current user: public

If you have questions about the server, please let us know.

Query: PF15961.5; ZN839_HUMAN/7-805; Domain of unknown function (DUF4764 topsan), from PfamA32U

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .  610    .  620    .  630    .  640    .  650    .  660    .  670    .  680    .  690    .  700    .  710    .  720    .  730    .  740    .  750    .  760    .  770    .  780    .  790    .
# E-value Template Links and tools%idFirst IQPQTARKSQLPRGNSCLVGLHIASPQLLRVQPLVRTEPQSCFLSDLCQPPAQGFVQRPLPALQVVPAKRVPAPKAPDEQGSMLTPLSASDPLAVTSLSSSSAHPFISNLHTRHTEKLKKSLKVKTRSGRVSRPPKYKAKDYKFIKTEDLADGHLSDSDDYSELCVEEDEDQRERHALFDLSSCSLRPKSFKCQTCEKSYIGKGGLARHFKLNPGHGQLDPEMVLSEKASGSTLRGCTEERTLSLTSLGLSMPADPCEGGARSCLVTESARGGLQNGQSVDVEETLPSEPENGALLRSERYQGPRRRACSETLAESRTAVLQQRRAAQLPGGPAAAGEQRASPSKARLKEFLQQCDREDLVELALPQLAQVVTVYEFLLMKVEKDHLAKPFFPAIYKEFEELHKMVKKMCQDYLSSSGLCSQETLEINNDKVAESLGITEFLRKKEIHPDNLGPKHLSRDMDGEQLEGASSEKREREAAEEGLASVKRPRREALSNDTTESLAANSRGREKPRPLHALAAGFSPPVNVTVSPRSEESHTTTVSGGNGSVFQAGPQLQALANLEARRGSIGAALSSRDVSGLPVYAQSGEPRRLTQAQVAAFPGENALEHSSDQDTWDSLRSPGFCSPLSSGGGAESLPPGGPGHAEAGHLGKVCDFHLNHQQPSPTSVLPTEVAAPPLEKILSVDSVAVDCAYRTVPKPGPQPGPHGSLLTEGCLRSLSGDLNRFPCGMEVHSGQRELESVVAVGEAMAFEISNGSHELLSQGQKQIFIQTSDGLILSPPGTIVSQEEDIVTVTDAEGRLast
1 0.000e+00UniRef50_G3W0U1 Uncharacterized protein n=3 Tax=Metatheria TaxID=9263 RepID=G3W0U1_SARHA  ali  43  7IRPKTITLSQPFNGNTDLLGLSIVNPSIIRIQPLMRTE-QQTLVNTVPPPPLQLLVQRPLPPLGPVSVEKFMGHKVLNGQRTTFVPLSASNTSTIPSVTSNSASLLISTPENECTEKIKKSVKVKTRSGRISRPPKYKAKDYKFIKTEDLADGHQSDSDDYSELNVEEEDDKKGKDTLFNSSSDYLKPKTFKCQTCEKSYIGQGGLARHYKLNPGHGQLEPKVLISNKPDGSGEVGGATRNKMTPEP-SIPAALNSESTLAPCMAEQDSTWNGQQNCDSKEIGTLLESDQKNGACWGSRRTRGSKRRKLKASA--KSGCSGKHSNSVQLTSCTGVAVEQNKMRNKARLKELLQQCDHEDLMELVLPRLTKLVTVYEFLLMKVEKNHPAKPFFPDVYKEFEELHKMVKKMCQDYFNNSVLSSQQPLEIKNNEVAESLGITEELLQNEELKKNEISPQSAVE---EGLGEVTGQKRENEILE-VPVPVKRTRIESGSKNMKDNYASHNGLQEKTILLCSQGLGLKLHLNRTTSQSSEKTYNMAVDFGSQMLQDDQLPKAVAEVEESKNDPASSVILYQAVKGTTTYSQLENPGSLLQEQTELLPEYSVHDHPSDQNTSDKSAISDFCCTVLSEKD------SSWSGHEIHNRRENEDCKSHQEFFNPENEIHELTSKPG--KILSTD-VPTDNSCQTSLESQHHSLLEASISTEGILESASENLHQFPESLQ--DVQMEQESAIAVDDTLAFEIANESQE-LNQEQEQIFIQTSDGLILSHPGTVVSEANDIVIVTDVDGN 790
2 0.000e+00UniRef50_U3JJB0 Zinc finger protein 839 n=31 Tax=Archosauria TaxID=8492 RepID=U3JJB0_FICAL  ali  36  7IQSKTITLSQPVGRNSGIPGLGIINPQIISIQPVSGTEQQQLFLHSSSESPVQLLMQRPLPSHESVSVDKVPPSKMVNGQRNTCATASASRSPNPTVAAASSAS-TPCLEKKQKDDKLKKSLKVKTRSGRISRPPKYKAKDYKFIKMEDLADGHQSDSDDYSELSIEDDEEGKGKDALFSSSNYNLKPKTFKCQTCEKSYIGKGGLARHYKLNPDHGELESSPPKIPLNKPNGSIFVEEKMMSPAHLDSTAVTLNHEKVLATSLQETVDSKAGEQKSFSFNIEMTLNILQQELMQLLARKKYLFRCRGIRFITCLCNCRKISRPGQSPSKSLSSVSAEHKVFRRKARLKELIQQCDNEDLMELALPRLTKLVTVYEFLLMKVEKGHPAKAYFPDVYREFEDLHNMVKKMAYDHLNSDSVNCQQPVEIKDTKVAESLGITEILSGEQKMQGAGSSQCAIKMVSEQVAVDILGQKRLTESSEELLPPAKRTKLEDITENVNNAYASQDEKKQKFKCFHQLTKSFNPLNGE--ILLSEDRHITCCT--TGSTLQTAEENNSLAESGVRLDGENSGTSSQTVEMRIEYPQPV-----------SMQGPDVAGEASLLHTEVVLPVKTSSAGLVQAHFVSGSAVGGPAAPELHSSMSEQALA----RQSTGPPTNVSDEIQELEKAFSTNLVPINYPHSAQAESHQNAVQGASLSAHGNQENAFKNQSEYSCGTG---EAHELANTVTVDETVAFEISDESHDFLSQGQEQIFIQTSDGLILSHPGTVLSQAEGIVIVTDSNG. 792
3 0.000e+00UniRef50_H3A8I1 Zinc finger protein 839 n=1 Tax=Latimeria chalumnae TaxID=7897 RepID=H3A8I1_LATCH  ali  33  8VQPKIVALNQSANKCSAASALNFIGPQIIRIQPVAGTGQQQLFLHSSSEPPIQLLVQKAPPPLGPTTVRKIPLYKPINGQMSASGILTTSSSNVIP--VTTSVTELSIDKKLKDKLRVKRPLKVKTRSGRISRPPKYKVKDYKFIKTEDLADGHQSDSDDYSELSVEEDEEGVKKDIAFCPLNYNLKPKKFKCETCEKSYIGKGGLARHYKLNPSHEQ--PNFLQTNQRSSVKPNGGVPVTKMAVLNIGINVSSSSVLAVAKIILITLKKRGGCFDLFSWGLEKKLPAPQGPGRPRGPGRTRGPKRSRQSALAGRPGYAVRSGRPGRPPKSLGNITTXXXXXXXXXXXXXXXXXXXXXELMELALPRLTKVITVWEFLLMKVEKGYPSKPYFADVYKEFEDLYTMVKKMAEDHFNNSHLSLQRSLEIKNVKVAESLGIEKVLRKQKQQAADTSERDVVVTIDDQLKLHSSAKKHGIERDEKLLPPDKRARIEISLIDTNSTYFSQKG-----KLVEALHLSGLTAEEGIIKQVNGDSKIACITNGSLGVRTEDTSSVSLHSTNEFKGPIGVEADTNPCHSNLLLYQSTEVASQPSEGIQGQSEDLVQEHLSNHSMADQLTDVELSDPVQTEHGIHSSSINSESTQEHCNSMNSRDPLTNHERSEQLHASVIADQMQQLENVLSTAIVSLDHSNRTQSASSTQVRLESQISHESVKSLQVANPNELCSEIEQSSSIHDVESTVTVDETVAFQLSDESHELLTQGHEQIFIHTSDGLILSHPGALVSQTEGIVIVTNADG. 810
4 0.000e+00UniRef50_A0A2I0MPE5 Zinc finger protein 839 n=60 Tax=Aves TaxID=8782 RepID=A0A2I0MPE5_COLLI  ali  36  14IQSKTIMLSQSVGRNSSISGLGIINPQIIRIQPVTGTEQQQLFLQ-SSESPVQLLMQRPLPSQGSVSVNKIPTSKMINGQKATRATVSATRSPNITMVAASSANTLIPCLEKQKDDKLKKSLKVKTRSGRISRPPKYKAKDYKFIKMEDLADGHQSDSDDYSELSIEDDEEGKGKDALFSSSNYNLKPKMFKCQTCEKSYIGKGGLARHYKLNPGHGQLESSPQKIPKPNGSIFVDNACGIREGMMSPAHLDSTAVTLNNENALATDLEGTVDSKAGEQICKSAESRHMLAEQQNETSSGHRGPKTPKGPGRPRRPKRRGRPRMGGRSKCSGRLSRPEHNVFRRKARLKELIQQCDNEDLMELALPRLAKLVTVYEFLLMKVEKGYPAKAYFPDVYREFEDLHNMVKKMAYDHLSNSDLSCQQPVEIKDAKVAESLGITEILTGEQKTGGDSCSQCIIKVVSEQVPVEILGQKRLAESSEELLPSAKRTKLEDVMENVNNAYASQDEVKEKSGNLCTLFEKDGFNPLNGEILLSEDSHITCCT--TGNTLLTVEEHNSLADSGVRINAENSGTFSQTVKMRIEYSQPVNIQGPDMAGEAPPSPELVQAHFVSGNAASGLSAPELCSSV-SEKAMGSLSASVPTSKGDGHKQNYQKLQEENQSSEQPHNADVADEMQELERVFSTNVVPITYTHSAQTESHQSPAQEASLSAHVNHENSFKNMTEFSCG---TCEPHELENTVTVDETVAFEITDESHDFLSQGHEQIFIQTSDGLILSHPDTVLSQAEGIVIVTDSNG. 845
5 1.000e-93UniRef50_A0A218UFQ7 Zinc finger protein 839 n=32 Tax=Archelosauria TaxID=1329799 RepID=A0A218UFQ7_9PASE  ali  35  198IQSKTITLSQPVGRKSSIPGAGIINPQLIRIQPVSGTEQQQLLVHSSSESPLQLLMQRPLPSHGSVSVDKIPPSKMVNGQRATCATASASGSPNPTMAAASSAS-TPCLEKKQKDDKLKKSLKVKTRSGRISRPPKYKAKDYKFIKMEDLADGHQSDSDDYSELSIEDDEEGKGKDALFSSSNYNLKPKTFKCQTCEKSYIGKGGLARHYKLNPDHGQLEPSPQKIPLNKPNGSMFVEEEIMSPAHLDSAAVTLSHEKALATSLEETVDSKGGEQASESEKSRHLLAEQPNETSSGHWGPVTPKRRGRPRMGGRSRGSGRLSRPGQSPSKSLSSVSAEHNVFRRKARLKELIQQCDNEDLMELALPRLTKLVTVYEFLLMKVEKGHPAKAYFPDVYREFEDLHNMVKKMAYDHLNSDSVNCQQPVEIKDAKVAESLGITEILSGEEKMQGAESSQCVIKMVSEQVPVDVLGQKRLAESSEEVLPPAKRTKLEDVTENVNNAYASQDEVKERSGNLCTLFEKDGFNQLNGEILISEDRHITCCT--TGSTLQTAEEHNSLADSGVRIDGENSGTFSQTVEMRIEYPQPAGIQGPDVAGEASLLHAEVVLPVGASGSAAGPAAPELHSSLM-EQAVARQSTGLPASEENGHSPKYHQLQEENERSEQLRNADMTDELQELEKAFSTNVVPINYPHSAQAESHQDAVQGASLSAHGNQENAFKNESGYSCVTQ---ETHELANTVTVDETVAFEISDESHDFLSQGHEQIFIQTSDGLILSHPDTVLSQAEGIVIVTDSSG. 1021
6 8.000e-90UniRef50_Q9NT83 Uncharacterized protein DKFZp434M1123 (Fragment) n=10 Tax=Simiiformes TaxID=314293 RepID=Q9NT83_HUMAN  ali  99  1...................................................................................................................EKLKKSLKVKTRSGRVSRPPKYKAKDYKFIKTEDLADGHLSDSDDYSELCVEEDEDQRERHALFDLSSCSLRPKSFKCQTCEKSYIGKGGLARHFKLNPGHGQLDPEMVLSEKASGSTLRGCTEERTLSLTSLGLSMPADPCEGGARSCLVTESARGGLQNGQSVDVEETLPSEPENGALLRSERYQGPRRRACSETLAESRTAVLQQRRAAQLPGGPAAAGEQRASPSKARLKEFLQQCDREDLVELALPQLAQVVTVYEFLLMKVEKDHLAKPFFPAIYKEFEELHKMVKKMCQDYLSSSGLCSQETLEINNDKVAESLGITEFLRKKEIHPDNLGPKHLSRDMDGEQLEGASSEKREREAAEEGLASVKRPRREALSNDTTESLAANSRGREKPRPLHALAAGT..................................................................................................................................................................................................................................................................................... 407
7 5.000e-87UniRef50_F1P4H0 Zinc finger protein 839 n=2 Tax=Galloanserae TaxID=1549675 RepID=F1P4H0_CHICK  ali  37  14IQSKTVMLSQSVGRNSSVPGLGIINPQIIKIQPVTPEQQQQLFLHSSSESPIQLLMQKPLPSHGSVPVNKIPTSKVLNGQKTARATVSPARSSNT--AASSTNTLMPCLEKKQKDDKLKKSLKVKTRSGRISRPPKYKAKDYKFIKMEDLADSHQSDSDDYSELSIEDDEEGKGKDALFNSSNYNLKPKMFKCQTCEKSYIGKGGLARHYKLNPGHGQLE---------------SVPQKTPLNKPNGSIFVDNLYALPIKVACKSAESGNLLAEQQNESSSGHRGP----ITAKGPGRPRRPKRRGRPRMGGRSRCSGRLSRPGQSPSKSLSSVSTERNVFRRKARLKELIQQCDNEDLMELALPRLTELVTVYEFLLMKVEKGCPAKAYFPDVYREFEELHNMVKKMAYDYLSNSDLSCQQPIEIKDTKVAESLGITEITTGEQKMQGVDPCSQHIIKMVSEQPVETLGEKRLAESSEELLPSAKRTKLEDVMENVNNAYSSQDEVKEKSLN-----------PLNGEILLPEDRRVTCCT--TGSMLPAEEERNLLVDSEVRINDENSGTFSQTVEMRIEYSQPVDRQGPVLPVEAGCSPELAEAHLVSQNTAGGLSASEPCNSV-SERAVGIQSTALAMSEENGLNQKSFSTH-----------------------------VPINYPHGAQAELHQNPVQEASLSAGVTHDCAYNNVSEFPCGTE---EQHELENAVAVDQTVAFEITDGSHDFLTQGHEQIFIQTTDGLILSHPAAVLSQAEGIVIVTDSDG. 764
