current user: public

If you have questions about the server, please let us know.

Query: PF14979.6; TMM52_MOUSE/30-178; Transmembrane 52, from PfamA32U

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# E-value Template Links and tools%idFirst RNCDPSDQCPPQARWSSLWHVGLILLAILLMLLCGVTASCVRFCCLRKQTHTQSHTPAAWQPCDGTVIPVDSDSPAHSTVTSYSSVQYPLGMRLPLYFGEPDPDSMVPPTYSLYASELPPSYDEVVKMIKAREEVAAPSEKTNSLPEALLast
1 3.000e-64UniRef50_A0A061ICM6 Transmembrane protein 52 n=7 Tax=Boreoeutheria TaxID=1437010 RepID=A0A061ICM6_CRIGR  ali  86 1682.NCDPSDQCPPQARWSSLWHVGLTLLALFLMLLCGVTASCVRFCCLRKQPHTQTHMPPAWQPCDLTAIPMDSDSPAHSTVTSYSSVQYPLGMRLPLSFGEPDPESMVPPTYSLYASELPPSYDEAVKMTKAREEAVTPSQKPNSLPEVL 1829
2 1.000e-43UniRef50_A0A2P4TH87 Uncharacterized protein n=1 Tax=Bambusicola thoracicus TaxID=9083 RepID=A0A2P4TH87_BAMTH  ali  48 1338......................................SCKKFCCRKKRPPVQPF---PRHPYDLTVVAIDSDSTAHSTVTSYSSFQYPPSAPIPSIFVGMDRSTVSPPAYSPYAMDLPPSYDEAVQMGKQHIEVALVNQKLSDIPGQV 1445
3 6.000e-42UniRef50_A0A0Q3LZ27 Uncharacterized protein n=1 Tax=Amazona aestiva TaxID=12930 RepID=A0A0Q3LZ27_AMAAE  ali  50 1390.......................................CIKFCCRKKRLPVETF---SRHPYDLTVIAIDSDSTAHSTVTSYSSWQYPLSAPIPSVFVDMDKNTVSLPAYSLYAMELPPSYDEAVQMGKQHIEVPWISQKCNNIPGQV 1496
4 1.000e-38UniRef50_A0A2I0TMG6 Transmembrane protein 52 n=3 Tax=Neognathae TaxID=8825 RepID=A0A2I0TMG6_LIMLA  ali  50  53.................................CGITASCIRFCCRKKRPPVETF---SRHPYDLTAIAIDSDSTAHSTVTSYSSWQYPLTAPIHSIFVDMDKNTVSPPAYSLYAMDLPPSYDEAVQTGKQCNEVARKSQKLSDIPGEV 165
5 1.000e-38UniRef50_Q9D702 Transmembrane protein 52 n=16 Tax=Euarchontoglires TaxID=314146 RepID=TMM52_MOUSE  ali  100  30RNCDPSDQCPPQARXXXXXXXXXXXXXXXXXXXXXXXXSCVRFCCLRKQTHTQSHTPAAWQPCDGTVIPVDSDSPAHSTVTSYSSVQYPLGMRLPLYFGEPDPDSMVPPTYSLYASELPPSYDEVVKMIKAREEVAAPSEKTNSLPEAL 178
6 4.000e-38UniRef50_F1N2T6 Transmembrane protein 52 n=22 Tax=Eutheria TaxID=9347 RepID=F1N2T6_BOVIN  ali  73  31.SCDPSDQCPPQARWSSLWHVGLILLTALLLLLCGVSASCVRFCHLRKRAHSQPHLPPAPEPCDLTAIPMDSDSPAHSTVTSYSSVQCWLGMQLPLPFGELDLDSTTLPAYSLYAPEPPPSYEEAIKMTKTRQE............... 163
7 2.000e-37UniRef50_J3QNP8 Transmembrane protein 52 n=9 Tax=Boreoeutheria TaxID=1437010 RepID=J3QNP8_MOUSE  ali  94  30RNCDPSDQLILLAILLML--------------LCGVTASCVRFCCLRKQTHTQSHTPAAWQPCDGTVIPVDSDSPAHSTVTSYSSVQYPLGMRLPLYFGEPDPDSMVPPTYSLYASELPPSYDEVVKMIKAREEVAAPSEKTNSLPEAL 164
