitin-protein ligase SlrP n=1 Tax=Salmonella enterica subsp. enterica serovar Heidelberg TaxID=611 RepID=A0A2X5C4K7_SALET  ali  14  208..........................................................................................................................................................NNELKSLPENLQGNIKTLYANSNQLTSIPATLPDTIQEMELSINRITELPERLPSLFHNKISCLPENLPEELRYLSVYDNS---IRTLPAHLPSGITHL--NVQSNSLTALPETLPPG-LKTLEAGENALTSLPASLPPELQVLDVS.................. 354
282 6.000e-05UniRef50_F4SYE9 Leucine-rich repeat protein, induced by the SPI-2 (Fragment) n=2 Tax=Escherichia coli M605 TaxID=656417 RepID=F4SYE9_ECOLX  ali  12  31.......................................................................................................................................................................................AQNYEAVWSAWKRAAPPEEVSDRTRVILRDIRD----------GKTSALELYNLNISSLPDCLPDGLHTLKITETP--LTALPALPDG--LAFLEITGTSLTELPA-LPDGLESLEISGTPLT............. 140
283 6.000e-05UniRef50_E9CQ54 Putative leucine-rich repeat-containing protein (Fragment) n=1 Tax=Serratia symbiotica str. Tucson TaxID=914128 RepID=E9CQ54_9GAMM :_  ali  11  1..................................................................................................................................................MLPVNNNPDLPVQTYLHSATDTPSSGSVSQTATVPLRPDEYYALWSEWEENAPPGMGEKRDIAVAR-MRECLETGKEL-------LDLIELQLSSLPESLPPYIRELI--VYGNHLSKLPDNLPETLI-AINACDNILMKIPTNTPPGIISFYLENNYLEVI........... 151
284 6.000e-05UniRef50_A0A2A2HLZ2 Uncharacterized protein (Fragment) n=1 Tax=Arsenophonus sp. ENCA TaxID=1987579 RepID=A0A2A2HLZ2_9GAMM  ali  46  1MSLSININNNHFIEINESRVKRLLSGNKDYATYMGILDKIKDLFRTEKKSVA........................................................................................................................................................................................................................................................................... 53
285 6.000e-05UniRef50_S4JJU9 Leucine Rich repeat-containing domain protein n=2 Tax=Salmonella enteritidis TaxID=149539 RepID=S4JJU9_SALEN  ali  21  23..........................................................................................................................................................................................................................................GENALTSLPASLPPELQVL--DVSKNQITVLPETLPPTIT-TLDVSRNALTNLPENLPAALQIMQASRNNLVRLPE......... 95
286 7.000e-05UniRef50_A0A1Y2HTM5 Uncharacterized protein n=1 Tax=Catenaria anguillulae PL171 TaxID=765915 RepID=A0A1Y2HTM5_9FUNG  ali  11  552...............................................................................................................................................................................................................EETRMDATTSATMADGGPILTADMSTYPNLTATTLESLALAHTSNPRSPLRTLTLTRFPDLSPLASLTDLSLTHCHLTSLPASLPTSLATLDLSHNPLVRLPADGLC..... 666
287 7.000e-05UniRef50_A0A1G7XR05 C-terminal novel E3 ligase, LRR-interacting n=1 Tax=Bradyrhizobium sp. Rc2d TaxID=1855321 RepID=A0A1G7XR05_9BRAD  ali  12  1......................................................................................................................................................................................................................MATNWPVCPPFSATLRDLAAPSNQLTSLPD-LPASIQSP--DVEHNQLTELPEPLPSG-IELLSASDNRLVRMP-ELPADLEALDVSNNRLTDVPE......... 91
288 7.000e-05UniRef50_A0A2U1KJH9 Leucine-rich repeat domain, L domain-like protein n=1 Tax=Artemisia annua TaxID=35608 RepID=A0A2U1KJH9_ARTAN  ali  15  362..............................................................................................................................................................................................................AEEVKEEMADILQDALVNGVAR---IDLSNRRLPFIPEAFGKLCTLVSLNLSSNKLNAIPESLAGLELEELNVSANMLESLPDGIGKLLQILNVSRNKLTFLPEGICCRSLV. 474
289 7.000e-05UniRef50_D2U1Y6 YopM-like, LRR containing protein n=1 Tax=Arsenophonus nasoniae TaxID=638 RepID=D2U1Y6_9GAMM  ali  12  149...............................................................................................................................................SVFDVSDNQLTAIPHNLPPSLTILYINKNNLESLSDNLPNELFYLDASDNPLTALPNKPFKLEKLMVNNAFLTALPNTLPDELYHLSVSNN---QITALPAKLPPKLQALTIDI--NQLSVLPNQLPAL-LRMLNVASNKLTCLPEVLPEDLILLDVSHNQLKALPK......... 310
290 7.000e-05UniRef50_A0A2B4RT30 G-protein coupled receptor GRL101 n=1 Tax=Stylophora pistillata TaxID=50429 RepID=A0A2B4RT30_STYPI  ali  11  92...........................................................YNQLEELPSKAFFENHNLEELDLSYNQLEELPSKAFLENYNLE--------ELFLNNNNIKNLSSNQLPRISLWGKK----------LRNLDLSHNQLKDLPPEVFSRFTYLLKIDLSYN-QLEQLPSRAFLNNFNLQELFLN-NNNIKNLSSDQLPRMYRQGDSKELRNLTLDFNKL--ETLPSDLFKHYKLIDLRLSGNRLEKLPRNILQGMLEEVDLSYNQLQSLPPGISTNLTILDLSNNKIQHLPEE........ 326
291 7.000e-05UniRef50_UPI00082DC3E0 hypothetical protein n=1 Tax=Bordetella sp. H567 TaxID=1697043 RepID=UPI00082DC3E0  ali  13  82......................................................................................................................................................................................................................................ELDLSKNRLTRLP-TLPCGIQTLILAQ--NQFETLPAFLPG-KLQRLDVSYNSLSALPETLPAGLISIDATRNALQSLP.......... 156