8 9.000e-86UniRef50_UPI000A3A153D zinc finger protein 839 isoform X2 n=1 Tax=Columba livia TaxID=8932 RepID=UPI000A3A153D  ali  32  14IQSKTIMLSQSVGRNSSISGLGIINPQIIRIQPVTGTEQQQLFLQ-SSESPVQLLMQRPLPSQGSVSVNKIPTSKMINGQKATRATVSATRSPNITMVAASSANTLIPCLEKQKDDKLKKSLKVKTRSGRISRPPKYKAKDYKFIKMEDLADGHQSDSDDYSELSIEDDEEGKGKDALFSSSNYNLKPKMFKCQTCEKSYIGKGGLARHYKLNPGHGQLESSPQKIPKPNGSIFVDNACGIREGMMSPAHLDSTAVTLNNENALATDLEGTVDSKAGEQICKSAESRHMLAEQQNETSSGHRGPKTPKGPGRPRRPKRRGRPRMGGRSKCSGRLSRPEHNVFRRKARLKELIQQCDNEDLMELALPRLAKLVTVYEFLLMKVAES-------------------------------------------------LGITEILTGEQKTGGVDSCSQCIIKVVSEQVPVEILGQKRLAESSEELLPSAKRTKLEDVMENVNNAYASQDEVKEKSGNLCTLFEKDGFNPLNGEILLSEDSHITCCT--TGNTLLTVEEHNSLADSGVRINAENSGTFSQTVKMRIEYSQPVNIQGPDMAGEAPPSPELVQAHFVSGNAASGLSAPELCSSV-SEKAMGSLSASVPTSKGDGHKQNYQKLQEENQSSEQPHNADVADEMQELERVFSTNVVPITYTHSAQTESHQSPAQEASLSAHVNHENSFKNMTEFSCG---TCEPHELENTVTVDETVAFEITDESHDFLSQGHEQIFIQTSDGLILSHPDTVLSQAEGIVIVTDSNG. 794
9 4.000e-83UniRef50_F7BFM3 Zinc finger protein 839 n=5 Tax=Catarrhini TaxID=9526 RepID=F7BFM3_MACMU  ali  90  20.............................................................................................................................................................................................................................................................................................................................................................QFLQQCDPEDLVELALPQLAQVVTVYEFLLMKVEKDHLAKPFFPAIYKEFEELHKMVKKMCQDYLSSSGLCSQETLEINNDKVAESLGITEFLRNKEIHPDNLGPESPSREMDGEQPEGAGSEKREHEAAEEGLASVKRPRREALPNDTTESLAANSRGWEKPRPLHALAAGE---VNGSVSPHSEESHTTTVSGGDGSVFQAGPQLHALADLEARSGSIGAAVSSQDVSGLPLYAQSGEPRRLTQAQVAEFPGENALKHSSDQDTRDSLRSPGFRSTLSS-GGAESLLPGRPGHAEAGHLSKVCDFHLNNQQPSPSSVLPTEVAAPLLEKILSMDSVAVNCACRTVPKPGPQPGPHGSLLTEGCLRSLSGDLKRFPCGLEVHSGQRELESVVAVGEAMAFEISNGSHELLSQGQKQIFIQTSDGFILSPPGTIVSREEDFVIVTDAEGR 465
10 3.000e-82UniRef50_UPI000C2AFC70 zinc finger protein 839 isoform X2 n=1 Tax=Piliocolobus tephrosceles TaxID=591936 RepID=UPI000C2AFC70  ali  71  123IQPQTARQSQPPQGNSCLVGLHITSPQLLRVQPLVRTEPQSCFLSDLRQPPAQVFVQRPLPALQVVPAKKVPAPKTPNEQGSVLT------------PLSASNPLAVTSLSSSSAHP------------------------------------------FVSNLHTKHTEKLKKSLKVKTRSGRVSRPPKYK--------------AKDYKFIKTEDLADSHLSDSDDYSELCVEEEEDQRESHTLFDLSSCSLRPKSFKCQTCEKSYIGKGGLARHFKLNPGHGQV----DPEMVLSDKANGSTLQGCMEERTLSLTSPGLSMPAAPCEGGARSCLVTESAH---GGLQFLQQCDPEDLVELALPQLAQVVTVYEFLLMKVGKDHLAKPFFPAIYKEFEELHKMVKKMCQDYLSSSGLCSQETLEINNDKVAESLGITEFLRKKEIHPDNLGPERPSQEMDGEQPEGAGSEKTEHEAAEEGLASVKRPRREALPSDTTESLAANSRGREKPRPLHALAAGFAPPVNGTVSPHSEESHTTTVSGGEGSMFQAGPQLHALADL-ARSGSIGAAVSSQDVSGLPLYAQSGESRRLTQAQVAAFPGENALKHSSDQDTRDSLRSPGFCSTLSSAGGAESLLPGRPGHAEAGHLGKVCDFHLNHQQPSPSGVLPTEVAAPLLEKILSVDSVAVNCAYRTVPKPGPQPGPHGSLLTEGCLRSLSGDLNRFPCGMEVHSGQRELESVVAVGEAMAFEISNGSHELLSQGQKHIFIQTSDGFILSPPGTIVSREEDFVIVTDAEGR 845
11 1.000e-79UniRef50_H0YM94 Zinc finger protein 839 (Fragment) n=10 Tax=Boreoeutheria TaxID=1437010 RepID=H0YM94_HUMAN  ali  99  59IQPQTARKSQLPRGNSCLVGLHIASPQLLRVQPLVRTEPQSCFLSDLCQPPAQGFVQRPLPALQVVPAKRVPAPKAPDEQGSMLTPLSASDPLAVTSLSSSSAHPFISNLHTRHTEKLKKSLKVKTRSGRVSRPPKYKAKDYKFIKTEDLADGHLSDSDDYSELCVEEDEDQRERHALFDLSSCSLRPKSFKCQTCEKSYIGKGGLARHFKLNPGHGQLDPEMVLSEKASGSTLRGCTEERTLSLTSLGLSMPADPCEGGARSCLVTESARGGLQNGQSVDVEETLPSEPENGALLRSERYQGPRRRACSETLAESRTAVLQQRRAAQLPGGPAAAGEQRASPSKARLKEFLQQCDREDLVELALPQLAQVVTVYEFLLMKVEKDHLAKPFFPAIYKEFEELHKMVKKMCQDYLSSSGLCSQETLEINNDKKTQ............................................................................................................................................................................................................................................................................................................................................................................. 492
12 2.000e-77UniRef50_F7GJG4 Uncharacterized protein n=3 Tax=Monodelphis domestica TaxID=13616 RepID=F7GJG4_MONDO  ali  43  222IQPKTITLSHPFNGNTDLLGLSVVNPSIIQIQPLKRTE-QQDLANTLPSPPLQFLVQRPLPPLGPVSVEKFLAHKMQNGQRSTFIPLSVLNTSAITSVTSNSANLLISTPESERTEKLKKSLKVKTRSGRISRPPKYKAKDYKFIKTQDLADGHQSDSDDYSELNVEEEDDKRGKDTLFNSSSGYLKPKTFKCQTCEKSYIGQGGLARHYKLNPGHGQLEPKILIPGKPNGNGEAGDITVNTVTTESSIHESTL------APGVAESDSAWNGQQNCDSKEVGTLLESEEKNGACWGSRRTKGSKRCRKLKASVKSSCSGKHSNSVHPTSCTGGAAEQNVVGNKKAELKELLQQCDHGDLMELVLPHLSKLVTVYEFLLMKVEKSHLAKPFFPDVYKEFEELHKMVKKMCQDYFGSSVLSSQQPLEIKNNEVAESLGITEELLRKKEKNSILPQTILSAVEVG--LGEITGQKREKEILEEVMVPVKRTRIESGSKNMNHNYISHGGLQEKTTPLCNQAEGFNLQLNRTTSQFSEETYNVTV-DAESQMFHADQLPKTLADAEGKNESVDSVTLYQAVNGIQTCSQLENPGDLLQEQTELFPACVQNHSPDFHNTTLSARDSTWSG------------------YEIQNRRENEECKSHQEFFNPGNETNEITS--QPERILPADFVTTANSYQISSESQHHPLLEASLSTEGILES-PENLDQFPESLQ--DNQREQENAIAVSETLAFEITDETQECL....................................... 955
13 8.000e-77UniRef50_K7GG24 Uncharacterized protein n=10 Tax=Archelosauria TaxID=1329799 RepID=K7GG24_PELSI  ali  33  2..............................................................................................................................................................................................FKCQTCEKSYIGKGGLARHYKLNPVHGQLESSQQKASMNKTNKSGGAGDGTESLAHLQPDVVTLNNEKSLAVGLEETASSQNEQQTGESAEGRNLLAAQQSDTSLEYRGPGMPNGSGRPKMAGRSVCSGRLSRPVQSPSMSLSNVSTEHIIFRRKTRLKELIQQCDNEDLMELALPRLTKLVTVYEFLLMKVEKGSPGKAFFPDVYREFEELHNMVKKMSQDHFNNSDFLSQQPVEIKDPKVAESLGITETLGKQMIQAADSSTQCVTKTVDEQMFTEITRKRANKNLDEELLPSAKRASIEGILENVKDVFASQNAIEEKSWSLSTLTTKDGFNPLNGVAVFSEDRGGIPC--ITGSAKHTGEQHKSLY-LESRANSVNSDIF-QSMKMRMECSQPVNIRGQDSIVNTFPPPELIQAHFVNETAEDRLTNSELCNCLVSEDDINNQSTNFSMNEEIHHNGKYQKLQQTSEQSEQLDDADIADQMQQLEKVLSTSIVPVDHSHETQLDPHQNP--ETSIPTQETLESPIKNLNEFSCSASPQAGQHEPENAVTVDETVAFEIADENHEFLSQGHEQIFIQTADGLILSHPGTVLSQAEGIVIVTNADG. 644
14 1.000e-75UniRef50_UPI000A30FC9C zinc finger protein 839 isoform X1 n=2 Tax=Mus pahari TaxID=10093 RepID=UPI000A30FC9C  ali  48  110IQPKTVGQSHLLGRSPS-KGVCVSSPQLLRVQALGRTESQLHFLRRSPQPPAPVFVQKMLPHLHPVPLKRAKAHETANGCGIALSPVAASGPRAVAAVPSG---LLISSLHTAHAEKSKKSLRVRTRSGRVSRPPRYKARDYKFIKTEDLAEGRLSDSDDYSELSVEEEEEPREKPASFDVEVCALRPKAFKCQTCGKSYIGKGGLSRHCKLNPGHGWLQPGVLLSEKDDGGPTLGCTDSKTRGPASLQPSTPATLCVEEAESAWHTLQNGQPVEVEETLVPE---PQNRSPSALLRPEKYLEPKNGNWESQAEVSRAS--LQESRAVQPASDSAVPSGLSVAGGAQLREALKQCGREELVELVLPQLAQVVTLYELLLVKAEKSPRAKPFFPAVYKEFEELHDLMKRMCQDYLSSAGAYPQEPLEISNHEVARSLGITEVLRRKETPT-------CSSQETKGRLEEGCARKRARELGE--LATVKKPRTVALPTDVPKYPPFANGCQQKPGPSPALATSKGSPAAGENSLYSEGSCREMVPASDRNAPPAGSWLTVMADFEVRSGSADPTLLFQDVSGSALYFQVAEPRRMPPAQESVFSEENIPEYTIDQDSGAIRKSNNACVMPLSGRRIESLLLRESENAEAGALRETNQPLLGGQQSSPSHVLLAEAASFPLHNTLPVNILPVACVSKIMPEPVLHPGPGGSLSTNGGPGSEAGDISQLLSRMETH-DQREPEIVAAVGEAMAFDISNVCQEVLSQGHEQVFIRTSNGFILSYPSTIVSQEEDNVIMTNARG. 894
15 6.000e-73UniRef50_UPI0003C1A6E9 zinc finger protein 839 isoform X1 n=2 Tax=Latimeria chalumnae TaxID=7897 RepID=UPI0003C1A6E9  ali  32  343VQPKIVALNQSANKCSAASALNFIGPQIIRIQPVAGTGQQQLFLHSSSEPPIQLLVQKAPPPLGPITTVRKI-PLYKPINGQMSASGILTTSSSNVIPVTTSVTELSIDKKLKDKLRVKRPLKVKTRSGRISRPPKYKVKDYKFIKTEDLADGHQSDSDDYSELSVEEDEEGVKKDIAFCPLNYNLKPKKFKCETCEKSYIGKGGLARHYKLNPSHEQPQTNQRSSVKPNGGVPVTDSGGGGDDSSSVLVSEPLVMLSEEVTTAPSQESQQDLQLVVPEQTVVLQLPAPQGPGRPRGPGRTRGPKRSRQSALAGRPGYAVRSGRPGRPPKSLGNITTXXXXXXXXXXXXXXXXXXXXXELMELALPRLTKVITVWEFLLMKVEKGYPSKPYFADVYKEFEDLYTMVKKMAEDHFNNSHLSLQRSLEIKNVKVAESLGIEKVLRKQKQQAADTSERDVVVTIDDQLKLHSSAKKHGIERDEKLLPPDKRARIEISLIDTNSTYFSQKG-----KLVEALHLSGLTAEEGIIKQVNGDSKIACITNGSLGVRTEDTSSVSLHSTNEFKGPIGVEADTNPCHSNLLLYQSTEVASQPSMDTDITSEDLVQEHLSNHSMADQLTDVELSDPVQTEHGIHSSSTLLSSTQEHCNSMNSRDPLTNHERSEQLHASVIADQMQQLENVLSTAIVSLDHSNRTQSASSTQVRLESQISHESVKSLQVANPNELCSEIEQSSSIHDVESTVTVDETVAFQLSDESHELLTQGHEQIFIHTSDGLILSHPGALVSQTEGIVIVTNADG. 1197