8 2.000e-37UniRef50_G5ATH7 Transmembrane protein 52 (Fragment) n=5 Tax=Boreoeutheria TaxID=1437010 RepID=G5ATH7_HETGA  ali  66  1.......RCPPQARWSSLWHVG----GCPGLLSTWLWSRCARFCCLRKQAHTQTHLSPAWQPRDLTAIPVDSDSPVHSTVTSYSSVQYPLGIRLPLPFGELDPDFMALPAYSLSTLELPPSYDEAIKMAKPRDELAPP-QKPGPLPG.. 135
9 2.000e-37UniRef50_A0A2Y9FRL8 LOW QUALITY PROTEIN: transmembrane protein 52 n=7 Tax=Cetartiodactyla TaxID=91561 RepID=A0A2Y9FRL8_PHYCD  ali  77  66.SCDPSDQCPPQARWNXXXXXXXXXXXXXXXXXXXXXXSCVRFCCLRKRAHAQPHLPSAPEPCDLTAIPADSDSPMHSTVSSYSSVQYPLGMRLPLPFGELDLDSVTPPAYSLYAPELPPSYDEAVKMAKTR................. 196
10 2.000e-36UniRef50_Q8NDY8 Transmembrane protein 52 n=46 Tax=Theria TaxID=722675 RepID=TMM52_HUMAN  ali  74  37.SCDPSDQCPPQARXXXXXXXXXXXXXXXXXXXXXXXXGCVRFCCLRKQAQAQPHLPPARQPCDVAVIPMDSDSPVHSTVTSYSSVQYPLGMRLPLPFGELDLDSMAPPAYSLYTPEPPPSYDEAVKMAKPREEGPALSQKPSPL.... 180
11 2.000e-36UniRef50_UPI0005F3A884 transmembrane protein 52 n=1 Tax=Mandrillus leucophaeus TaxID=9568 RepID=UPI0005F3A884  ali  72  194.................................CGVTAGCVRFCCLRKQAQAQPHLPPARQPCDLAVIPMDSDSPVHSTVTSYSSVQYPLGMQLPVPFGELDPDSMAPPAYSLYAPEPPPSYDEAVKMAKPKEEGPALSQKPSPL.... 305
12 4.000e-36UniRef50_A0A2K5CBH7 Transmembrane protein 52 n=4 Tax=Boreoeutheria TaxID=1437010 RepID=A0A2K5CBH7_AOTNA  ali  73  31.SCDPSDQCPPQARWSSXXXXXXXXXXXXXXXXXXXXAGCVRFCCLQKQVQARPHLPPARQPCDLAVIPMDSDSPVHSTVTSYSSMQYPLGMRLHLPFGELDPDSVAPPAYSLYAPEPPPSYDEAVKMAKPREEGPAPSQKPSP..... 173
13 9.000e-36UniRef50_H2PXU4 TMEM52 isoform 2 n=10 Tax=Boreoeutheria TaxID=1437010 RepID=H2PXU4_PANTR  ali  74  31.SCDPSDQCPPQARXXXXXXXXXXXXXXXXXXXXXXXXGCVRFCCLRKQAQAQPHLPPARQPCDVAVIPMDSDSPVHSTVTSYSSVQYPLGMRLPLPFGELDLDSMAPPAYSLYTPEPPPSYDEAVKMAKPREEGPALSQKPSPL.... 174
14 7.000e-35UniRef50_F7EAM7 Transmembrane protein 52 n=20 Tax=Euarchontoglires TaxID=314146 RepID=F7EAM7_MACMU  ali  73  54.................................CGVTAGCVRFCCLRKQAQAQPHLPPAWQPCDLAVIPMDSDSPVHSTVTSYSSVQYPLGMQLPVPFGELDPDSMAPPAYSLYAPEPPPSYDEAVKMAKPKEEGPALSQKPSPL.... 165
15 2.000e-33UniRef50_U6D5D0 Transmembrane protein 52 (Fragment) n=6 Tax=Boreoeutheria TaxID=1437010 RepID=U6D5D0_NEOVI  ali  72  12.................................CGVTASCVRFCCLRKRVHSRPHLPPTPQPCDLTVSPVDSDSPVHSTVTSYSSVQYPLGVRLPLPFGDLDLDSMTPPAYSLYAPELPPSYEEAVKMAKPRQEEPRPSQ......... 118
16 3.000e-33UniRef50_K7FX21 Transmembrane protein 52 n=9 Tax=Sauria TaxID=32561 RepID=K7FX21_PELSI  ali  54  75.......................................CVKFCCRKKRPPVQTF---PRRPYDLTVIAIDGDSTAHSTVTSYSSLQYPQSTPLPIPFGDMDRSTMSPPAYSLYALELPPSYDEAIKMAKPYIETALVSQKLNDIAEPV 181