292 7.000e-05UniRef50_P55456 Probable E3 ubiquitin-protein ligase NGR_a03640 n=44 Tax=Rhizobiales TaxID=356 RepID=Y4FR_SINFN  ali  16  105.................................................................................................................................................................................................................LRRLNVNNNQLGDLPDTLTLLELEASENRLTRLPD-LPAGLQRL--NVENNRLTNLPEPLPAA-LEWLGAGYNQLTRLPEMIPPELIWLGARNNQLTSVPE......... 203
293 8.000e-05UniRef50_A0A1C3XH94 Uncharacterized protein n=1 Tax=Bradyrhizobium yuanmingense TaxID=108015 RepID=A0A1C3XH94_9BRAD  ali  11  55...............................................................................................................................................................................................ENWAAERDVGPLEDREEALTRLNLSEFNQH----------LDLESLSLTSLP---RFSTDLRRIDVPFNRLTRLPHTLPAT-LESLNVGHNQLTNLPT-LPAVLAYLDASNNRLANLPD......... 158
294 8.000e-05UniRef50_A0A261UI72 Uncharacterized protein n=2 Tax=Bordetella TaxID=517 RepID=A0A261UI72_9BORD  ali  12 1011..................................................................................................................................SHHDLDSVPPLPADVRVLIMSHNPVRDWSHLPERLSVLRAEGTRMTRLPSNLPAGLLELDVSGNLLRTPALVFPPGLRRLDIGRNRLGSLPLLPASLRELISDGNHLRLSGLPSELR------LVDVSDNQIARLPANLPAG-LKVLYASRNRLAQLPGRLPATLEELDVSSNRLRELTR......... 1184
295 1.000e-04UniRef50_A0A2Y5RUL1 Invasion plasmid antigen n=3 Tax=Shigella flexneri TaxID=623 RepID=A0A2Y5RUL1_SHIFL  ali  16  15................................................................................................................................................................MHQINNIHSLTLFSLPVSLSPSCNEYYLKVWSEWEKNGTPGEQRNIAFNRLK---ICLQN-------QGAELNLSELDLKTLPD-LPPQITTLE--IRKNLLTYLPDFPPM--LKVIHAQFNQLESLPA-LPETLEELNVGDNKIKELP.......... 147
296 1.000e-04UniRef50_UPI00080C6027 E3 ubiquitin-protein ligase ipaH3 n=3 Tax=Shigella TaxID=620 RepID=UPI00080C6027  ali  17  24........................................................................................................................................................................................ADYFSAWDKWEKQALPGENRNEA-------VSLLKECLIN---QFSELQLNRLNLSSLPDNLPPQITVLEITQNDNHLSTLPELPAS--LKHLDVDNNQLTMLP-ELPALLEVLSVRNNQLTFLPE......... 154
297 1.000e-04UniRef50_UPI0005EE4FD1 LOW QUALITY PROTEIN: E3 ubiquitin-protein ligase LRSAM1 n=1 Tax=Strongylocentrotus purpuratus TaxID=7668 RepID=UPI0005EE4FD1 :  ali  11  53....................................................................................................................................................KSNKDVWEVEVIMHKQSNEAKKRMEHCQFLAQASPEPNYDLSKCELTEVLQCKVLRKEVLIMSDNLLSSLNGGNIKDLSLLRVLDLRNNRFAQLPDALTELGQLQVLDVTDNKLKQLPKSIKLHALQTLNARGNSLKELPDSVCQMLRTLDISHNQIRSLPRRFC...... 226
298 1.000e-04UniRef50_A0A2Y5LL04 Invasion plasmid antigen n=4 Tax=Shigella TaxID=620 RepID=A0A2Y5LL04_SHIFL  ali  16  15................................................................................................................................................................MHQINNIHSLTLFSLPVSLSPSCNEYYLKVWSEWEKNGTPGEQRNIAFNRLK---ICLQN-------QGAELNLSELDLKILPD-LPPQITTLE--IRKNLLTYLPDFPPM--LKVIHAQFNQLESLPA-LPETLEELNVGDNKIKELP.......... 147
299 1.000e-04UniRef50_UPI000CF70C80 hypothetical protein n=1 Tax=Shigella dysenteriae TaxID=622 RepID=UPI000CF70C80  ali  18  4.................................................................................................................................................................TNNNHRLISNSFSTYSIDTSRAYENYLTHWTEWKNNRIQEEQRDIAF---QRLVSCLQN-------QETNLDLSELGLTTLPEIPPGIKSINISKNNLSLISPLPASLTQ-----LNVSYNRLIELPA-LPQGLKLLNASHNQLTTLP.......... 135
300 1.000e-04UniRef50_A0A0G0FMV3 Uncharacterized protein n=1 Tax=candidate division TM6 bacterium GW2011_GWA2_36_9 TaxID=1619072 RepID=A0A0G0FMV3_9BACT  ali  13  17...........................................ICMDEKMDVEEPAERLISLPEGEEPRNVDLNQEDPIAYETFATMISAINLAIEKKEEQIPHLRLAEVVTTIDEKPFYHHFLSDSIDDYIKDQVLNKHQNPENPLNRQPITRIYFYTYHPE--ERNFTRDELILEPPFAIQEDAIVHQDAPDLEA---------LENLLQELSPRAHAHRYNQERQRLDLSNLDLYSENIPADFFTRLAHILPDVSNNDLERLPDTIGNLALKRLNVYNNQLRSLPESIGTLLQELDVSHNHLGSLPE......... 283
301 2.000e-04UniRef50_P93666 Leucine-rich-repeat protein n=6 Tax=Asteraceae TaxID=4210 RepID=P93666_HELAN  ali  14  167.......................................................................................................................................................................................QKLYDTAKSAGKLSALDKRVSSMLPEVKEEMADILQDALMNGVER---IDLSRRRLPFVPEAFGKLHTLVSLDLSSNKLTAIPESLAGLSLEELNLSANLFESLPDTIGSLLQFLNVSRNKLTSLPDGICCRSLL. 306
302 2.000e-04UniRef50_A0A086E751 Uncharacterized protein n=1 Tax=Pectobacterium carotovorum subsp. brasiliense TaxID=180957 RepID=A0A086E751_PECCA  ali  17  20...................................................................................................................................................................................................................................................ESLPQNLRTLSVSY--NSLTTLPESLPQN-LRTLSVSYNSLTTLPESLPQNLRTLSVSYNSLTMLPD......... 83