16 3.000e-72UniRef50_A8K0R7 Zinc finger protein 839 n=69 Tax=Eutheria TaxID=9347 RepID=ZN839_HUMAN  ali  100  7IQPQTARKSQLPRGNSCLVGLHIASPQLLRVQPLVRTEPQSCFLSDLCQPPAQGFVQRPLPALQVVPAKRVPAPKAPDEQGSMLTPLSASDPLAVTSLSSSSAHPFISNLHTRHTEKLKKSLKVKTRSGRVSRPPKYKAKDYKFIKTEDLADGHLSDSDDYSELCVEEDEDQRERHALFDLSSCSLRPKSFKCQTCEKSYIGKGGLARHFKLNPGHGQLDPEMVLSEKASGSTLRGCTEERTLSLTSLGLSMPADPCEGGARSCLVTESARGGLQNGQSVDVEETLPSEPENGALLRSERYQGPRRRACSETLAESRTAVLQQRRAAQLPGGPAAAGEQRASPSKARLKEFLQQCDREDLVELALPQLAQVVTVYEFLLMKVEKDHLAKPFFPAIYKEFEELHKMVKKMCQDYLSSSGLCSQETLEINNDKVAESLGITEFLRKKEIHPDNLGPKHLSRDMDGEQLEGASSEKREREAAEEGLASVKRPRREALSNDTTESLAANSRGREKPRPLHALAAGFSPPVNVTVSPRSEESHTTTVSGGNGSVFQAGPQLQALANLEARRGSIGAALSSRDVSGLPVYAQSGEPRRLTQAQVAAFPGENALEHSSDQDTWDSLRSPGFCSPLSSGGGAESLPPGGPGHAEAGHLGKVCDFHLNHQQPSPTSVLPTEVAAPPLEKILSVDSVAVDCAYRTVPKPGPQPGPHGSLLTEGCLRSLSGDLNRFPCGMEVHSGQRELESVVAVGEAMAFEISNGSHELLSQGQKQIFIQTSDGLILSPPGTIVSQEEDIVTVTDAEGR 805
17 9.000e-72UniRef50_UPI000703FE3B zinc finger protein 839 n=1 Tax=Tupaia chinensis TaxID=246437 RepID=UPI000703FE3B  ali  57  41VQPQTARPCLPP-RASSLEGLGVASPQLLRVQPLVRAGQQ---------PPAQVFVQRPLPALQPVPGKRVPGPPAQNGQGAGLMPSSASDPSAMAPVSASPPNVVTSNLLTKHTEKLKKSLKVKTRSGRISRPPKYKAKDYKFIKTEDLADGHPSDSDDYSELSVEEEEEQREKQAPFDFPSGLLRPKAFGCAACGKAYIGKGGLARHFKLNPGHGQLDASASVGPASQAPSLPATTPEEGDLPC-------------RAPGTEPAPGSLQNGQSVEFEEVLTAEPENRSYSAPLRSERHPGPRGNGCAESPAGPSVAVLRQSRAV-LAGGPAAAGGQRALRNKARLKQFLQQCHPEDLVELALPQLAQAVTMYEFLLMKVENGRLAKPLFPAVYKEFEELHEMVKKMCQDYLLRSGPCSQEPLEINNAKVAESLGITEKLLRAKIHTKCTPPPGLCHEAEGTSPEEXXXXXXXXXXXXXXXXXXXXXRRGALPKDTSGSLAADSRGREKPRPSSAPAASDGPGLSMNASPHSEESHALLVSDGDSHTLYAGQQLKAFADLEARSGSAGPVPSTR----------SGAPSRLSPAQRAGFPRENALEHSSDQDSVDSV-SLGDCGALSPGGGAESLLHGVSAK-EAGDPCRMHGSHLDHLQPSPCNTPRTEIVASPLQEVVSVDIVPTDYAHRTVSQPGPQPGPEG-LATELGLRSQVGALNRLPRGVEAHTGQGKVDSVVAVRGATAFDITNGCHELLSQGQEQVFVQTSHGLVLSHPGMLVSQEEDIVIVTNTE.. 838
18 2.000e-70UniRef50_UPI0007AA72F5 zinc finger protein 839 n=1 Tax=Ornithorhynchus anatinus TaxID=9258 RepID=UPI0007AA72F5  ali  40  7IQPKTITMNQPLHRNPNPSGLRVINPQILKIEPISGTGQQQYLLNSSANPSLQLLVQKPLPPLGPVSVKKIAAPKFLNGQRIVLAPVSPAATPVIPSVLSSSADSLVPNLEKNHTEKLKKSLKVKTRSGRISRPPKYKARDYKFIKTEDLADGHLSDSDDYSELSVEEDRRDREKDALFSSSGCYLRPKAFKCQLCEKSYIGKGGLARHYKLNPSHGQLEALLPRVFPSDKPSSEGMGVNSKMLAESPPISAVARIEGPHPGCATEPDPTPNGPQMSRSADVGLLLEAGQENGSLTRSGKPRGAKRRGRQSIPRKPRCSGFRPN------SLPDTSAEQTVVKRKARLKE-------------------------------VERHHSTKPFFADVYKEFEELHKMIKKLCQDHFSNSIVGFQKPLEIINNEVADSLGITEELLRKQKAQM---EGTSVHTSAEEGSAESGQQKRGNETPEETVTPAKRIRVD--QHQTGGHISHNGPTETSLQLSSPVVNEGFSQLPGRTPQSSEEPCGGRLPDVGRTTLQTTQQISVLADLEAGRDSAGSGNLFEAGPGTLNYAQVGSPGPVAHEQTLELLEEIVPAHSPDQNASGRLTASDASGVETAGGLADLLKSDISRNEEVRDENESQEHRVNREHPDQCKVANVVDQAQQLEKVLSGNLVPLDHSYRTLSEPQHAPGAEGLGPPQGHLDSPDKTLNQFPCGIE---ERGGLESIVAVGETVAFEITGESHELLSREHERIFIQTSDGLLLSHPGTVVSQTDGIVIVTQADG. 769
19 2.000e-66UniRef50_A0A2J8SZN5 ZNF839 isoform 6 (Fragment) n=2 Tax=Simiiformes TaxID=314293 RepID=A0A2J8SZN5_PONAB  ali  95  59IQPQTARKSQLPRGNSCLVGLHIASPQLLRVQPLVRTEPQSCFLSDLRQPPAQGFVQRPLPALQVVPAKRVPAPKAPNEQGSMLTRLSASDPLTVTSLSSSSAHPFISNLHTRHTEKLKKSLKVKTRSGRVSRPPKYKAKDYKFIKTEDLADGHLSDSDDYSELCVEE---------------------GFKCQTCEKSYIGKGGLARHFKLNPGHGQLDPEMVLSEKANGSTVRGCTEEKTLSLTSPGLSTPAAPCEGGARSCLVTESACSGLQNGQSVDVEETLPSEPENGALLGSERYQGPRRRTCSETPAESCTAVLQQRRAAQLPGGPAAAGEQRVSPSKARLKEFLQQCDREDLVELALPQLAQVVTVYEFLLMKVEKDHLAKPFFPAIYKEFEELHKMVKKMCQDYLSSSGLCSQETLEINNDK................................................................................................................................................................................................................................................................................................................................................................................ 468
20 1.000e-65UniRef50_H9FD38 Zinc finger protein 839 (Fragment) n=2 Tax=Boreoeutheria TaxID=1437010 RepID=H9FD38_MACMU  ali  91  23.QPQTARQSQPPQGNSCLVGFHIASPQLLRVQPLVRTEPQSCFLSDLRQPPAQVFVQRPLPALQVVPAKKVPAPKTPNERGSMLTPLSASNPLAVTSLSSSSAHPFVSNLHTKHTEKLNKSLKVKTRSGRVSRPPKYKAKDYKFIKTEDLADSHLSDSDDYSELCVEEDEDQRERHTLFDLSSCSLRPKSFKCQTCEKSYIGKGGLARHFKLNPGHGQVDPEMVLSEKAKGSTLQGCTEERTLGLPSPGLSMPAAPCEGGARSCLVTESAHGGLQNGQSIDIEETLPSEPENGALLGSERYQGPRRRACSETPAESHTAVLQQRRAAQLPGGPAAAGEQTASPSKARLKEFLQQCDPEDLVELALPQLAQVVTVYEFLLMKVEKDHLAKPFFPAIYKEFEELHKMVKKMCQDYLSSSGLCSQETLEINNDKVAESLGITEFLRNKEIHPDNLGPESPSREMDGEQPEGAGSEKREH................................................................................................................................................................................................................................................................................................................................... 497
21 3.000e-65UniRef50_A0A2K5HL15 Zinc finger protein 839 n=14 Tax=Euarchontoglires TaxID=314146 RepID=A0A2K5HL15_COLAP  ali  89  82IHPQTARQSQPPQGNSCLVGLHITSPQLLRVQPLVRTEPQSCFLSDLRQPPAQVFVQRPLPTLQVVPATKVPAPKTPNEQGSMLTPLSASNPLAVTSLSSSSAHPFVSNLHTKHTEKLKKSLKVKTRSGRVSRPPKYKAKDYKFIKTEDLADSHLSDSDDYSELCVEEDEDQRERHTLFDLSSCSLRPKSFKCQTCEKSYIGKGGLARHFKLNPGHGQVDPEMVLSEKANGSTLQGCTKERTLRLTSPGLSMPAAPCEGGARSCLVTESAHGGLQNGQSVDIEETLPSEPENGALLGSERYQGPRRGACSEAPAESRTAVLQQRRAAQLPGGPAAAGEQRASPSKARLKEFLQQCDPEDLAELALPQLAQAVTVYEFLLMKVEKDHLAKPFFPAIYKEFEELHKMVKKMCQDYLSSSGLCSQETLEINNDKVAESLGITEFLRKKEIHPDNLGPERPSREMDGEQPEGAGSEKREHEAAEEGLASVKRPRREALPSDTTESLAANSRGREKPRPLHALAAGFAPPVNGTVSPHSEESHTMTVSGGDGSMFQAGPQLHALADLEARSGSIGAAVSSQDVSGLRLYAQSGESRRLTQAQVAASPGENALKHSSDQDTRDSLRSPGFCSTLSSAGGAESLLPGRPGHAEAGHLGKVCDFHLNHQQPSPSGVLPTEVVAPLLEKILSMDSVAVNCACRTVPEPGPQPGPHGSLLTEGCLRSLSGDLNRFPCGMEEHSGQRELESVVAVSEAMAFEISNGSHEPPRPAEKQIFIQTSDGFILSPPGTIVSQEEDFVIVTNAEGR 882
22 6.000e-63UniRef50_UPI0003F06399 uncharacterized protein LOC102805193 n=1 Tax=Saccoglossus kowalevskii TaxID=10224 RepID=UPI0003F06399  ali  20  167..............NSAEVQSAIQNNQHITIVQVP-DRSLLGDFNNLGDKNFSNLIQVPSSLTLDNNVSNLLKTQNVTAATIPTANHLSNVVTTTPTPTVQPSPIVTAVGKQNKSDEKKKPRRAVTRSGRVSKPPTYRVRDYKTLRPGALA--MCSDSEEYSDYTPDDEDGEDDRSENVKYPFDSERPKRFQCDKCDKSYIGRAGLARHYRLQADHGSIEDIPEPAPTPTPAPVPKVQVTETDRPMPRRRGRPPRLIKPAPTSAEYAV---------------NTPNSVPTTATLDGNSMVQG---DGQSQTPSDVK----------------VIYQAQTLGKRKQRIKELLKTVGDEDLLELVLPRLSKVVTVWEFLLMKVEKGRPCRAYFPDVYKELGKIRKQVQRMAVECLNSSENEVDENMVIEDEVIANLLGIETGCYKVKSSMPEVEFKYKLLVTDPTEAERMPLDKRTLEVVSQDQSPTKKRKVDCQPQSPSKLNFGTSGATSDPTTMQVQVKSEDQP--RQVGLSTQLTYRGDSSPPPLQPLPLRHKQSTSAVQEAPPSTCIPETSQSTQQQTIETTNSGDLRQDNGVVIPSTVQQDSQLHTAATSTVN-------CNTVNSGEVSSNDFKMLTDSQAETEVNKPCE---------NSIVTEIQVEESRQQSQHRVLMLPPGFNLSKTQNGYAIDKPDGTTWQITGEGSIPLDTIQALLNMDTPQEIFQAQTNTGVNSEQVSKIVEVAQASVSQEEMELNTQNVDALAESHSTTSV............... 899