17 4.000e-32UniRef50_A0A287A8S3 Transmembrane protein 52 n=5 Tax=Eutheria TaxID=9347 RepID=A0A287A8S3_PIG  ali  67  49.................................CGVTASCVRFCCLRKRAHTQPHLPPAPQPCDLTAIRLDSDSPVHSTVTSYSSVQYPLSTRLPLPFGESDLDFLTPPAYSPHAPDLPPSYDEAIRMAKTRQEEPAPSLGPH...... 158
18 6.000e-32UniRef50_U3IU36 Transmembrane protein 52 n=16 Tax=Neognathae TaxID=8825 RepID=U3IU36_ANAPL  ali  49  28......................................SCIKFCCRKKRPPVQPF---PRHPYDLTGVAIDSDSTAHSTVTSYSSFQYPLSVPIPSLFVGMDRSTVSPPAYSPYTMELPPSYDEAVQMGKQYIEVALVSQKLSDITEQV 135
19 7.000e-32UniRef50_UPI000906FB44 transmembrane protein 52 n=5 Tax=Archosauria TaxID=8492 RepID=UPI000906FB44  ali  53  94.......................................CVKICCRKKRPPVQAF---PRRPYDLTVITIDNDSTAHSTVTSYSSLQYPQSTSLPLPFGEMDRSTMSPPAYSLYAMELPPSYDEAIKMGKPYTETVLVGQKPSDFPEQ. 199
20 1.000e-31UniRef50_L5L831 Transmembrane protein 52 n=79 Tax=Amniota TaxID=32524 RepID=L5L831_PTEAL  ali  69  50.................................CGVTASCVRFCCLRKRAHTQPHLPSAPQLCDLTIVPVDSDSPAHSTVTSCSSVQHLAGMRLPLPFVGLDLDSVTPPAYSLCAPELPPSYDEAVKMAKPRQKEPPPSQ......... 156
21 3.000e-31UniRef50_A0A1L8FIY7 Uncharacterized protein (Fragment) n=1 Tax=Xenopus laevis TaxID=8355 RepID=A0A1L8FIY7_XENLA  ali  33  163.DCDNNEHC-SKTEWVNXXXXXXXXXXXXXXXXXXXXXVCLRCCYLRQQRF-PEGGGGEERPCEVTVIAIDHDSTIQSTITSLQSVFGPAARRIFAVSHSH----GAPTSFTPAGPETPPCYEEAVRM--SRFTVARSTHKSPKLASV. 301
22 3.000e-30UniRef50_M3W5H0 Transmembrane protein 52 n=27 Tax=Boreoeutheria TaxID=1437010 RepID=M3W5H0_FELCA  ali  65  40.SCDPSDLCPPQARXXXXXXXXXXXXXXXXXXXXXXXXSCVRFCCLRKRAHTQPHLPATPQPCGLTVSPTDSDSPVHSTVTSYSSVQYPLGTRLPLPFGELDLDSMTPPAYSPYAPELPPSYEEAVKMSKPRQEEPPSSYAQHP..... 191
23 4.000e-30UniRef50_V9L6B2 Transmembrane protein 52 n=1 Tax=Callorhinchus milii TaxID=7868 RepID=V9L6B2_CALMI  ali  42  34...NASSGCP--STWSNQWYVWLISLTMFLLMLCGVTASCVK-CCRRAKPQTPTF---PARSCEVTVIGIEN-ANTDSNVPANISLQYPPASGEQFS-VPNNRLVMAPPPYSLYAIETPPSYDEALKMAIP.................. 153
24 2.000e-29UniRef50_UPI00052265BA transmembrane protein 52 n=2 Tax=Accipitrinae TaxID=8955 RepID=UPI00052265BA  ali  51  42.......................................................ETFPRHPYDLTVPAIDSDSTAHSTVTSYSSLQYPLSAPIPSIFMDMDKNTLSPPAYSLYAMDLPPSYDEAVQTGKQYIEVAQISQKLNDIPGQM 135