303 2.000e-04UniRef50_A0A2X2PNU4 Outer membrane protein n=1 Tax=Yersinia pseudotuberculosis TaxID=633 RepID=A0A2X2PNU4_YERPU  ali  10  64.......................................................................................................................................ECLENNADKLNLHNLDLTSLPDTLPPCNELEISNNNITELPTLPNNLQRLMAICNQLRTLPDTLPEHLLSLY--VISNKLERLPENLPESLNTLNVCDNPSLQ---FPNNWPSNLMYLNIA--DCELTELPTLP--NTLTELYADFNQLRTLPDTLPTSLLKLSVTSNQFTQLPE......... 229
304 2.000e-04UniRef50_UPI0009AE440B hypothetical protein n=1 Tax=Salmonella choleraesuis TaxID=28901 RepID=UPI0009AE440B  ali  12  23.......................................................................................................................................................................................NTSYYTLWQTWASEAIVGEGEQRDIAVERLCACLSNQKSI--------LDLGDLSLHTLP-LLPACVSTL--NISNNHLSTLPDLPEG--LRDLTCAGNTLTSLPALPPT-LQALDCSQNKLSEL........... 133
305 2.000e-04UniRef50_A0A2U8I3C4 Uncharacterized protein n=1 Tax=Candidatus Fukatsuia symbiotica TaxID=1878942 RepID=A0A2U8I3C4_9GAMM  ali  11  55.....................................................................................................................................................................................................................VINKLKECLR---VNAVELDLSGCDLTHLPEKLPPLVQVLKVA--GNWLTHLPEKLP-PSLRELDVSYNQLISLPENLPPSLKVLCVTANCLTKLPKNPCYRSCIL 156
306 2.000e-04UniRef50_W0I1A6 Yop type III secretion system effector n=1 Tax=Sodalis praecaptivus TaxID=1239307 RepID=W0I1A6_9GAMM  ali  15  162...................................................................................................................................................LKILLACNNSLTALPERLPAGMLTLKVCNNCLSALPA----VLPTQLTHLAVDANRLSTLPNVPRLITLSANFNNLQSLPNMLHTAIATLLISKLDDALPKDILFLDASF--NQLTRLPDTLKQPRLMFLNLSNNSLTSLPACLPAGLTQIYLGHNQLTALP.......... 326
307 2.000e-04UniRef50_UPI0009BE1A5C hypothetical protein n=4 Tax=Edwardsiella ictaluri TaxID=67780 RepID=UPI0009BE1A5C  ali  12  319.............................................................................................................................................................................SSLTSLPELPSELRSLISNTSLTSLPELPSELRSLNISNTSLTSLPE--LPSELRSLNISNTSL--TSLPE-LPSELRSL--NISNTSLTSLPELPSE--LRSLNISNTSLTSLPELPP-GLQTLNASNTQLTSLPE......... 446
308 2.000e-04UniRef50_C5BD30 Uncharacterized protein n=11 Tax=Enterobacterales TaxID=91347 RepID=C5BD30_EDWI9  ali  10  299.............................................................................................................................................................................TSLTSLPELPSELRSLISNTSLTSLPELPSELRSLNISNTSLTSLPE--LPSELRSLNISNTSLTLPELPSELR------GLNISNTSLTSLPELPSE--LRSLNISNTSLTSLPELPP-GLQTLNASNTQLTSLPE......... 426
309 3.000e-04UniRef50_A0A193FZL6 Uncharacterized protein n=2 Tax=Bordetella bronchialis TaxID=463025 RepID=A0A193FZL6_9BORD  ali  17 1078.........................................................................................................................................................................................................................................LRENGLEALPAGLPRGLELL--DASNNALTRLPDDLPST-LRVLHAEHNRLQQLPV-LPDGLDELAVSWNRLQSLGELPRSLRIL. 1158
310 3.000e-04UniRef50_A0A098LJV3 Uncharacterized protein n=1 Tax=Sporocytophaga myxococcoides TaxID=153721 RepID=A0A098LJV3_9BACT  ali  14  287.................................................................................NCFETIPENPRPEFLTRFVVTPNNENCE-AFLAKYVTIPDPNFRTFLISKYPSCFNTSQKMDTTCSKITEVTLLEASSKNIQDLDGIQYFENLYRLNCTANKLKALPKKLPPHLASLDISNNEESLPAIPENLLYCSQNKLTPKLTALGCINNSIENLPALPDGL------TDFGCSNNRLVTLPALPP--LLKILNLKNNLLQSLP-ELPSKLTHLYCNNNELTKLP.......... 513
311 3.000e-04UniRef50_A0A1I8IL12 Uncharacterized protein n=2 Tax=Macrostomum lignano TaxID=282301 RepID=A0A1I8IL12_9PLAT  ali  12  518............................................................................................................................NRISSISERLADRLKPIRRINFRMNQISLNGTSSMKLDRFQHLAYLDLRDNLIESLDLGDLALLEFFCCERNRLAELKLNGRSLLLEDNRLASLDIEPQPEYLEYLDASHN--RLTQLPAYLGELKRLVHCRLSHNFLTELPPFLDGRQLKALIAGHNAIHSLPDEIDCGIEELQLQHNWLSRLPD......... 707
312 3.000e-04UniRef50_A0A1I8HRB6 Uncharacterized protein n=2 Tax=Macrostomum lignano TaxID=282301 RepID=A0A1I8HRB6_9PLAT  ali  12  412............................................................................................................................NRISSISERLADRLKPIRRINFRMNQISLNGTSSMKLDRFQHLAYLDLRDNLIESLDLGDLALLEFFCCERNRLAELKLNGRSLLLEDNRLASLDIEPQPEYLEYLDASHN--RLTQLPAYLGELKRLVHCRLSHNFLTELPPFLDGRQLKALIAGHNAIHSLPDEIDCGIEELQLQHNWLSRLPD......... 601
313 3.000e-04UniRef50_A0A0E4BM58 Uncharacterized protein n=2 Tax=Bradyrhizobium TaxID=374 RepID=A0A0E4BM58_9BRAD  ali  12  83......................................................................................................................................................................................................................................QLDLSSLSLTTLRPALPPEI--EVFRVRDNQLTSLPVLPDG--LRVFNAAGNQLTSLLAVLPSRLRSLIIGENSLTSLP.......... 157