23 1.000e-60UniRef50_UPI000C7F0224 zinc finger protein 839 n=2 Tax=Euarchontoglires TaxID=314146 RepID=UPI000C7F0224  ali  67  7IQPKTPRQSQPPSRGSSHVGLCVTNPQLLKIQPLMRTRPLPCFLSDLPQPPAQVFIQMPLPAPQQVPAKILTIPKPSNGQGSTSTPLSASDPPVVTPVSSSSAHLFISHLHTKHTEKLKKSLKVKTRSGRISRPPKYKAKDYKFIKTEDLADGHLSDSDDYSELSVEEDEDQRDKQVLFDLSSCSLRPKTFKCHTCEKSYIGKGGLARHFKLNPGHGQLEPEKLLSEKADGSVIRGCLEEGTFLELSTPTALQGEGTLS--CYATETESARGNLQNGQSVEVEEALVSEPENGSHSALSENHLGSGSGCSETCAESSTAILQQRRTPQPHGSPAVAGGQNTSNGKARLKEFLQQCDQEDLVELALPQLAQAVTVYEFLLMKVEKVHLAKPFFPAVYKEFEELHKMVKKMCQDYLSTSGSCSQELLEIRNNKVAESLGTEEFWREKEIHPDCILPKHPSQETDGEQLEEASRQKRQNEAAEEGLASVKRPRREALPRDTTESLAANSGGCEKHGLLRAPTAS------------------------------EGQQLKAFADLEARSGSVGPTSSYQDVGGSALYNQSEEPRSLTQTQEAAFPEESALEHSSDQDIRDSLRSPGVYSILSSGTTVSQEEDIVIVTSAEGPALQMGPPE.............................................................................................................................................. 634
24 3.000e-60UniRef50_A0A1L8F9Z4 Uncharacterized protein n=1 Tax=Xenopus laevis TaxID=8355 RepID=A0A1L8F9Z4_XENLA  ali  34  150.................QVNLHSQNSNLRVFQ--LKTRAEHGEIKHGLDSAIQILVQQP---HFSETLKAKDTNKDTNKKTVNPVTLLKSQNYSVSVAKNMSKKKVSCNPEKLQKKDKCKKSKIKTRSGRISRPPMHKAKDYKFIKTGTLAHSSPSDSDDYSELS-GEDEDRKTEHVSFASQSFTVKHTLFQCETCEKSYMGKGGLLRHYRLYPFHGQMQ-----SSEINVSMPPGNEAEKR----------------------------------------------LFDTQKSKPSHLSKGPVSRGRPRRTGRCAARLGR-----PKKSLNSISSYSDIQLKTAKFKEFLQQYEEGDLKELVLPCLTKFVSVYDFLLSKVEDDQPGKSSFPFIYKEFEQLHSMVKLLAQEYVANTLESAEVPLEIKDYKVAESLGIKGDITGKYPSTDLTSESKTRSETKQKHKPECS--------DEEMLPPAKIPRMEGNVNESMN----EGGIGEKFSSI-TDANGKCCHPDSTAMPSSD........................................................................................................................................................................................................................................................................ 592
25 1.000e-59UniRef50_A0A2Y9JIT8 zinc finger protein 839 isoform X2 n=1 Tax=Enhydra lutris kenyoni TaxID=391180 RepID=A0A2Y9JIT8_ENHLU  ali  53  120.RPVPPLPTIQPKPALSQLPARTSRVLGPRPQPLLSTGPGPRFLSSSL--PVQLLAQGPLPALQPL---------AANGPGATPAPSPAPDPPALVSVSPSPANFFLSGLHTKHTKKLKKSLKVKTRSGRISRPPKYKAKDYKFIKTEDLADGHLSDSDDYSELSVEDDDEQREKQMLFDLSGCSLRPKTFKCQMCEKSYIGKGGLARHLKLNPSHGRLEPEVLLSEKANGSVTRGRTAG----------LTSPEPSTPALRSEEGAQSPGAGPQNSQSLEVEEALVSEPENGALLGSERHPDPRSDS-SVALMEASTAVVGRSGAAHPAKGARAAGVQSASRARAGLKE-------------------------------VETDHLAKPLFPAVYKEFEELHKMVKKMCQDYLSGAGLCSREPLEISNSKVAESLGLTEFLRKQEAHA-------RCGEPGPAEVEDACQQKRRHETAEEGLAWAKRTRREAPAPAPASPEPPAGGPQKPPTCAPAASKGCAPYVSGNGCYDSAESHTTLVSKSDRSVLPADQQLKALADLEAKSGSAAPALSYQHVGGPSLCPPLEEPRTQTQGQVAAFPEENVPEHSVAWKVGDSLRPQALCSTLISTGGADSLPPSGSGSLE------MQDSPQRGQRSSPSHILLREDTGPPPARVLSVDTVPADCARRTVQERGL--GQAGSPSSDGGQGSQAGDSHPFPCGPEACADQRGLESILAVGEAVAFEITHECHELLSQGQEPLFIQSSDGLILSHPGSLVSGEEDLVLVAGVDG. 853
26 2.000e-58UniRef50_A0A1L8F020 Uncharacterized protein n=1 Tax=Xenopus laevis TaxID=8355 RepID=A0A1L8F020_XENLA  ali  36  129..QQLKTEDQAVDQDTPIEGLHTHNSNLLGGRMFPKTQAEHRERKHELDSAIQILVQQPYLS-------EKHKAKDTNKKTLNPVTLLNSQNCSVSVARTASKKKVSCNTKLQKKDKCKKPLKVKTRSGRISRPPMHKAKDYKFIKTGTLAHSSPSDSDDYSELSA-EDEDRKKENVSFAAQSFTVQHTLFQCETCEKSYMGKGGLLRHYRLYPSHGQMQ-----SSEINVSMLSGNEAEKRLLEAQKSQA----------------------------------------------SHLSKGPVCRGRQRRTGRCVSRLGR-----PKKLLNSLSSYSDKQLKTAKFKEFLQQYEEGDLKELVLPCLTKFVSVYDFLLSKVKGDYPGKSSFPFIYKEFEQLHSMVKLLAQDYLANSLKIAEASLEIKDDEVAESLGIKRDITGQYSTPDMLPSECKTRSEM--------KQKHKPELDEDMLPPLKVPKVEGNVSEFME........................................................................................................................................................................................................................................................................................................... 558
27 4.000e-58UniRef50_V9KD97 Zinc finger protein 839-like protein (Fragment) n=2 Tax=Callorhinchus milii TaxID=7868 RepID=V9KD97_CALMI  ali  32  98VQPKTAASTQLGNQSNVSGGVNISGPQIIRIQPLSGSGPQQYILHSSSVPPIQLLVQRQPPPLAPVNSINVLPGVSISAQSGIFTNSIAASKSAVTAVVANSCTNAKKHELS-EKSKQKKPVKIKTRSGRISRPPKYKVKDYKFIKTEDLAEGHQSDSDDYSEYSLEEEEAKAKEEDRNLSLPCSFKPKKFKCETCEKSYIGRGGLARHYRLNASHGQ--------------LVSAPEEQRTSVNKPNGNVLVGDSGNGGDENGKLTPGRVVPSPELMTPPLIHATESVTVDSTTASSQGVQQPVKITSAHNFPGHRQTVRRGRP----PKQHNNTPQDQVLKRKARLKEFLKQCDDEELMELALPRLTKVITLWEFLLMKVERGRPARPHFPDVYKEFEMLHKHVKKMAEEQLSSRVISPQQPLQISCLQVAESLGMTEFMSKEKQQNADLSLSYSIVTVGDKNNLNSSGEKHALEKDGAFPPSSKRMRMDITVQTESNQCLTTEAGQKPTDCPAVNTCDAPTTSPGTLAAEVVDKHNDELLSGNPGEEQSNSEDLGFQVAEVTLSSSQLPLLESENQGLNNSIQEQESDFLTMDTDVTAEEIVQEQLSSRNQIPDHLSDPDLTSPVQSDDEMTNQNTTSSCVQELQHEISSQDPLCNQEQSEQINDSDIADQMQQLENALSHDVEPTEHICRTEVNSLQQQQQDCQVTSEEINLLEVVDPNKIMHVDEQNADQNILESTVTEDGTLQFQLPDGSQEFLAQGHEQIFIQTSEGLLLSHQGTAVHTSDGIVIVTNADG. 937
28 7.000e-57UniRef50_A0A2G5S891 Uncharacterized protein (Fragment) n=1 Tax=Caenorhabditis nigoni TaxID=1611254 RepID=A0A2G5S891_9PELO  ali  1................TTVGPSTSTSVPSSSSTTAEPSSSTTEVPSSSTTAESSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAESSSSTTELPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPPSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSFTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVP.. 781
29 1.000e-56UniRef50_W5P2X6 Uncharacterized protein n=7 Tax=Cetartiodactyla TaxID=91561 RepID=W5P2X6_SHEEP  ali  52  28.....................................GAPPCVLSHHPQPPVRVFIQRPLPALRPVPVKTVLAAEPPSGRSTAAVRLSASDLPAVTSVSSSSARLFISSSQTKHAEKLKKSLKVKTRSGRISRPPKYKAKDYKFIKTEDLADGHPSDSDDYTELSVEEDEDQRGRQALFDLASCSLRPKTFKCQTCEKSYIGKGGLARHFKLNPGHGHLEPEMSPSEKANGSVIAGPAEGNTCSLAPRGPPTPAPPVEEGAASAGRA------GQNGQSVEVEEALVSEAKNGSFSALLGSERHPGPRRRGYSTEPSTAVLEQSGMAHPPVGAGAT------RSRARLQELLHQCDRDDLVGLALPRLAQVVTVYEFLLMKVEKGHLAKPLFPAVYKEFEELHKMVTKLCQDYLRSSGPCSQAPLEVNNNKVAESLGTEEFLRKREGYADCVPGKCTSPEEAPAELEGARPQKRADEIAEDGLASVKRTRRDAVPQDPTECPAEDGGLQRPALRAPAAGAGFAPGVNGGASPGPEESPAMPAPKQEGSGAQAGHRLAALTGWAAQGGPVDPTALRQGALGRETGDRGPAPAGCAPWGE-------------YPDAGAGLGSPALCRTCL-----------QPGNSEAGSFCEACGSHL-----SSPESSAGEAPAPLPRKVWSMDAVRGPCRPQGAGTSCPERHTDQGLEAALPSG------------------------------RRAFELSNGCPAVLS-GIGADGSSDSDWLPLFHPGSLVSGEGDTVTVTDAEG. 717
30 1.000e-56UniRef50_A0A2P6KK90 Zinc finger protein n=1 Tax=Nephila clavipes TaxID=6915 RepID=A0A2P6KK90_NEPCL  ali  21  230......KPNAPLGSVENPIQITHKGNTYETTQCLTQAQLQQYVLQSQKANKIHNGGKSILPSTNTRIVCRVVHPSELQGNNLKLQNSDLVSKPNTLRRTSTSSKGKGCSRKSREEREEKKKQRPRTRSGRISKPPSYMVKDYKRIHHLDFDEDTYDSDGGYSDYHVSDEEAEKSQSKEEALPPGTSKQRNFACQKCSKAYIGKGGLSRHYRLHPNHGNM---------PEGEEISTQDENSSSSLASSVLSSSGNPTNNQHST---NSLPQTTVKFGNENQPEKV-----------------------------------------SQILSLTNSQANSLLERRKSRLREVLKSCSDEELIDSVLPILAQKVSLWDFFLRKCDEKSDGLRIF-EMLKEFEKFLIEMQKISHAYLSPASFEDHRKINISSKQIAEALSLERGAYFIKDSLIDASNITLEKNTLNNIHPHLP--------DEIIQPHAKRKRIDQSVEDVSNRLPDQILSDVHGSGSLELPLSDVT-FTGNSDFQRQDNHHILSSTLSASDSQNDASSKSLFDLNSSTNVTPSSLSSGCLSA-------VNSAKSLKANVFFSPNGAAQLHNLQMQKVQLLGS.................................................................................................................................................................................. 794
31 6.000e-56UniRef50_M4AVH7 Uncharacterized protein n=4 Tax=Percomorphaceae TaxID=1489872 RepID=M4AVH7_XIPMA  ali  39  1...................................................................................................................KRERKALKVQTRSGRVSRPPKYKAKDYKFIKTEDLAESHQSDSDDYSDMSVEEEENAKRDRPSPSSLSYSLKSRCHRCQTCDKAYIGPGGLNRHYKLNPTHGEPDLTGVTASSASNKVTRGGDNGLAAEGLTGLHYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPPKAPAEGSNLQLHWYFDVFGSETGACSINISVVSVGRPGRRGRPPKLGVIPVTAXXXXXXXXXXXXXXXXXXXXXELMDAVLPRLTKMLSLWELLLAKVKKTHMLLVCFPDIYHEFESLHAQVRQTAQDYIVSPQGGAM-PVEVRNIEVARSLGILDEVNKMKVLP.............................................................................................................................................................................................................................................................................................................................................................. 341