25 3.000e-29UniRef50_L5LC94 Transmembrane protein 52 n=1 Tax=Myotis davidii TaxID=225400 RepID=L5LC94_MYODS  ali  67  387.........................................RFCCLRKRAHAQP-LSTAPQPCDLTLFPGDSDSPAHSTVTSYSSVQYPLGMRLPLPFPELDLDAMTPPAYSPYTLELPPSYDEAVRMAKPGQEEPPP........... 483
26 4.000e-29UniRef50_A0A1D5PSV9 Uncharacterized protein n=2 Tax=Gallus gallus TaxID=9031 RepID=A0A1D5PSV9_CHICK  ali  47  39....................................................PPVQPFPRHPYDLTVVAIDSDSTAHSTVTSYSSFQYPPSAPIPSIFVGLDRSTVSPPAYSPYAMDLPPSYDEAVQMGKQHIEVALVNQKLSDIPGQV 135
27 2.000e-28UniRef50_A0A2U3XL38 transmembrane protein 52B n=2 Tax=Laurasiatheria TaxID=314145 RepID=A0A2U3XL38_LEPWE  ali  31  164.......................................CFRCCLSRQQNGEDEGRP----PYEVTVIAFDHDSTLQSTITSLQSIFGPAARRILAVAHSH-----SPLGQLPSSLDTLPGYEEALHM--SRFTVARCGQKAPDLPPV. 261
28 7.000e-28UniRef50_Q4KMG9 Transmembrane protein 52B n=56 Tax=Amniota TaxID=32524 RepID=TM52B_HUMAN  ali  33  65........................................FRCCCLSRQQNGEDGGPP---PCEVTVIAFDHDSTLQSTITSLQSVFGPAARRILAVAHSHSSLGQLP-----SSLDTLPGYEEALHM--SRFTVAMCGQKAPDLPPV. 162
29 1.000e-27UniRef50_A0A2D4I0S2 Uncharacterized protein (Fragment) n=2 Tax=Serpentes TaxID=8570 RepID=A0A2D4I0S2_MICLE  ali  50  106.......................................CAKFCCRTKHPLRQTF---PPHAHDLTVIPMEHDSTAHSTVTSYSSLQYPPNVSLSLPFGDPDRNNACPPAYSLYAIEMPPSYDEAIQMSKPHAETPSVGQKPES..... 207
30 2.000e-27UniRef50_G3SGF5 Transmembrane protein 52B n=81 Tax=Amniota TaxID=32524 RepID=G3SGF5_GORGO  ali  33  65........................................FRCCCLSRQQNGEDGGPP---PCEVTVIAFDHDSTLQSTITSLQSVFGPAARRILAVAHSH-----SSPGQLPSSLDTLPGYEEALHM--SRFTVAMCGQKAPDLPPV. 162
31 3.000e-27UniRef50_A0A2D4GM23 Uncharacterized protein (Fragment) n=3 Tax=Colubroidea TaxID=34989 RepID=A0A2D4GM23_MICCO  ali  49  1...................................IGASCAKFCCRTKHPLRQTF---PPHAHDLTVIPMEHDSTAHSTVTSYSSLQYPPNVSLSLPFGDPERNTACPPAYSLYAIEMPPSYDEAIQMSKPHAETPSAGQKPES..... 106
32 4.000e-27UniRef50_UPI000B3E09D1 transmembrane protein 52B n=1 Tax=Numida meleagris TaxID=8996 RepID=UPI000B3E09D1  ali  33  39.....................................SVCMRCCFTHCR---QAGEESGPQPYEVTVIAFDHDNTLQSTITSLHSVFGPAARRILAVAHSHNTVQGTPP---LTASDTPPVYEEALH--TSRFTVAKAGQK........ 134
33 1.000e-26UniRef50_A0A2I0M3F2 Transmembrane protein 52 n=4 Tax=Neognathae TaxID=8825 RepID=A0A2I0M3F2_COLLI  ali  49  39....................................................PPVESFSRHPHDLT--ATDSESTAHSTVTSYSSLQYPLSAPLHSIFVDMDKIIVSPPAYSLYAMELPPSYDEAVQMDKQHIEVARINQKLNDIPGQV 133