314 3.000e-04UniRef50_A0A2X5BVC1 E3 ubiquitin-protein ligase SlrP n=1 Tax=Salmonella thompson TaxID=600 RepID=A0A2X5BVC1_SALTH  ali  14  1..............................................................................................................................................................................................................................................................MNVQSNSLTALPETLPPG-LKTLEAGENALTSLPASLPPELQVLDVSKNQITVLPE......... 55
315 4.000e-04UniRef50_A0A1X1EL27 Uncharacterized protein n=1 Tax=Pantoea cypripedii TaxID=55209 RepID=A0A1X1EL27_PANCY  ali  13  4......................................................................................................................................................VNNHLSSPSFLRANSDSAQQSGNIDGTPAQPQTKEEYLAHWRQWAQEAPAGEQRDRAVNI---MLDCFERHS-------NVLYLPNLSLSSLPTFIPQHIETLDLSNNQNLNFQLPPH-----VTDLCVDHNELTSLPEPLPENLTRLYVSHNQLNFLPE......... 173
316 4.000e-04UniRef50_A0A2B4RD48 G-protein coupled receptor GRL101 n=4 Tax=Stylophora pistillata TaxID=50429 RepID=A0A2B4RD48_STYPI  ali  12  305.....................................................................................................................................CDVDNSLKRFWEIEKSSRDRNDGLVLTEEEILALSTVKDSLKYKNGRWLGNNNLKNLSEDLFTGQDMLKYFD----LSYNQLEKLPSGAFFLNRDIQELTLDFNKLEALPSDLFKDYRLNDLRLSGNRLEKLPPNILQGMLEEVDLSYNQLQSLPRGINTNLKVLDLSNNKIQHLPED........ 483
317 4.000e-04UniRef50_UPI000A39D011 hypothetical protein n=2 Tax=Actinobacteria TaxID=201174 RepID=UPI000A39D011  ali  10  2........................................................................................................................................................................................................................................NLWRQRLGTVPESVWEHRGLDVLILADNDLTELPRIGELGRLRTLDLGHNLLTAVPEEIPQVTDFLYLHDNRLTELP.......... 79
318 4.000e-04UniRef50_UPI000BF7E997 protein lap4-like isoform X1 n=22 Tax=Varroa TaxID=62624 RepID=UPI000BF7E997  ali  13  28................................................TSAAIAAVVSLATSSLNVASMFYRCRRRLHHLGQHLFRLQKLRSFSASDNIQIPQDIGNWQLLQELDLSKNDIQDIPELLDLSQNCLYRT--PDFIVELKNLTALYLNDAATLTSLINLELRDNLLKMLPDSFGQLLRLERLDLGGNEIEELSPVIGRLESLEELWLDCNSLTRLPPETRLKCLDVSENRLEVLPNELCHLKMLSDLLLSQNVLKKLPDIGKLRKLTILKADQNQLSHLPDSLGQNLQELILTDNELMQVPPD........ 315
319 5.000e-04UniRef50_A0A0L0D691 Uncharacterized protein n=1 Tax=Thecamonas trahens ATCC 50062 TaxID=461836 RepID=A0A0L0D691_THETB  ali  15  159.........................................................................................................................................................................................LRELVLSNNELSEFPEEVLG-LKNLERLMLSNNTIGEISKLRSLRELSLARCGLSEIPDTVGNLKRLKILILRNNALTELPATLGFLSRKKLDVEGNELTQLPRQLSGMLEELYLQHNGLTELPAD........ 290
320 5.000e-04UniRef50_W4XGB1 Uncharacterized protein n=1 Tax=Strongylocentrotus purpuratus TaxID=7668 RepID=W4XGB1_STRPU  ali  12  80......................................................................................................................................................................QFLAQASPEPNYDLSKCELTEVLAGTYSQCKVLRKEVLIMSDNL----LSSLNGGNIKDLSLLRVLDLRNNRFAQLPDALTELGQLQVLDVTDNKLKQLPKSIKLHALQTLNARGNSLKELPDSVCQMLRTLDISHNQIRSLPRRFC...... 226
321 5.000e-04UniRef50_D2U1Z0 Yop type III secretion system effector protein n=1 Tax=Arsenophonus nasoniae TaxID=638 RepID=D2U1Z0_9GAMM  ali  14  66................................................................................................................................ELDVSDNQLTNLPNNLPKALTHLYVGQNQLTSLPEYLPEELLALRANANKLTALSDMSLNISENQIISLPSELPANLRLLNVGDNKLSALPDNLPSSLGVLFVDKN---NLESLPNKLPNSLWYLKVSDNP--LTALPNQLPSM-LQTLEVKNAFLTALPNSLPDTLWNLKVSNNQITALPAK........ 248
322 5.000e-04UniRef50_G5NAF6 Secreted effector protein (Fragment) n=41 Tax=Salmonella choleraesuis TaxID=28901 RepID=G5NAF6_SALET  ali  10  7..................................................................................................................................................................................................................................................................NNRLTSLPALPSG--LKELIVSGNRLTSLPM-LPSGLLSLSVYRNQLTRLPE......... 55
323 5.000e-04UniRef50_W4XS40 Uncharacterized protein n=1 Tax=Strongylocentrotus purpuratus TaxID=7668 RepID=W4XS40_STRPU  ali  13  46..................................................................................................................................................................................................................SDNLLSSLNGGNIKDLSLLRVLDLRNNRFAQLPDALTELGQLQVLDVTDNKLKQLPKSIKLHALQTLNARGNSLKELPDSVCQMLRTLDISHNQIRSLPRRFC...... 152
324 5.000e-04UniRef50_A0A0E8XNQ2 Outer membrane protein n=26 Tax=Yersinia pseudotuberculosis complex TaxID=1649845 RepID=A0A0E8XNQ2_9GAMM  ali  10  64.......................................................................................................................................ECLDNNADRLNLHNLDLTSLPDTLPPCNELEISNNNITELPTLPNNLQRLMAICNQLRTLPDTLPEHLLSLY--VISNKLERLPENLPESLNTLNVCDNPSLQ---FPNNWPSNLMYLNIA--DCELTELPTLP--NTLTELYADFNQLRTLPDTLPTSLLKLSVTSNQFTQLPE......... 229