32 7.000e-55UniRef50_F1N4Q9 Uncharacterized protein n=3 Tax=Boreoeutheria TaxID=1437010 RepID=F1N4Q9_BOVIN  ali  68  1...................................................................................................................EKLKKSLKVKTRSGRISRPPKYKAKDYKFIKTEDLADGHPSDSDDYAELSVEEDEDQRGRRALFDLATCSLRPKTFKCQTCDKSYIGKGGLARHFKLNPGHGHLEPEMSPSEKANGSVIAGPTEGKTCSLASQGPPTPALPVEEGAASAR------RGLQNGQSVEVEEALVSEAKNGALLGSERHPGPRRSSFSMVPAEPSTAVLERSGTAHPPVGAGAA------RNRARLQELLHQCDQDDLVELALPRLAQVVTVYEFLLMKVEKGHLAKPLFPSVYKEFEELHKMVTEMCQDYLRSSGPCSQEPLEVNNSKVAESIGTEEFLRKKEVHADCIPCKCTSPEEAPEELEGAGPQKRANEIAGDGLASVKRTRRDECPAE.............................................................................................................................................................................................................................................................................................................. 374
33 3.000e-54UniRef50_UPI0005294CC1 zinc finger protein 839 n=1 Tax=Mesitornis unicolor TaxID=54374 RepID=UPI0005294CC1  ali  43  14IQSKTITLSQSVGRNSSIPGLGIINPQIIRIQPVTTEQQQQLFLHSSSESPIQLLMQRPFPSHGSVSVNKIPPSKTLNGQKASRAAASATRSPNAAVVAAGSANPLVPCEKTPKDDKLKKSLKVKTRSGRISRPPKYKAKDYKFIKMEDLADGHQSDSDDYSELSIEDDEEGKGKDALFSSSNYNLKPKMFKCQTCEKSYIGKGGLARHYKLNPGHGQLESPPQKIPSNKPDNACGIREEMMSPAHLDSVAVTLNTENALATSLEETVDLKAGEQTCKSAESRHLAEQQSESSSGHRGPAAPSKRRGRPRMGGRPRCSGRLSRPGQSPSKSLSSVSAEHNVFRRKARLKELIQQCNNEDLMELALPRLTKLVTVYEFLLMKVEKGYPAKAYFPDVYREFEGLHSMVKKMAYDHLSNSDLSCQQPVEIKDAK................................................................................................................................................................................................................................................................................................................................................................................ 463
34 4.000e-54UniRef50_A0A2J8SZN3 ZNF839 isoform 10 n=2 Tax=Hominidae TaxID=9604 RepID=A0A2J8SZN3_PONAB  ali  88  123IQPQTARKSQLPRGNSCLVGLHIASPQLLRVQPLVRTEPQSCFLSDLRQPPAQGFVQRPLPALQVVPAKRVPAPKAPNEQGSMLTRLSASDPLTVTSLSSSSAHPFISNLHTRHTEKLKKSLKVKTRSGRVSRPPKYKAKDYKFIKTEDLADGHLSDSDDYSELCVEEDEDQRERHALFDLSSCSLRPKSFKCQTCEKSYIGKGGLARHFKLNPGHGQLDPEMVLSEKANGSTVRGCTEEKTLSLTSPGLSTPAAPCEGGARSCLVTESACSGLQNGQSVDVEETLPSEPENGALLGSERYQGPRRRTCSETPAESCTAVLQQRRAAQLPGGPAAAGEQRVSPSKARLKEFLQQCDREDLVELALPQLAQVVTVYEFLLM--------------------------------------------------KVAESLGITEFLQKKEIHPDNLGPEHLSRDMDGEQPEGAGSEKREHEAAEEGLALVKRPRREALSNDTTESLAANSRGREKPRPLHALATG---------TIVSQEEDIVMVTDAEGRALQMGPPEGVPLEAVESLVTVEPEPSQRS.............................................................................................................................................................................................................................. 640
35 7.000e-54UniRef50_UPI000BAFD7CD uncharacterized protein LOC111130080 n=1 Tax=Crassostrea virginica TaxID=6565 RepID=UPI000BAFD7CD  ali  21  189..PSNQASGAPLGSSQNPIRIIQQGNQYTPMQNLSAEQLQQIMQVVQQQQVAKTSTAEGSPQTNTRIVYRVIYPSELHKNSPSSILKMGKKQSQGQQTPRRQYKKRMKEEESREEKEERKKHRPRTRSGRISKPPKHMVKDYKHLHVLDFEEEEAADDSDYSDYKYSEDEEDENDHVIEEPEGSTGKPKKFQCSVCNKAYIGQGSLERHYRMHPDHAP----------------------------------------EGLQFTTPMTSASHNGFNSTGNMSEDSNTQDSTSSTPPRFSSTRGPRRGGSRGRPPGPNA----------------------AFRRRSRLQDMISSCSDEDLIDIVLPRIAKVFTLWDFLLLKVQKGLPRRPQADHIYREFQTLAKEVKEVCGTFMQPATEKSANTLKVEDEKLAGAVGLEAGLYEIKEMPATQETTTFRSGTAISVNNVNTPVKRNLNMVEELSSPAKKFKPTMT................................................................................................................................................................................................................................................................................................................. 660
36 1.000e-53UniRef50_UPI00070456DD zinc finger protein 839 isoform X2 n=5 Tax=Eutheria TaxID=9347 RepID=UPI00070456DD  ali  53  10................................................................................................................................................................................................................................................................................CSQSVQGDEALVSEPENGSCSALSGSKRHPGP-RSVCSTAPAEPSAAVLEQSG---PHVGAGTAGARSPARSRARLQEFLHQCDQEDLVELALPQLARVVTVYEFLLMKVERGHLAKPFFPAVYKEFEELHKMVKKMCQDYLHSSGPCLQEPLEINNNKVAESLGITEELKKRETCTDCVPPKCTSQEMDREGPGEAGRRKRGNQTTEEGLASVKRTRRETLPQDT-EPSANIGGQQRPALWVSAASEGFGPGVNGCTSHLADDSPPRPASERDGSTAHAGQRLKAFADLAAGSGSADPAPWCRDVSGL----------GALALGWVAAVPENTQEHWTDAATGDSLRSWRLCSSSTSAGGVGSLLPGGSGSAEAGNLCEVRDSPVTG----PGEVLLAQAAAPPLDKVLSLDIGPADHAYGSVSEPGPQ------LCPEGGLGGHVGDLDQLPCGTETHTDQGELEHVAAV----AFEVTNGCH-----GQERIFIQTPDGLILSHPGPVVSAEGDIVIVTNAEG. 502
37 2.000e-53UniRef50_A0A2D4CGA5 Trans-sialidase n=1 Tax=Pythium insidiosum TaxID=114742 RepID=A0A2D4CGA5_PYTIN  ali  312ITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTT---PCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTTPCPITSKPEPKPTPKPEPTTPCPTSVTSKPEPKPTPAPSTPCPTGVTSKPVPSPEPTTKGPVPVPTTKAPEPTTPCPTGVTSKPVPSPEPTTPCPTGVTSKPVPTTAAPTPNPTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHQ................................................................ 1043
38 9.000e-53UniRef50_UPI000A32994E zinc finger protein 839 isoform X2 n=1 Tax=Mesocricetus auratus TaxID=10036 RepID=UPI000A32994E  ali  40  51IQPKTARQSEPP-RSSSSLGLCVSGPQLLRVQALGRAGSQLCFLRRSPQPPAPGLGQKPLPALQPVPSRRVKAPQ------------AANGLGVTLNPLAASGPPAVGPVSSS------------------------------------------SACLFIPAWHTVHTEKLKTSLKVKTRSGRISRPPKYK--------------ARDYKFIKTEDLADGHLSDSDDYSELSVDEEEEGTERRGLFHTEGCALRPKAFKCQTCEKSYIGKGGLARHFKLNPGHG----HLEPEVLLSEKANGSLTLGCAASET---------RGLASPALSTPAALCTGAAEPAWRTSQALQQCGREELVELVLPQLAQVVTLCELLVVKVERSRGAKPFFPAVYKEFEELYGVVKRLCQDYLRSSGLHSQEPLEINNDEVARSLGITEFLRRKETHPSSAP--ECSCQEMEEKLQEASGHKRERAWAVVVTGEGLASVKKARTADVPECPAAISGCQQKPGSSSAPSKGSARAVIENPSPCYEGSCGEMVTASGRRVSSAGPQLMASADFEARSGSTDPDLLCQDVSRSALYSQVAEPRGLSPAQMPGFSEENVPEHSVEQNSGAVQRSTGVCGTPSSGGGVESLLLGEWGNAEAGDIREMSQPHLRGQQASPRHALPEEAAAFPLHSILPVTVPPAAGASKTVREPGQHPVPDGASSAKGHPGSEAGDVSQLLPRMEA-DGQREPETVAAVGEALASEISDMCQEVLSQGQEQILIRTPSGLILSNPRAIVSQEENTVIVTNTGG. 770
39 6.000e-52UniRef50_T1J616 Uncharacterized protein n=1 Tax=Strigamia maritima TaxID=126957 RepID=T1J616_STRMM  ali  21  131.........APIGSSANPIQIIQQGNTYHSTQMLSQEQLQQIAQVLQQQQQLSQLSPNGSTSTNTRIVYRIIYPSDLNNKSKNVTAATEVKVQAAASIVKGRGRPRKPWGRRFEDVEEKKKHRPRTRSGRISKPPKHMVKDYKRIHYLDFDDEPYDDSDGYSDYHVSGEDDGSRSSTSSAATTGTSKSRRYRCGSCDKSYIGRGGLSRHYRLYPGHGNADDIEPEIAGTSAASVDGM------------LSGPGTPAESSQASNDAILPS---------------------------------------SSTPTFITSTPMPVKRGRGRPSSHEIAS----LRRKAKLEELIKHCENEELMETVLPRLAEVVSVWEFLLMKCEKGSPTRASIPDICKELESLIKQAQKVAQEYMTLVPEDSADKYELTSSHLAGMLGLTPGQYNVEEMQKPEAPRYKMLTADPTEIKRTHATRRTIEVVDAESSPVKRRRMSAENETKPDINETNINLLPMEILQESQEDSLDFVQVGNASNGNNVFRDETEPKAENTETQPSPSETVEGKV--------VNDKPQAFENVENVTQVVETAFVNPNNTDETTENN.................................................................................................................................................................................................. 701