34 2.000e-26UniRef50_A0A286ZYQ9 Transmembrane protein 52B n=5 Tax=Amniota TaxID=32524 RepID=A0A286ZYQ9_PIG  ali  33  45.................................CGLTSVCFRCCLGRQQNGEEEGRP----PYEVTVIAFDHDSTLQSTITSLQSAFGPAARRILAVAHSPGSLSQLPT-----SMDTLPGYEEALHM--TRFTVSRCGQKAPDLPPV. 148
35 4.000e-26UniRef50_UPI000762AE72 transmembrane protein 52 isoform X4 n=1 Tax=Marmota marmota marmota TaxID=9994 RepID=UPI000762AE72  ali  64  30RSCDPSDQCPSQARWSSLWHVGWLGHSWPXXXXCGVTASCVRFCCLRKQVHTQTHLPPAWQPCDLTVIPVDSDSPVHSTVTSYMHLSCHPPMMRPSRWQNPEKRSWPPP........................................ 166
36 7.000e-26UniRef50_UPI0002B4312D transmembrane protein 52B n=1 Tax=Taeniopygia guttata TaxID=59729 RepID=UPI0002B4312D  ali  35  45...........................................CCFQCH---QTGDEAGPPPYEVTVIAFDHDSTLQSTITSLHSVFGPAARRILAVAHSHNAAQGTPP---LSASDTPPVYEEALHM--SRFTVAKAGQKVPELDPV. 141
37 1.000e-25UniRef50_G3TRJ2 Uncharacterized protein n=1 Tax=Loxodonta africana TaxID=9785 RepID=G3TRJ2_LOXAF  ali  71  12.................................CAVTASCVRFCCLRKRAQAQPHLPSPQQPCDLTVISVDSDSPVHSTVTSYSSVQYPLALRLPLPFWELDPDTEAPPAYSMYVLELPPSY........................... 100
38 6.000e-25UniRef50_U3JLZ3 Transmembrane protein 52B n=93 Tax=Amniota TaxID=32524 RepID=U3JLZ3_FICAL  ali  35  65...........................................CCFQCH---QTGDESGPQPYEVTVIAFDHDSTLQSTITSLHSVFGPAARRILAVAHSHNAAQGTPP---LSASDTPPVYEEALHM--SRFTVAKAGQKVPDLDPV. 161
39 2.000e-24UniRef50_M3Y4V0 Transmembrane protein 52B n=15 Tax=Boreoeutheria TaxID=1437010 RepID=M3Y4V0_MUSPF  ali  32  124.......................................CFRCCL----SHQQNGEDEGRPPYEVTVIAFDHDSTLQSTITSLQSIFGPAARRILAVAHSHSPLSQLP-----SSLDTLPGYEEALHM--SRFTVARCGQKAPDLPPV. 221
40 6.000e-24UniRef50_H9G5I5 Uncharacterized protein n=3 Tax=Amniota TaxID=32524 RepID=H9G5I5_ANOCA  ali  53  75.........................................KFCCRKKRPPTQPF---PPHTHDLTIVPMDHDSTAHSTVTSYSSVQYPGSFPIPFPFREVDRGMSSPPAYSLYAIEMPPSYDEAVRMAKPSVE............... 164
41 9.000e-24UniRef50_I3M007 Transmembrane protein 52B n=10 Tax=Eutheria TaxID=9347 RepID=I3M007_ICTTR  ali  30  75........................................FRCCLGRQQQ----GEDGGQLPYEVTVIAFDHDSTLQSTFTSLQSVFGPAARRILAVTRSHSSLGQLP-----SSLDTLPGYEEAIHM--SRFTVARCGQKAPDLPSV. 171