325 5.000e-04UniRef50_UPI00046D71A9 hypothetical protein n=1 Tax=Candidatus Sodalis pierantonius TaxID=1486991 RepID=UPI00046D71A9  ali  17  8......................................................................................................................................................................................................................LQSLPNMLHTAIATLPISNNW---LDQLDDALPKDILFLDASF--NQLTRLPDTLKQPRLMFLNLSNNSLTLLPTCLPAGLTQIYLGHNQLTALP.......... 99
326 5.000e-04UniRef50_A0A093SSL6 Uncharacterized protein n=2 Tax=Pectobacterium TaxID=122277 RepID=A0A093SSL6_9GAMM  ali  10  271.............................................................................................................................NINNNRLKNLPNSLPQETTHLDVSANKLVTLPVSLPQKITHLNLSDNRLETLPASLPQKITRLNISNNRLKTLPSLPQETTHLDVSANKLVTLPVSLPQKITYLNISDN---RLVTLPDSLPQETTHL--DVSANGLETLPVSLPQ-KITYLDASYNRLETLPVSLPQGIIYLDVSHN................ 443
327 5.000e-04UniRef50_UPI000B42BC70 hypothetical protein n=1 Tax=Escherichia coli TaxID=562 RepID=UPI000B42BC70  ali  20  16...................................................................................................................................................................................................NKIPFENITIDLSALEKEALASLKYCNFKKVTFTGAISYENLNGSVFGNCFFEDCIFENVSLVSSRY......................................................... 82
328 6.000e-04UniRef50_Q8VSC3 E3 ubiquitin-protein ligase ipaH9.8 n=1229 Tax=cellular organisms TaxID=131567 RepID=IPA9_SHIFL  ali  13  24........................................................................................................................................................................................ADYFSAWDKWEKQALPGEERDEA-------VSRLKECLINNSDELR---LDRLNLSSLPDNLPAQITLLNVSYNSNKLSELPVLPPA--LESLQVQHNELENLPALPDSLLT-MNISYNEIVSLP.......... 153
329 7.000e-04UniRef50_UPI000CF30403 hypothetical protein n=1 Tax=Escherichia fergusonii TaxID=564 RepID=UPI000CF30403  ali  13  49.............................................................................................................................RVLDTSSNELTVLPELPHSLRTLNVLSSWLTTLPDLPASLEMLYVSSFLLTTLPDLPDSLRTLCVSNTRLTALPDLPDSLRTLCVSDTGLTALP--DLPASLTKLVVSYNE-HLTALPE-LPDSLRTLDASF--NHLTALPELPDS--LRTLDAPFNHLTDLPP-LPASLENLQVFNNQLTSLPD......... 224
330 7.000e-04UniRef50_A0A0T9JDF3 Leucine rich repeat domain-containing protein n=26 Tax=Yersinia pseudotuberculosis complex TaxID=1649845 RepID=A0A0T9JDF3_YERPU :  ali  11  16...........................................................................................................................................................................TLDSDSTHQKLSKSDYHAIWKKWEKTDFLGEGENRDMAV-KAMKIHLKNKN------ATELNLNNLGLRSLPDILPPCTTLNV---SNNYLTELP-LLPANLTH-LNLANNQLTKLSFPLPGNLTHLDLANNQLTDLSD......... 144
331 7.000e-04UniRef50_A0A073CEI6 Uncharacterized protein n=1 Tax=Planktothrix agardhii NIVA-CYA 126/8 TaxID=388467 RepID=A0A073CEI6_PLAAG  ali  11  2................................................................................................................................................................ITDEIREIIQEVKQQRLTELDLGFNSYDTPYEENLTEIPAEVFDLTWLNLSGNKLTSVP-KSITRLTNLSTLDLSNNRLTSVPESISRLTNLSTLGLGSNELTSVPESSRLTNLSQLNLWDNQLTSVPESIGSLLSTLELSYNQLTSVPESIGS..... 160
332 7.000e-04UniRef50_W0I3L7 Leucine-rich repeat protein n=1 Tax=Sodalis praecaptivus TaxID=1239307 RepID=W0I3L7_9GAMM  ali  13  185................................................................................................................................................RSLIVNDNQLKQLPASLPSTLTKLSANQNSLTSLPTTLPSTLYTLSVSCNRLTHLPETLPPRLEALEPPSLYRLNVGGTKWPPKLDSLDIGDTLLTELPENLPQQLTSLDISCNPMALTTLPENLPQSLNELL-VQYNQLTHLPERLPLALATLSVNNNQLTCLSE......... 388
333 8.000e-04UniRef50_A0A0G8AT00 Uncharacterized protein n=1 Tax=Candidatus Synechococcus spongiarum 142 TaxID=1608213 RepID=A0A0G8AT00_9SYNE  ali  15  102.............................................................................................................................................................................................................RWLYLKDNSLSSLPADVFARLSGMLNLDLSENNLSSLPEDVFSGLSLLSISLNNNKLSSLPEDLFAGLLTTIDLNNNELSSLPEDVPSKLHTLNLNNNELSSLPED........ 214
334 1.000e-03UniRef50_A0A2P6CT27 Uncharacterized protein n=37 Tax=Leptospira TaxID=171 RepID=A0A2P6CT27_LEPIR  ali  14  89............................................................................................................................................................EIGQLENLQELDLRDNQLATFPAVIVELQKLESLDLSENRLIILPNEIGRLQNLQDLGLYKNKLTTFPKEINLQKLWLSENRLTALPKEIGQLKNLQTLDLQNNQFTTLPKEIGQLQLQTLNLSDNQLATLPVEIGQLLQELYLRNNRLTVFPKE........ 250
335 1.000e-03UniRef50_UPI000B53BA43 effector protein n=2 Tax=Salmonella choleraesuis TaxID=28901 RepID=UPI000B53BA43  ali  13  6......................................................................................................................................................................DYAGRITPTASEASPAANTSYYTLWQTWANEAIVGEGEQRDIAVERLYACLSNQESI--------LDLGELNLRTLP-LLPACVSTL--NVSNNHLSALPDLPKG--LRALTCAGNTLASLPVLPPT-LQTLDCSQNTLSEL........... 133