40 7.000e-52UniRef50_V3ZH75 Uncharacterized protein n=1 Tax=Lottia gigantea TaxID=225164 RepID=V3ZH75_LOTGI  ali  22  182..PANQNSVAPIGSSQNPIRIVQQGNQYTPVQQLTAEQLQQIMHVVQEQQLAKSADSNNGPQTNTRIVYRVIYPSELHKSTSNSSTENTSITGSQTGVDNTQIQRRAYKKRTREDEEDKKKHRPRTRSGRVSKPPKHMVKDYKHIHVLDWDEDYDDSDGGYSDFKISDEDENSRDAAETDGLSGVERVKNHKCETCDKAYIGQGGLRRHYQLNPSHGSL-------------------------PDDIEDVDKASSINSNNNKSNGSICSLSEDSNTQDSLLSQSV--TPTSNTVIQPTKRRGPGR--------------------------PPFNVEGAPGKRRAKLQDLIRQCTDDELMEIVLPRLAKVVTLWEFLMMKLEKGGKATPKVEDIFHEFESIQKQVAKTCQDCLIPMEPSAGSKLQIEDSSLAASLGLKIGQYQVKVQEKSFHYKFLTTEPRGPVPTKRQNNRRTIEPDELIQTNSKKPRMTTILNNNVLSMAAKSATPTVVKSSSSSSLLTPSLSNSSITPISQNHTIISEPLSTSSLPITSQFVNTASTSNGTSHVRNTQTVILTNSAPTSNS...................................................................................................................................................................................................................... 774
41 9.000e-52UniRef50_UPI0003F11AAF zinc finger protein 839 n=1 Tax=Chrysochloris asiatica TaxID=185453 RepID=UPI0003F11AAF  ali  42  129VQPRTWRPSPLAARSPSL-----AGPQLLRAQPLLKTGPQPCHLSSSPQPPVQVFVQRPLPALSAISVKRVTVPKAPSGE------AAGASQPALPSISPGSANASVSDLHIKQTEKIRKSLEVKTRSGRISRPPKYKAKDYRFIKTEDLADGHPSDSDDYSELNVEEDEEQRGKGALFDTSPCSLRPKTFKCQTCEKSYIGRGGLARHFKLNPGHGQLQTAELLPERARGHSLQGHTEDGTTSPVPPELSTPSIRSEERALQTLLLLLSSCQCLKLTSWGFGAPSATSATAGSLSWTSLVKAPLTAQVTRGIVTALSFTPLLVPTLSQPSGHVLTVKKLGVFRDVKLLVVPQQCGREEVTEVAPPELTPVVTVYEFLLMKVARSRLAKPLFPAVYKEFEELHTMVKKLCQDYLRSASHSSLEPLEIHNTKVAESLGITEELLREREVRLDSLPGRCGGHEAD--RAEAGRRKREGETPDELLVSVKRTRRETVPQDATEPLAVPNGSQERPRTMCVPAVQEAICCNLQV----NGHASYPGPVSGDSLRLVGQLCGTLADVGGHSGSADSMPLPQGAIGL---------------------AQDTQEHSGQHAGGRLLCPSLDSSSVSSGGPGALLLGGVQNAGASPSPITLTDVP-----------------------ALFPEAEPADQASKTAAEPGLPPDLDKLPAASRGLGSHMGG-----CGLEEHAEQTELENIVAVGETLALEIASGGHQLFPQGQEQIFIPTANGLVLSHPGTLVTGEEDVVIVTTVEG. 885
42 3.000e-51UniRef50_UPI00084DA6EA uncharacterized protein LOC108698783 isoform X2 n=1 Tax=Xenopus laevis TaxID=8355 RepID=UPI00084DA6EA  ali  36  150.................QVNLHSQNSNLRVFQ--LKTRAEHGEIKHGLDSAIQILVQQP---HFSETLKAKDTNKDTNKKTVNPVTLLKSQNYSVSVAKNMSKKKVSCNPEKLQKKDKCKKSKIKTRSGRISRPPMHKAKDYKFIKTGTLAHSSPSDSDDYSELS-GEDEDRKTEHVSFASQSFTVKHTLFQCETCEKSYMGKGGLLRHYRLYPFHGQMQ-----SSEINVSMPPGNEAEKR----------------------------------------------LFDTQKSKPSHLSKGPVSRGRPRRTGRCAARLGR-----PKKSLNSISSYSDIQLKTAKFKEFLQQYEEGDLKELVLPCLTKFVSVYDFLLSKVEDDQPGKSSFPFIYKEFEQLHSMVKLLAQEYVANTLESAEVPLEIKDYK................................................................................................................................................................................................................................................................................................................................................................................ 501
43 1.000e-50UniRef50_G3MZX9 Uncharacterized protein n=17 Tax=Pecora TaxID=35500 RepID=G3MZX9_BOVIN  ali  59  7IQSKLAGPGPPPSGHCSAVGLSSQ-----------LLGPPPRVLSHHPRPPVRVFIQRPLPALRPVPVKTVSATEPPSGRSTAAVRLSASDPPAITSVSSSSANLFISSSQTKHAEKLKKSLKVKTRSGRISRPPKYKAKDYKFIKTEDLADGHPSDSDDYAELSVEEDEDQRGRRALFDLATCSLRPKTFKCQTCDKSYIGKGGLARHFKLNPGHGHLEPEMSPSEKANGSVIAGPTEGKTCSLASQGPPTPALPVEEGAASAR------RGLQNGQSVEVEEALVSEAKNGALLGSERHPGPRRSSFSMVPAEPSTAVLERSGTAHPPVGAGAA------RNRARLQELLHQCDQDDLVELALPRLAQVVTVYEFLLMKVEKGHLAKPLFPSVYKEFEELHKMVTEMCQDYLRSSGPCSQEPLEVNNSKVAESIGTEEFLRKKEVHADCIPCKCTSPEEAPEELEGAGPQKRANEIAGDGLASVKRTRRDECPAE---------DGGLQRPAECAPAAGFTPRVSGVASPRPEESPSIPAPEREGSVAQVGHRPAALAGWTARGGPADPTALCPDALGQGSPVP..................................................................................................................................................................................................................... 564
44 2.000e-49UniRef50_UPI000BA7E5A1 uncharacterized protein LOC106469767 n=1 Tax=Limulus polyphemus TaxID=6850 RepID=UPI000BA7E5A1  ali  23  511LQPKSKT--APLGSSENPIQIIQQGNTYHSTQVLTQEQLQQIAHVLQQQQISKSSESGSSPATNTRIIYRVIYPSELQTKSSSKKDGSIRGGIKRGRGRPRSVKKVTQDEPSQEEKELKKKHRPRTRSGRISKPPSYMVQDYKRIHHLDFNEDPHDDTDGYSDMSDEESENMHQGPKYLPPGVNTVRPRTHKCSSCDKAYIGQGGLARHYRQYPSHGKL------PNPEENSVYEDENSNTSAISNSTTSTGQIASVIDSAKEATVSEKIDGTSKTDPDISSKNLCGSASTENQTANSEPIEKPRRRVNVAK-----------------------------IRRQNKLKDVLRHCTDEDLLEVVLPRLAGVVSLWEFLLKKFQLEDANELEITDMFDQLTTLMTRVRALAQDCLTSSEESSRSTVKIHSEELAELLGISTGVYQTKPWKK---PHQAEVPSEPQSFTEPSDSHCSKETGAEA............................................................................................................................................................................................................................................................................................................................. 977
45 9.000e-48UniRef50_UPI000D17F545 zinc finger protein 839 n=1 Tax=Desmodus rotundus TaxID=9430 RepID=UPI000D17F545  ali  54  32IQPRTAWPSQLPGRHCSVLGPRVTSPQLLGARLLLSTQPQLRVLSSSPQPPVQALAQRPLPALRP-----VMAPPALNGPGATLAPRSASDPLAVTPVSSSSSNLFISNLHTKHTEKLKKSLKVKTRSGRISRPPKYKAKDYKFIKMEDLADSHPSDSDDYSELSVEEEEEQREKQALFDLPSCSLQPRTFTCQKCAKSYIGKGGLARHFKLNPGHGPPPPEMLASGKADGSRTQGLPSARGCLQNGQSVEVAEASVSEPA---------------------------DGSYSALLGTERHPGP-TRGCAVAPTEPRAAALQRSSVARSSAS---------------LQEFLHQCDRQDLVELALPQLAQVVSVYEFLLMKVEKDHPAKPFFPAVYKEFEELHKMVKKMYQDYLHSSGPCSQEPLEINSNEVAESLGITEGLRKRETHTDGVPHTCSSHGTDWAGPEAAVPRKRESENVEAGLASAKRTRRAALPKEPIASSADSGGQQTPAGGAPAASQGFAPRVSGSTCHRPEEDHRTLVSDLDPSASQVGWQLKALSDSAARSGSADPTLSHQDVSSVVSGEEDVVTLTEVEGPVLQTCPPEGAPHVAVEAAPSQ..................................................................................................................................................................................... 602
46 1.000e-47UniRef50_A0A1A6GIW9 Uncharacterized protein n=2 Tax=Muroidea TaxID=337687 RepID=A0A1A6GIW9_NEOLE  ali  42  111IQPKTARQSHLPGRSSS-LGLCVSSPQLLRVQALGRTGSQLCFLRGFPQPPAQVLVQKPLPALQPVPLRRVKALQAANGHGVTL------------SPLAASGPPAVAPVSSS------------------------------------------SACLFISSLHAAHTEKLKKSLKVKTRSGRISRPPRYK--------------ARDYKFIKMEDLADGHLSDSDDYSELSVDEEEEEREKRGLFDIEGCGLRPKAFKCQTCEKSYIGKGGLARHFKLNPGHG----QLEPEVLLSEKANGNPTLGCIDSKT---------RGPASPTLSTPATLCTEEAESAWRIMQALKQCGREELVELVLPHLAQVVTLYELLVVKVERSPGAKPFFPAVYKEFEELYDVVKRMCQDYLSSSGLCSQEPLEINNDEVARSLGITDFLRKKETHPSSAPECSSPKLEGKLEEASGQKREREQAATGEGLATAKKARTVAPPTDVPQCPATISGCQQKPGSLCAPSKGSAPAATEKPSPCSEGSCGEMDPASDXSVPPXGQQLSASADSEARSGSADPALLCQDVSRSASYSQVAEPREPPPAQLSMFSEENAPEHTVEQDSGAIQRSNIVCGTPSSGGGVESLLLGESGNAEAGDLREMSQPHLRGQQATPSHDLPAEATAFPLQNILPVNVLPAACVSKTVPKPGPHSGPDGSLSTKGGPGSKAGDISHFLSRMEA-DGQREPETVAAVGEALAFEIPDVCQEV-SQGQEQIFIRTSSGLILSHPSTIVSREENVVIETNVGG. 834
47 3.000e-47UniRef50_H9G3C1 Uncharacterized protein n=1 Tax=Anolis carolinensis TaxID=28377 RepID=H9G3C1_ANOCA  ali  42  1...................................................................................................................QKIKKSLKVKTRSGRVSCPPKYKAKDYKFIKTEDLADCHQSDSDDYSELSLEDDEGGKGTETLFDSLKNDLRPKLFKCQSCEKSYIGQGGLARHYKLNPNHGQQEPSFLINRPQKKTLLENIGKRSSEAPSVTATLEWARPVSDGKCSCELIHTVQKRKENSTIFKVKNSFNQYKLNSISM--EDLRGHPVQPPSAIP--EKTIKTSQQMATSCXXXXXXXXXXXXXXXRSNGKELSQHFPNEDFMEQAVPHFTKLVTVFEFLLMKVEQKYQKKALFPDVYREFEELHAMVKRMCQDYFGN--PELRKPVEVNNEKVAESLGITDCFLLLKKTQVDCSPEY-IETTSDCVFTKTVEQKCATE.................................................................................................................................................................................................................................................................................................................................. 359