42 2.000e-23UniRef50_A0A061HVV2 Uncharacterized protein n=18 Tax=Eutheria TaxID=9347 RepID=A0A061HVV2_CRIGR  ali  31  64.......................................CFRCCLSR----PENGEDGAPPPYEVTVIAFDHDSTLQSTITSLQSVFGPAARRILAVAHAHSSLGQLP-----SSLDTLPGYEEALGM--SRFTVARCGQKAPELPSV. 161
43 4.000e-23UniRef50_UPI000854E2AC transmembrane protein 52 n=2 Tax=Tetrapoda TaxID=32523 RepID=UPI000854E2AC  ali  47  84....................................................PPVQTLPNQPYEVTVIAIDNDSTIHSTVTSYSSVQYPHM----FAFSDMDRSAMSPPAYSLYALELPPAYEEAIKMAKPSGEVSTSGPKLEDISE.. 176
44 4.000e-23UniRef50_UPI00052EE695 transmembrane protein 52 n=1 Tax=Tinamus guttatus TaxID=94827 RepID=UPI00052EE695  ali  32  133....................................................PPAPSCPRLPGDPTVVLAGGDSPARRAGTPFSSLQCLPCAPSPLSYVDTDRKTLSPPAYDLFAMEPPPSYEEAIKIGTQYIEATAANQKHRDIPGE. 228
45 9.000e-23UniRef50_UPI0005762DAA transmembrane protein 52 isoform X1 n=2 Tax=Bison bison bison TaxID=43346 RepID=UPI0005762DAA  ali  66  49.................................CGVSASCVRFCHLRKRAHSQPHLPPAPEPCDLTAIPVDSDSPAHSTVTAYSSVQCWLGMQLPLPFGELDLDSTTLPAYSLYAPEPPPSYEEAIKMTKTRQEEPPLS.......... 189
46 1.000e-22UniRef50_F6PPW1 Transmembrane protein 52B n=2 Tax=Tetrapoda TaxID=32523 RepID=F6PPW1_XENTR  ali  34  26......................................ACLRCCYLRQQRFPEGGGE---RPCEVTVIAIDHDSTIQSTITSLQSVFGPAARRIFAVSHSH----GAPTSFAPGGPETPPCYEEAVRM--SRFTVARSTHKSPKLAPV. 126
47 2.000e-22UniRef50_UPI00064C15D9 transmembrane protein 52B n=1 Tax=Ochotona princeps TaxID=9978 RepID=UPI00064C15D9  ali  35  66.........................................RCCCPSRQQAGEDRGPP---PFEVTVISFDHDSTLQSTVTSLQSVLGPAARRILAVAHTHCPLGQQPP-----SADVLPGYEEALHM--SRFTVARCGQKAPDLPAV. 162
48 4.000e-22UniRef50_UPI0008541E27 transmembrane protein 52B n=1 Tax=Nanorana parkeri TaxID=125878 RepID=UPI0008541E27  ali  36  29.DCENSKHC-SKTDXXXXXXXXXXXXXXXXXXXXXXXXXCLRCWYLRQQRCPERGE----QPCEVTVIAFDHDSTIQSTVTSLQSVFGPAARRIFAVSHSHGPS----PQLTTVGPETPPCYDEALLM--SRFTVARSTHKPCVLAPV. 164
49 4.000e-22UniRef50_A0A091D446 Uncharacterized protein n=7 Tax=Boreoeutheria TaxID=1437010 RepID=A0A091D446_FUKDA  ali  30  71.........................................RCCLARQRNGEEEGQP----PCEVTVIAFDHDSTLHDTITSLQSVFGSAARRILAVTHSHSSLRQLP-----SSVDTLPGYEEALHM--SRFTVARCGQKAPELSPV. 166
50 5.000e-22UniRef50_UPI000775B82C transmembrane protein 52B-like n=2 Tax=Serpentes TaxID=8570 RepID=UPI000775B82C  ali  32  139.........................................RCYCLNCH----PGEDSSPQPYEVTVIAFDHDSTLQSTITSLHSMFSPAARRILAVAHSHN---GVPAVHHPARTETPPIYEEAIHMN--RFTVAQSGERLELMPEE. 237