336 1.000e-03UniRef50_UPI000CD6417F leucine-rich repeat-containing protein 15-like isoform X1 n=2 Tax=Paramormyrops kingsleyae TaxID=1676925 RepID=UPI000CD6417F :  ali  15  139...................................................................................................................................................................................SSLQNLQRLFLSGNKISHLPQELFRGRQLDLSKNALRVIPEGIFDDLSNLESLSLKDNQIEHLPSNLFSSLENLVTLYSRNNLVRLPEFLHVTRLQKLSLFQNRLENLGTSVPLLLTELWLYSNNLTRL-EDGIFRNL.. 284
337 1.000e-03UniRef50_A0A1J0E212 Uncharacterized protein n=2 Tax=Providencia rettgeri TaxID=587 RepID=A0A1J0E212_PRORE  ali  22  31...................................IWGHIREWFSPKLEPLAYECLNDFYH---------VDLLVTPPEQLESFLTLKSLASQGHQNNFTTE......................................................................................................................................................................................................................... 88
338 1.000e-03UniRef50_A0A0M9DZF2 Leucine rich repeat protein n=2 Tax=Desulfobacteraceae TaxID=213119 RepID=A0A0M9DZF2_9DELT  ali  14 1263.............................................................................................................................DALNISYNKLISLPEWLGLFEYLSTLDISHNNLMNLPENFVNLMYLSELNLSHNQ--------LTSLPENFGSLISLMILDLSNNQ---LASLPE-SLVSLGSLMKLDLSNNLLTSIPDIFFNCQYLMIIDLSNNQLSGLPESLSNLMLESLNLSHNQLTSIPDIFNSAIRVLNISHNQLNSLP.......... 1437
339 1.000e-03UniRef50_UPI000932B5A1 hypothetical protein n=1 Tax=Candidatus Fukatsuia symbiotica TaxID=1878942 RepID=UPI000932B5A1  ali  17  140..............................................................................................................................................................................................................................................LTKLPKNLPPLLQELY--INHNQLDDLSENLPG-SLEVLNVAANCLSHLPITLPMKLTVLDLSYNEFTELPAAICT..... 212
340 1.000e-03UniRef50_A0A1Z4Q533 Leucine-rich repeat-containing protein n=8 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1Z4Q533_9CYAN  ali  15  49..................................................................................................................................................................NLSDNQLRELPEAIASLSQLQQLNLSGNKLTELPEAIASLTQLQLLNLSDNQLRELPE-AIASLSQLQQLNLLGNQLTELPEAIASLSQLQQLDLSDNQLRELPEAIASLQLQQLNLSYNQLTELPEAIASLLQQLDLSHNQLTELPE......... 198
341 1.000e-03UniRef50_UPI0004A0BF41 hypothetical protein n=1 Tax=Escherichia coli TaxID=562 RepID=UPI0004A0BF41  ali  14  228............................................................................................................................................................................................................................................................LELELANLMLTSLPELPAG--LEKLDVSGNQLCSLPV-LPAGLEKLDVSGNQLCSLP.......... 281
342 1.000e-03UniRef50_D2TXL0 LRR-MCF ORF3 n=3 Tax=Arsenophonus nasoniae TaxID=638 RepID=D2TXL0_9GAMM  ali  11  239......................................................................................................................LPDNLPDDLRNIDVHSNWLAVLPDKWPKFLQFLSVSNNKLKTLSNSLPDALQHLNVSGNLLRNLPDHLPNQLKILLVDNNHLSVIADNLPADLNVLDAHNNQLVKIPIYLPYKLTSLDLKLTNLLTDLSNNLTTL--DVSNNRLSDLPDKLP-DKLEKLAAHDNRLTSLPEQLPSSLVSLNVSNNQLDNLPD......... 430
343 1.000e-03UniRef50_A0A192M565 Uncharacterized protein n=26 Tax=Rhizobium TaxID=379 RepID=A0A192M565_9RHIZ  ali  12  95................................................................................................................................................QRLNANDNRLGRLPNNLPPGLRKLSACDNQLTTLPEVLPDMLETLYVDGNRLTRLPNELPSRLKYLNHNRLTSLPD-NLPPELRELHVTRNEI--AHLPENLPLELTDLRAELNN--IIRLPERLPAKLTR-LEVPHNELTSLPEDLPATLKWLSTDSNELTHLPPN........ 257
344 1.000e-03UniRef50_D2U1Y7 N-terminal half of LRR-MCF ORF1. Contains LRR and RTX-like regions n=2 Tax=Arsenophonus nasoniae TaxID=638 RepID=D2U1Y7_9GAMM  ali  14  2...............................................................................................................................................................................................................................................TALPNSLPIMLKHL--DGHNNLLTSLPTNLP-NILITLNVSHNQLISLPNNLSNKLKKLDISSNQLTALPD......... 69
345 1.000e-03UniRef50_A0A2X4VK29 Secreted protein in the Sop family transferred to eukaryotic cells n=2 Tax=Salmonella enterica I TaxID=59201 RepID=A0A2X4VK29_SAL  ali  68  1MPVTLSFGNHQNYTLNESRLAHLLSADKEKAIHMG............................................................................................................................................................................................................................................................................................ 35
346 0.002UniRef50_L1J3U1 Uncharacterized protein (Fragment) n=1 Tax=Guillardia theta CCMP2712 TaxID=905079 RepID=L1J3U1_GUITH  ali  21  15.................................................................................................................................................................................................................LENNNLESLPEGIFNGLSRLGQLNLYNNELSSLPAAIFNGLSNLQYIYLNTRISRLPEFNGLGRLAILRLHDNELESLPAGLLGTLQYLYLNNNQLKSLP.......... 120