48 9.000e-47UniRef50_A0A151P8I1 Zinc finger protein 839 n=1 Tax=Alligator mississippiensis TaxID=8496 RepID=A0A151P8I1_ALLMI  ali  32  32..........................................................................................................................................................................................................................................AGGTEDESVSLMLSEPITVTLNNENAASGFEETASSQGEQQTGKSSEDKHLLATQQTESGLV----HRGPGVPKGPGRAGRSRCSGRLSRSGRSPSKSLNNVSTDHVFRRKARLKEIIQQCDNEDLIELALPRLAEFVTVYEFLLMKVENGCPARAFFPDVYKEFEELHNMIKKMAQDHLCSSDLSSQQPIEIKNPKVAESLGITEKILEKQTQAADSSQQCTIKTMVEQVPAEIVGQKRVIENSGELLPSAKKTKVEDPSGNMNDVYANQNGVKQKSGSLNTLTDGFNPLNGETV--HSEDRGTAVLSQTEGIVIVTD------ADGTTMHIRTPDGVPFETVEALLAMEADGQSEDILLSHSEEEP..................................................................................................................................................................................................... 404
49 3.000e-46UniRef50_UPI00080F7102 cellulosome anchor protein n=1 Tax=Clostridium thermocellum TaxID=1515 RepID=UPI00080F7102  ali  1370........................................................................................................................................................................................................IQPAPIKAASDEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPTPSDEPTPSDEPTPSETPEEPTPSDEPTPSDEPTPSETP.. 1967
50 3.000e-46UniRef50_G3TFN3 Uncharacterized protein n=3 Tax=Eutheria TaxID=9347 RepID=G3TFN3_LOXAF  ali  41  7IQPRMARSNLPPGRNHSLLDPGVTSPQLLRVQPLVKTGPQPCHLSSPPQPPVQVFLQRPLPTLSPVSVKR------------TAAPKAPGGQGATSAPPPASNPLALTSLSPS------------------------------------------SANVFISNLHTKHTEKLKKSLKVKTRSGRISRPPKYK--------------AKDYKFIKTEDLADGHPSDSDDYSELSVEEDEDQRGKEAPFDFSSCSLRPKTFKCQTCEKSYIGKGGLARHFKLNPGHG----QLEAVVLLSEKANGCIPQVCAE-----HRAIGPVSLEASAPATLMCLHESSLIESAWQTLQPLYQCDQEDVVEPALPQLTSLVTVYEFLLMKVGRSHLAKPLFPAVYKEFEELHEMVKKMCQDYLRSCGPCSLEPLEINNSKVAESLGITEELRKRATHTDGLPGRRTGGGTDRAELAEAGGQKREKE----VLASVKRTRRESVPKDATEPLAAPSRGQERPRTECVPAEGRGPQVSGHSSCPCGEAHPTAGPVSSCNVLPASQELRVFGDIDAQSGSVGSALLPRAASGLALHTQLAQDTQECSGQRAGV----------------SPGGSGLCSTLVSSGGPGSLLSGRAGSAGVGNLGSECTCRPDGPQPSPSTVTLTDVATPLPKTALSPEALQVDHASTTAPGPGPQPGLDGSQSAATGLESHVGDWSQFSCGAEEPAQETELENIVAVGEAMAFEITSGCHELFSQGQEQIFIQTS........................... 684
51 2.000e-45UniRef50_F6WZF6 Uncharacterized protein n=1 Tax=Ornithorhynchus anatinus TaxID=9258 RepID=F6WZF6_ORNAN  ali  37  1.............................................................................................................................................................................................................................................................................................................................................................................................VERHHSTKPFFADVYKEFEELHKMIKKLCQDHFSNSIVGFQKPLEIINNEVADSLGITEELLRKQKAQMEGTSVHTSAE---EGSAESGQQKRGNETPEETVTPAKRIRVDQHQTGGHISH-NGPTETSLQLSSPVVNEGFFSPFTLLTPQSSEEPCGGRLPDVGRTTLQTTQQISVLADLEAGRDSAGSGNLFEAGPGTLNYAQVGSPGPVAHEQTLELLEEIVPAHSPDQNASGRLTASDASGVETAGGLADLLKSDISRNEEVRDENESQEHRVNREHPDQCKVANVVDQAQQLEKVLSGNLVPLDHSYRTLSEPQHAPGAEGLGPPQGHLDSPDKTLNQFPCGIE---ERGGLESIVAVGETVAFEITGESHELLSREHERIFIQTSDGLLLSHPGTVVSQTDGIVIVTQADG. 410
52 2.000e-44UniRef50_V9KM92 Zinc finger protein 839 n=1 Tax=Callorhinchus milii TaxID=7868 RepID=V9KM92_CALMI  ali  27  2.................................................................................................................................................................................................................................................................................................................................................................................................................LHKHVKKMAEEQLSSSVISPQQPLQISCLQVAESLGMTEFMSKEKQQNADLSLSYSIVTVGDKNNLNSSGEKHALEKDGAFPPSSKRMRMDGVQKVEDNLQCLTTEAGQKPTDCPAVNTCDAPTTSGTLAAEVVDKHNDELLSGNCTMGPGEEQSNSFQVAEVTLSSSQLPLLESENQGLNNSIQEQESDFLTM-DTDVTAEEIVQEQLSSRNIPDHLSDPDLTSPVQSDDEMTNQNTTSSCVQELQHEISSQDPLCNQEQSEQINDSDIADQMQQLENALSHDVEPTEHICRTEVNSLQQQQQEADISDQVELDCQVTDPNKIMHADEQNADQNILESTVTEDGTLQFQLPDGSQEFLAQGHEQIFIQTSEGLLLSHQGTAVHTSDGIVIVTNADG. 460
53 3.000e-44UniRef50_UPI0006443CE4 zinc finger protein 839 n=1 Tax=Clupea harengus TaxID=7950 RepID=UPI0006443CE4  ali  32  322LQSKPMAVT--PIRGKVTTASVVGSPHVIHITPLPG--QQQYILQNPGEPPIQLLLQRPAPPLVQIPVNGSPVRPPAPKVTPLVVPTAKVTPVPTTRAPVAKPAPAKEKERPRGRKRAKKPQKIQTRSGRVSRPPKHKVRDYKFIKTEDLADSHQSDSDDYSEISVEDEEEDGKKKGVD--VNFNLTPKAFKCETCEKCYVGLGGLSRHYKLNPSHGT---SPAPSQATGGAPAPASATTAATSVKAEAVSGGLQP---------PQQXXXXXXXXXXXXXXXXLVGRPPKRGRPGRPPKIQPPNIAXXXXXXXXXXXXXXXXXXXXX------------------------------DLMEVVFPRLTKVMTAWEFILMKVETGRTTKSQFAEVYREFEQLHGQVKKMAQHH------PSGQTLEVHNMEVLRSLGITDRPSLAKPL---VPAPTPPATTTGPQEAVASKNIRHMENT-KMLPPAKRFKMENTNGFQISQNGLQKPLVEEASKKEATAVQAGTAA................................................................................................................................................................................................................................................................................. 809
54 7.000e-44UniRef50_A0A1W4Y3P1 zinc finger protein 839 n=1 Tax=Scleropages formosus TaxID=113540 RepID=A0A1W4Y3P1_9TELE  ali  26  58FQQKNVSVNQLPNRVNVSTGVNVTCPQIIHIAPVVGEH--QYLLHNAGDPPIQLLVQRPEPIMGNFIPVLQKIP------LQNPINGNAVKSTTTSSSNVTLTSTVEKKDRQKEKKHSKRPQKIKTRSGRVSRPPKYKVKDYKFIKREDLADGHQSDSDDYSEISMEEEEGEETNSNIAT-MNLNLNPKAFKCETCDKAYIGNGGLSRHYRLNPSHKEQQGTVSETGSAMLPLGNSDTRVTPGQAAVEKVFVCTTQIQSSPEAVSTTDSTAGLAQQDEQKVEPLHVEGTHLGSEQRESCGPGRPKGPGRPGRPKIGARAGRRGRPGRPPKHCGGTSMDQQNQRKKALLKEVMEKCSNEELIEMVLPRLAKVMTVWEFLLMKVDKGCSSTPQFSDVYQEFEQLHSQVKKMAQSHYSM--PGPHTPLEVNDPQVSLSLGIKDSVIIPKLLCSDPGNQ---KTEDVSKEISPPSKKAHHSEEFKTLPPAKRFKLENTSVESNGVYLDQIVTEKVAENGHSLSEA---PRKDMEFVPRGHQQALLESKSHLSIIDLQPSSKTQTHTEAVALKSQVV--------------------FSSIETNFTPVDLVEEHLPSEESANAEDIHKLVIDGVPQICSE--------------VSEKSETATEMETSNVLNDSDIADQMNQLEQVLNTDVVPLDHSYRTSVQ-------------------EPQPPTETVNGLE---QERSLESTISLGGTVEFQVGEESQK---NDFDQVFFHTEDGLIVHHTGESLA-ADPIVIVTNPNG. 791
55 2.000e-43UniRef50_UPI0009A40341 zinc finger protein 839 n=1 Tax=Rhincodon typus TaxID=259920 RepID=UPI0009A40341  ali  28  400VQPKPAASSQLANRTTVSGGVNISGPQIIRIQPISTSGTQQYILHSSSEPPIQLLVQRQPPPLAPVNAIRVIPGVSISGQSGIASTSVTAITTAVGNSVCSSHTK---KHEPSDKSKEKKPVKIKTRSGRISRPPKYKVKDYKFIKTEDLAEGHQSDSDDYSEYSFDEEDVKTKVDESSLSIPCSFKPKKFKCDTCEKSYIGRGGLARHYRLNPSHGQLASVSEEQRTSVDKSNGNVIIGGNGDDRNGQMAPELVVSSIGTDATSVMVDSTAPSSQDFQQTEKVALARHF--------------------------PGHRRTVRRGRPPKHHNNAYQQDQVLKRKARLKELLKQCDDEELMELALPRLTKVITLWEFLLMKVEKGRPARPQFSDVYREFEMLHKHVKKMADEHLSSSITNPQQPLQISCTQVAESLGITEYTNKENQQDASVSLTYRLVTVDDQNHLNSSGEKHSMERDFGTLSPSSKRMKIDDSVTVTENNFNQNGEGQKQTPCPTLNASEAHTMYGPADVQVFDKHTDDGVLVSESSSVEQSTSEELCYQVSQVTLSSTQLPLLEQHNEVLNSTIEGQDDFLAMDTDITAEELVQEQLSYQNIPEQLNDTQLTTVQSEDEITGQASEASNSVQVLQHQLGNQDPLGNPEQAEQLNDSDIADQMQQLEKALSRDVEVCSSESNHLQQHQPEQTFEADISTEVDLAGQVSPE............................................................................. 1128
56 2.000e-43UniRef50_UPI00077F93CD uncharacterized protein LOC107453009 n=1 Tax=Parasteatoda tepidariorum TaxID=114398 RepID=UPI00077F93CD  ali  19  300.......TNAPLGSVGNPIQIIHNGTSYLSTQMLSQAQLQQ-ITHVLQQQQAKKLANGGEPNTRTRIVCRVVQPSEL--QQKLSKPETSKANNCLPAVGKGRGRPKAKSSFSKEEREERKKHRPRTRSGRISKPPNHLAKDYKRIHPLDLNEEVYDDSDGYSDYHVSDDEVKQKEAKASSLPPGTAKPRKYSCVVCDKAYIGRGGLSRHYRLNPGHGSL---------PEGEDASTQDENSNSSMASSILSNSGSNTNNQSIPVIPTPSSKQGPSILQEALTQDSFPSEQ-------------------------------------QKPQAPVNEITPPIDRRKSKLKEILKGYSTSELVDVLLPKFAEEVSTWKFFTTKCHRETEGETLF-EMLKEFEKFLTPMQRVSCSCLSRASEAGKTIINITSQRLAEVLTLEKGSYTVNSTENTVPLSSAESEVPNHPLHSFPKRKRLDPSVEQILSDAQESNCLDLPMSEESFSETADFHHQQTNLLNVCVAKGAIQLNSSTIVTPSSLSSGCLSAVNSSDLQKGIQLQNMQNAALQNQTFSTAANAMALNGLALSSNSILGGLTSQTQVKDSVAVQHQEDLVSSSSAIENKAFRAIGLESAAGIFNSCPELSQANLIDTHQSSSNAEPQSDVQENLANCLVVADIAHSLENPSESDIQTCVSAGIIPASSHPVERQFQVTSTDIVSSDNVKSPEQAVLRQLMLPDGRIIGVWSSVDNAD-----KASNEQILQGGNLILVQNSDGSI....................... 1105