51 2.000e-21UniRef50_Q4V7S8 MGC115426 protein n=14 Tax=Xenopus TaxID=262014 RepID=Q4V7S8_XENLA  ali  50  82....................................................PPVQTFQNHPCEVTVIAIDNDSTIHSTVTSYSSVQYPHM----FPFVDPDRSAMSPPAYSLYAMELPPAYDEAIKLAKTGNEVGPSASAP....... 167
52 2.000e-17UniRef50_H3BIP5 Transmembrane protein 52 n=2 Tax=Sarcopterygii TaxID=8287 RepID=H3BIP5_LATCH  ali  47  79.......................................................QALASHPYEVTVIAIDND----STVTSYNSVQFLPSSRLSLPFAEVDGPYMSPPPYSLYALELPPSYEEAVRMAKTLYEMALGRQKPSEQPGQ. 171
53 7.000e-17UniRef50_G7NWT1 Uncharacterized protein (Fragment) n=1 Tax=Macaca fascicularis TaxID=9541 RepID=G7NWT1_MACFA  ali  72  51........................................................................DSPVHSTVTSYSSVQYPLGMQLPVPFGELDPDSMAPPAYSLYAPEPPPSYDEAVKMAKPKEEGPALSQKPSPL.... 123
54 8.000e-17UniRef50_UPI0009A2814B transmembrane protein 52-like n=1 Tax=Rhincodon typus TaxID=259920 RepID=UPI0009A2814B  ali  39  67...........................................CCRRNKPQVPAF---PARPYEVTVIAFENDNTIHSTVSTNGPLQYXSANRNSIPFQE---STLPPPPYSLYAIETPPPYDLALKMAKP.................. 148
55 4.000e-16UniRef50_UPI000740155F transmembrane protein 52 isoform X1 n=2 Tax=Lepisosteus oculatus TaxID=7918 RepID=UPI000740155F  ali  34  70....................................................PPSPTFAGHPFEVTVVSVENENTTQSTVSSYSVIPHRPGSLLPLPFRPEAGTSTSPPPYNLYALEIPPAYEEALKMPFDLYAAPHGNRK........ 161
56 3.000e-15UniRef50_UPI000CD5DA8C transmembrane protein 52 n=1 Tax=Paramormyrops kingsleyae TaxID=1676925 RepID=UPI000CD5DA8C  ali  30  33.........................................KMCCRSSKPPVPT---CPGQRFEVAVIDVENRSALSSISTMSSFSHRLPGEPSPRIFTAGLRSPLSPPPYSLYAMESPPQYDEALKMADKTVVVPRALEDPHVAPEV. 137
57 4.000e-14UniRef50_W5MG73 Transmembrane protein 52 n=1 Tax=Lepisosteus oculatus TaxID=7918 RepID=W5MG73_LEPOC  ali  34  78....................................................PPSPTFAGHPFEVTVVSVENENTTQSTVSSYSVIPHRPGSLLPLPFRPEAGTSTSPPPYNLYALEIPPAYEEALKMPFDLYAAPHGNRK........ 169
58 5.000e-14UniRef50_UPI0007A6E9C9 transmembrane protein 52B n=2 Tax=Microchiroptera TaxID=30560 RepID=UPI0007A6E9C9  ali  25  122.........................................................................SPSPLPSPALQSVFGPAARRILAVAHSHGSLAQLP-----SSVDTLPGYEEALHM--SRFTVARCGQKAPDLPSV. 189