347 0.002UniRef50_A0A2G8L8B7 Uncharacterized protein n=1 Tax=Stichopus japonicus TaxID=307972 RepID=A0A2G8L8B7_STIJA  ali  15  74.................................................................................................................................................................................................................LSDNELTMLPNGYFNNFTHVTCLNLSFNRLQNFTDVLIETSNLLILNLSHNHLTSIPPFSQVKQLEMLDLSHNMLTEIPNTLFGNLHNLYLNHNKLTKLPEN........ 181
348 0.002UniRef50_A0A0C1H496 Leucine-rich repeat-containing protein 1 n=2 Tax=Neochlamydia TaxID=112987 RepID=A0A0C1H496_9BACT  ali  14  402............................................................................................................................................................KIGQLSQLPSLDLSDNRLTVLPAEIGQLTKLEKLDLRKNQLTALPAEIGRLSQLEHLDLSCNQLASLPQLSQLTRLWLSDNQLTALPAEIGQLSRLLELVLGNNQLTALPEFGQLGELRLLYLSQNRLTSLPITLGKGLRKLYLDNNQLATIP.......... 561
349 0.002UniRef50_A1ZDM8 Leucine-rich repeat containing protein n=1 Tax=Microscilla marina ATCC 23134 TaxID=313606 RepID=A1ZDM8_9BACT  ali  12 1115.............................................................................................................................................................................................................................SIANCSYLNEIKLNNNQITFLPNSLSNSVTYFSIDLSNNELTELPEVIPQKQLRNLNISDNKLTALPSELASELYYLRVTNNQITHLPQ......... 1207
350 0.002UniRef50_C3Y6T9 Uncharacterized protein n=1 Tax=Branchiostoma floridae TaxID=7739 RepID=C3Y6T9_BRAFL  ali  11  135.........................GNNKLSTFPAGVEKLKLYLHSNELTEVPSGVYSLSNLEVLCVARNPIRRLS--DDITRLTRLKSLIVADHFDEFEVLYAGQAGGSKFDMVPDELEDLQHLWYLSLENNLLRTLPSTMSHLHNLRVVNLWNNQFDTFPEVLCE-LPAMKELDIKNNSITRLPIALHRADKLEDLNPLTYPPRHVQGTRAIMTFLKQQNLQPQTVNGKIDLSNQGLTSIPEEVFDITGLEVLDVSNNELTSIPE--AIGRLQKLNAGGNMLTSLPQAIGSLLTHLYIYDNRLTELPPWICS..... 446
351 0.002UniRef50_UPI00084ADC39 leucine-rich repeat-containing protein 40-like n=1 Tax=Hyalella azteca TaxID=294128 RepID=UPI00084ADC39  ali  10  168.......................................................................................................................................................................................................................................LDLSDNQLSTLPQEITELKALHRLTVSHNKLTQLPKILHLPELRVLKMDHNELTCLPDLMETLLDQLDVSHNKLTALPDSIC...... 251
352 0.002UniRef50_A0A067D9M8 Uncharacterized protein n=5 Tax=Saprolegniaceae TaxID=4764 RepID=A0A067D9M8_SAPPC  ali  11  54...................................................................................................................................................................................................................................KLNTLDLSNNELTEIPAAIGQLINLKTLKLDSNQLSSLPDLSALTKLTNLVLDNNKLATLQA-LPMGLTKLSARNNQLLALPPTLCCLSQL. 143
353 0.002UniRef50_A0A164Q054 Toll receptor 8-like protein n=8 Tax=Daphnia TaxID=6668 RepID=A0A164Q054_9CRUS  ali  14  151.................................................................................................................IGDTLEDINLSQNSLGDQLNPIFSTSEFHNLKQLKRIDLSDNDLKALDDFIFKGCDRLQELRLERNSLTRVPTGTLKEVKTLQRLNLEHNNIRSLNMSHNVIANIDMTALKGLSQLQKMDLSFNKISRLSERLFQDVPVLDVDLSNNFLSSIPTSLTGLSLKRLSLSANLIQNLLGELPS-LEYLDVSRNNIAELPNGTLSR.... 371
354 0.002UniRef50_R7QK78 Leucine-rich repeat-containing protein n=1 Tax=Chondrus crispus TaxID=2769 RepID=R7QK78_CHOCR  ali  14  136.............................................................................................................................................................................................................................NIVRMTALKKLDLASNKLTSLPDAFTGMRVLEHVDLSDNKLSELPPSFAELQLTALSLGRNAFTTAPLQVTSMLMALDLSHNQITSVPE......... 226
355 0.002UniRef50_UPI000682BE97 hypothetical protein n=1 Tax=Sodalis glossinidius TaxID=63612 RepID=UPI000682BE97  ali  18  141..........................................................................................................................................................................................................................................SEANLTSLPENLPPELRNLVVPY--NELTYLPENLPMA-LEELAVGNNQITRLPENLPPLLRTLKAGNNNIEYLPVR........ 214
356 0.002UniRef50_D2U1Z2 Yop type III secretion system effector protein n=2 Tax=Arsenophonus nasoniae TaxID=638 RepID=D2U1Z2_9GAMM  ali  10  836..........................................................................................................................................KLPNSLRYLTANNNQLSSLPDNLPASIKYLTVANNQLTELPSSLPNELIELTVS----HNPLVKLPDTLPNTLKNLIVNSAWLTELPSKLPTTLNVLEVRLIKLPVNLPDSLILL--DVNNNQLPVLPKHLP-DSIKILDVSNNQLTSLPLIMPGMLENLYIRNNRLKTLP.......... 1002
357 0.002UniRef50_A0A086EY87 Uncharacterized protein n=1 Tax=Pectobacterium carotovorum subsp. brasiliense TaxID=180957 RepID=A0A086EY87_PECCA  ali  10  254......................................................................................................................LPDSLPHKLTELNVSGNRLTSLPNTLPQSLKELATNSNNLTSLSDSLPRSLEELTASSNYLTSLPKALPKNLKTLNVIRNNLVNLPDSLPKSLKTLNASHNDLTTLPNSSLQTLDIDSNKLISLPDSLPNSLKTLNASR--NYLTTLPSSLP-KSLQTLEIDSNKLISLPDSFPNSLKTLNASRNYLTTLPK......... 445
358 0.002UniRef50_A0A0E1NT89 E3 ubiquitin-protein ligase ipaH9.8 n=27 Tax=Yersinia pseudotuberculosis complex TaxID=1649845 RepID=A0A0E1NT89_YERPA  ali  12  94......................................................................................................................................................................NIIENKLTELPTTLPDNLQTLNAAFNQLRTLPNTLPASLLSLNVYGNELERLPESLPEGLKKLDVGRNESLQR---PNRLPPNLESLGMA--NCRLTELPTLP--NSLEKLEVDNNQLHTLPDTLPALLSSLLVSSNRLTALPENGSLRDI.. 239
359 0.002UniRef50_UPI000BB8DF42 type III effector protein n=1 Tax=Escherichia coli TaxID=562 RepID=UPI000BB8DF42  ali  17  2.................................................................................................................................................................................DEKAFQSGILKMQFPNDNEKIPFENMIIDLSALKKDVLVSLKQCCFKKMTFTGNISYENLNGPVFENCFFEE-------------CNFENVSLVGFDKVTCESYDVLCNVK............................... 107
360 0.003UniRef50_UPI0009479DC1 leucine-rich repeat-containing protein 15-like n=1 Tax=Branchiostoma belcheri TaxID=7741 RepID=UPI0009479DC1  ali  13  87................................................................................................................................................................................................................HLDYNRISMIHNKTFHNLTSLTELFLFYNRLTTLPADIFEGLGNLRLNLHNNQLTSLPADIFEGLLRFLYLDNNQLTSLPADIFEGLRFLYLYNNQLISLP.......... 193
361 0.003UniRef50_E0UBI6 Small GTP-binding protein n=4 Tax=Cyanothece TaxID=43988 RepID=E0UBI6_CYAP2  ali  11  126.............................................................................................................................................................................................................................TIENLVHISRLSLSYNQLTTLPSAIKGLMRLSWLDLNNNQLTTLPPEIGQNSLNQLDVGYNQLTTLPPEIGQLLNSIDVSYNKLTSLP.......... 216
362 0.004UniRef50_UPI00068C088A hypothetical protein n=1 Tax=Arsenophonus endosymbiont of Nilaparvata lugens TaxID=1247023 RepID=UPI00068C088A  ali  13  8.................................................................................................................................................................NIDPSEKRETALNRVFTCITEENSSLNLSGLNLTSLPNLPEWIIKL-DVSDNQLTRLPDELPKKLTHLLVGTN---QLTNLPEHLPETLIELQVDCNN--LVRLADNLPKGLV-SLNASHNQLISLPNYLPERLSVLKASDNKLTALPNK........ 150
363 0.004UniRef50_UPI00081433C0 leucine-rich repeat-containing protein 15 n=1 Tax=Pygocentrus nattereri TaxID=42514 RepID=UPI00081433C0  ali  11 1121...................................................................................................................................................................................................................ENKVTSMPDGIFDNLQSLKEISLHSNRITHIPNLIPHKSKLTKLLLDNNLLTELPPNLFVDFLKTLTLHHNQLTSLPSDLFGKITELGLNNNNLTSLPAR........ 1226
364 0.004UniRef50_A0A1B1TV44 Uncharacterized protein n=1 Tax=Synechococcus sp. PCC 7117 TaxID=195498 RepID=A0A1B1TV44_9SYNE  ali  14  110..............................................................................................................................................................................................................................IVQLTNLQRLDLSRNQLTTLPEVITQLSNLQILAFIGNQLTTLPEVIAQLSLRTLALSGNQLTTLPEGITQLLQALYLSFNQLTTLPE......... 200
365 0.004UniRef50_A0A2E3C3T2 Uncharacterized protein n=1 Tax=Magnetococcales bacterium TaxID=2026759 RepID=A0A2E3C3T2_9PROT  ali  15  232.....................................................RHLIKPYHGGKDGTQTAMYPDNAYGIEHEAFHKLRDYFNNGLQGKFQLDKHLYQDGITFTIEKGEV---HLPKAQQKKANVRHLPDNLRDGQCSAEDLLNHLGYKYQNQERGQLNLSGMGIRQLPDLSMVECGHLNCDQNELTELPALPQNLTSLSARSNKIETLPEKLP---SKLGSLDVSQNQLMWLPSQLPQNLDELDCSENQMLLPELPENLRILNLDNLSCALNNLSTLPGELPQNLRHLNCSHNRMIVMP.......... 509
366 0.004UniRef50_UPI0009AF4CB5 hypothetical protein n=1 Tax=Yersinia pestis TaxID=632 RepID=UPI0009AF4CB5  ali  12  15......................................................................................................................................................................NIIENKLTELPTTLPDNLQTLNAAFNQLRTLPNTLPASLLSLNVYGNELERLPESLPEGLKKLDVGRNESLQR---PNRLPPNLESLGMA--NCRLTELPTLP--NSLEKLEVDNNQLHTLPDTLPALLSSLLVSSNRLTALPENGSLRDI.. 160
367 0.005UniRef50_A0A146VK09 Extracellular matrix protein n=7 Tax=Ovalentaria TaxID=1489908 RepID=A0A146VK09_FUNHE  ali  16  312...................................................................................................................ENSLLNLTTLRKLNLDDNQIARMPALPPSLEELKINKNKLAVLTDHCFKGVRNLLKLELRANTL--YEAIVSPAAFQPLQKLQDLQLDNNRFRSLPLGLPSSLQ------VLRMNENLIEEVADEALRDCVHLKVLDLSHNYIHDHSVTGNTWSRLRSLEELDLSHNRLTSVPMNLPRFLRKLILQHNRIRQIP.......... 497
368 0.005UniRef50_K8WYE3 Uncharacterized protein n=1 Tax=Providencia sneebia DSM 19967 TaxID=1141660 RepID=K8WYE3_9GAMM  ali  11  60...................................................................................................................................................................................KEINQKEYLEDWNQWLKNSPDEEKYSRSIALSKLKKCIFHN--------ECTLDLSRLSLTSLPKLPPCIKTLSCERNRLNELPDLPKGLKYLICHSNNIS------VLPELPERLESLFCNNNQIRTLPK......... 176

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 0 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35