59 5.000e-12UniRef50_V8NFP0 Transmembrane protein 52 (Fragment) n=1 Tax=Ophiophagus hannah TaxID=8665 RepID=V8NFP0_OPHHA  ali  50  1..................................................................................YSSLQYPPNVSLSLPFGDPDRNTACPPAYSLYAIEMPPSYDEAIRMSKPHAETPSGGQKPES..... 62
60 8.000e-12UniRef50_A0A2I0T348 Transmembrane protein 52b n=1 Tax=Limosa lapponica baueri TaxID=1758121 RepID=A0A2I0T348_LIMLA  ali  30  19.................................................................................ALHSVFGPAARRILAVAHSHAAAQGTPP---LAASDTPPVYEEALHM--SRFTVAKTGQKVPDLDPV. 80
61 1.000e-10UniRef50_UPI00064D4EC6 transmembrane protein 52B n=1 Tax=Jaculus jaculus TaxID=51337 RepID=UPI00064D4EC6  ali  25  61..............................................................................SLAALQSVFGPAARRILAVAHSHSSVGQVP-----SCLDTLPGYEEALGM--SRFTVARCGQKAPDLPSV. 123
62 6.000e-09UniRef50_A0A1W4ZN44 transmembrane protein 52 isoform X1 n=3 Tax=Scleropages formosus TaxID=113540 RepID=A0A1W4ZN44_9TELE  ali  33  62...........................................CCASKS----PAPAYPGQHFEVAVVGVDNESTVHSISSVSSSSEQNPSGPPSHVFATA--LSFLPPPYQLYALESPPQYEDAVKMP.................... 141
63 4.000e-08UniRef50_UPI00084019C0 LOW QUALITY PROTEIN: transmembrane protein 52 n=1 Tax=Callithrix jacchus TaxID=9483 RepID=UPI00084019C0  ali  53  66....................................................................................SDQCPPQARWSSLWHGWTPDSMAPPAYSLYYPEPPPSYNEVVKMXKPREEGPAPSQKPSP..... 126
64 4.000e-07UniRef50_U6DWE2 Uncharacterized protein C12orf59 (Fragment) n=3 Tax=Boreoeutheria TaxID=1437010 RepID=U6DWE2_NEOVI  ali  27  1..................................................................................LQSIFGPAARRILAVAHPHSPLSQSPSS-----LDTLPGYEEALHM--SRFTVARCGQKAPDLPPV. 59
65 3.000e-06UniRef50_A0A091LYU9 Transmembrane protein 52 (Fragment) n=3 Tax=Neognathae TaxID=8825 RepID=A0A091LYU9_CATAU  ali  53  29.......................................CIKFCCQKKRLPVETF---PRHPCDLTVIAIDSDSTAHSTVT.................................................................... 67
66 5.000e-05UniRef50_A0A1S3GXY9 transmembrane protein 52-like n=1 Tax=Dipodomys ordii TaxID=10020 RepID=A0A1S3GXY9_DIPOR  ali  95  60..CDPSSQCPPQARWSSLWHVG............................................................................................................................... 79

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 2 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.