57 4.000e-43UniRef50_H0YM06 Zinc finger protein 839 (Fragment) n=5 Tax=Homininae TaxID=207598 RepID=H0YM06_HUMAN  ali  99  3..........................................................................................................................................................................................................................................................................................EETLPSEPENGALLRSERYQGPRRRACSETLAESRTAVLQQRRAAQLPGGPAAAGEQRASPSKARLKEFLQQCDREDLVELALPQLAQVVTVYEFLLMKVEKDHLAKPFFPAIYKEFEELHKMVKKMCQDYLSSSGLCSQETLEINNDKVAESLGITEFLRKKEIHPDNLGPKHLSRDMDGEQLEGASSEKREREAAEEGLASVKRPRREALSNDTTESLAANSRGREKPRPLHALAAGESPPVNVTVSPRSEESHTTTVSGGNGSVFQAGPQLQALANLEARRGSIGAALSSRDVSGLPVYAQSGEPRRLTQAQVAAFPGENALEHSSDQDTWDSLRSPGFCSPLSSGGGAESLPPGGPGHAEAGHLGKVCDFHLNHQQPSPTSVLPTEVAAPPLEKILSVDSVAVDCAYRTVPKPGPQPGPHGSLLTEGCLRSLSGDLNRFPCGMEVHSGQRELESVVAVGEAMAFEISNGSHELLSQGQKQIFIQTSDGLILSPPGTIVSQEEDIVTVTDAEGR 521
58 1.000e-42UniRef50_UPI000CCC5E28 LOW QUALITY PROTEIN: zinc finger protein 839 n=1 Tax=Myotis lucifugus TaxID=59463 RepID=UPI000CCC5E28  ali  43  171VHPRTARPSQPPGRHCRVLGLSVASPQLPRAQPLLSARPQ---------PPVQVLLQRPLPALQPVPAVRLVAPQAPNGLGATSAPQSASDQPAVTSVSSSSANLFISNLHTKHTEKLKKPFKVKTRSGRISRPPKYKAKDYKFIRMEDLADSHPSDSDDYSELSVEEEEEQRDKQALFDLPSSSLRPRAFRCQTCGKSYIGRGGLARHFKLQPGHGXXXXXXXXSEKAKGRMARGCAEGRPRGPTSPGPSTPAPLSAEGAPSARGGLQVRFLSGGSEGFRQRLEQNQVPFWGHLGASSPLVAPPNTIQNGQPIEVEAWESERHPGPERGYTPAPAGQSRAARSRAALQEVLQQCALEDLVELALPRLAQAVTVYEFLLTKVEKGHLAQPLFPAVYKEFEELHQMVKKMCQDYLRGPSPRSQEPLEIKDPEVAESLGITEEFLRKEETHTDGIRHTCSGREAASPPEREPRPQGKRCLQRKGPEGQLCPRSPPRLPPAAAAREHLRRPR---------AASKGLPLESMGPPDPGVRKATPHRGLRATAARAGPAAESACRGSSQEPVCGAPLAWDVSGPGLHAQPGQPSRGADPEPAAASPTEGAQGPSSDLDAGVKPGWRGLRCGCMSVGGVHPCCLPGLETPSAGEALLTRLRSLRRRKS---------------------------CPCSPVSQPGLRCLLGGS-------RGHVRGLDQLPFGTRPHTDQREPESVIAVGEAVXFEIASGCQELL....................................... 915
59 2.000e-42UniRef50_UPI0006B1E816 zinc finger protein 839 isoform X1 n=3 Tax=Serpentes TaxID=8570 RepID=UPI0006B1E816  ali  36  177..PKNIAGSQAVEKNSKPLGFSAINTEIFQIHTLTGTGSQHFFLCNSSKPTVQLLLPASLHPPGQVPLSKIIT----HGQKHKSITKDREDSSNVSLVPSCSAKTIVNEGKQPKEQKIKKSLKVTTRSGRISHPPKYKVKDYKFIKTEDLADCHPSDSDDYSELSLEDDECNKVKEELFNTFNNDLRPKLFKCQNCEKSYIGKGGLSRHYRINPGHGHQESSESSSINRFSRMTQLECAEKANCESNHQPSSPLPITLALVSKNGLAAELEKNLQTHQSEISAEDRKSEAYSTHLGPGRRKRQRRSYQPKMANRSRCSTTFNSLGQLSSNSLSISAEHLSRFKRKEKLKELIQQCTNEEFMELVVPRMTTVVTVFEFLLMKAEKRCQTKATFPDIYREFEELHAMVKKMCQDYFNNS--ELKQPLEIKNHKVAESLGITDCYLEVPKIQTNSFPEC-TESTDQPILLHISGQKRAAEF................................................................................................................................................................................................................................................................................................................................. 650
60 3.000e-42UniRef50_C3XR99 Uncharacterized protein n=2 Tax=Branchiostoma TaxID=7737 RepID=C3XR99_BRAFL  ali  24  331...HTVYVLQKPGQSNVQQQVQTVTAAPPTSQPNVHVVPQLIHRTGQNTQPIQILHKPGQPQGQTVHIAQPTGATQVLQQQAQLVRQQQQVLVIPQNQPKKRGRKPKAALAEKQEDKEKKPHKQMTRSGRVSRPPSYRVRDYKVIKTEDLADSQDSSEGEYSDYSPDSDDDAAKLSKDDKPPLMSEKPRGWKCETCEKAYIGRAGLGRHYRLYPEHGHLEPEE------------------------GDEKTPGTPVEKDRRSQGNADVLSSPIGTVTSFSGTIETSGPP----------------PQTPSTASNNRAAVGSETPVKRGPGRPP--TQHGEARRKAKFRELLKQMNDEELMELALPRLTKAITLWEFLLMKVERGRPSRAHFPDVYQEYEVLHKHVQKMAEEYMQPAVTPSQPSLVIQSETVAKSVGITPELKEAAQVQASDSFKYKLLVTDPSDATRTTNERRVVEVVSPGQPPSKRQRTEETILSETYSRPEVETLQESEQIMHTSQTTDTMQNNLTPRHGGFGRVSSTSSLVHSNNVATSSQDVGQDSTELDTGVFPAESNMASVEAEPTQEEFVPSSTDQTEPTVMEEGEQIPSSTDTQPDGNTMGSPEVEEGVTLMSHPGATVTQIADGQ.......................................................................................................................................................... 976
61 4.000e-42UniRef50_G7PBN5 Uncharacterized protein (Fragment) n=3 Tax=Cercopithecinae TaxID=9528 RepID=G7PBN5_MACFA  ali  91  52.QPQTARQSQPPQGNSCLVGFHIASPQLLRVQPLVRTEPQSCFLSDLRQPPAQVFVQRPLPALQVVPAKKVPAPKTPNEQGSTLTPLSASNPLAVTSLSSSSAHPFVSNLHTKHTEKLNKSLKVKTRSGRVSRPPKYKAKDYKFIKTEDLADSHLSDSDDYSELCVEEDEDQRERHTLFDLSSCSLRPKSFKCQTCEKSYIGKGGLARHFKLNPGHGQVDPEMVLSEKAKGSTLQGCTEERTLGLPSPGLSMPAAPCEGGARSCLVTESAHGGLQNGQSIDIEETLPSEPENGALLGSERYQGPRRRACSETPAESRTAVLQQRRAAQLPGGPA................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 384
62 1.000e-41UniRef50_UPI0009E1A8F4 zinc finger protein 839 isoform X1 n=3 Tax=Pogona vitticeps TaxID=103695 RepID=UPI0009E1A8F4  ali  38  193.....QSIIQPTEKNSKKLEFNVVNPQIIRLLPLTGTESQQFFICNSSEPTVQLLLQNPLLPLGQVTVAKIPT----HGQTNATDATAAVDSLSTNRVSICSEKSLTNHEKKEKVKKP---LKVKTRSGRISQPPKYKIKDYKFIKTEDLADCHQSDSDDYSELSLEDDGDKEKAMSLFDPLMYNLRPKLFKCQSCDKSYIGKGGLARHYKLNPDHGQQEPSLSSP------------------------------TSRPHGTALLEHTRKTSVKSHASAEDKKFVQQLSSHRLYLDPGRLRRTGRLSQSKKTERSRHSGGFNRPGRSKSLNNMSAEHQSIFRRKARLKELIEQSSIEDFIELVVPRLTTLITVFEFLLKKVEKKCSAKAPFPDVYREFEELHGMVKRMCQDYFSN--PELNEPMEIKNPKVAESLGITDSCIKTQQIHTNSMSAC-INTTFEHVFTEISGRKRATENSDEMLPVAKKTTVGNLLEN.............................................................................................................................................................................................................................................................................................................. 647
63 2.000e-41UniRef50_UPI000495ACF7 zinc finger protein 839 isoform X1 n=2 Tax=Stegastes partitus TaxID=144197 RepID=UPI000495ACF7  ali  23  399................................PLKTPTSIIKTPPTAAKTVSIPLIKNSANSTTTAAGKSAIKPPTVITTVPVQTATPAARPVTVTTPTVAPPPVREREKEKKLKKREKKAVKIQTRSGRVSRPPKYKAKDYKFIKTEDLADSHQSDSDDYSDMSVEEEDGEGGKKDGPAPGSYSHKSRSHRCQTCDKAYIGPGGLNRHYKLNPTHGEPEPTPPLPSQSEETTAGAVXXXXXXXXXXXXXXXXXXXXXXXPAAIATNRVEGGPATAVGLRGLHHXXXXXXXXXXXXXXXXXXXXXXLGPPPKVTMGLVSRRGRRGRPPKLGVTTVTAXXXXXXXXXXXXXXXXXXXXXELMDIVLPRLTKVLSLWEMLLAKVERGGPVRTRFPDIYREFESLQTQMRQAAQDYISSP-LGGASPLEVRNIEVARSLGILDEVNRMKVLPGASLSSSLTNKNARYMENS------------KMLPPSKRFKME------NSIPVHHNGIETPTTGCSVTAIPSITPVTSVTPVTP----VMPVTSVTLVPSVTAVTSVTPVTPVPSVTPVNSSLKSCSVSVSPLVIPDGSKLLPISADSASSPSGSTPPTTNSAHDATPME-----VSPGEDQGEGLLPLQQDQVLSSNDIAAQVTELEKALGSSPERTADTKTPESGPVQISGSSSDQILLPSQPQQQDSSQPEFDTTEPCES---------KELQEGQEIYIQTEGLTVQLAEPGSDGIVIVNG------PDGTTMHIQTPEGVPLEAVQALL............... 1117
64 5.000e-41UniRef50_A0A2G5T6S2 Uncharacterized protein n=1 Tax=Caenorhabditis nigoni TaxID=1611254 RepID=A0A2G5T6S2_9PELO  ali  159..STTMETSPSSETTTISESSSQSTIAPTSTTMETSPSSETTTISESSSQSTIAPTSTTMETSPSSETTTISESSSQSTIAPTSTTMETSPSSETTTISESSSQSTIAPTSTTMETSPSSETTTISESSSQSTIAPTSTTMETSPSSETTTISESSSQSTIAPTSTTMETSPSSETTTISESSSQSTIAPTSTTMETSPSSETTTISESSSQSTIAPTSTTMETSPSSETTTISESSSQSTIAPTSTTMETSPSSETTTISESSSQSTIAPTSTTMETSPSSETTTISESSSQSTIAPTSTTMETSPSSETTTISESSSQSTIAPTSTTMETSPSSETTTISESSSQSTIAPTSTTMETSPSSETTTISESSSQSTIAPTSTTMETSPSSETTTISESSSQSTIAPTSTTMETSPSSETTTISESSSQSTIAPTSTTMETSPSSETTTISESSSQSTIAPTSTTMETSPSSETTTISESSSQSTIAPTSTTMETSPSSETTTISESSSQSTIAPTSTTMETSPSSETTTISESSSQSTIAPTSTTMETSPSSETTTISESSSQSTIAPTSTTMETSPSSETTTSSSQSTIAPTSTTMETSPSSETTTISESSSQSTIAPTSTTMETSPSSETTTISESSSQSTIAPTSTTMETSPSSETTTISESSSQSTIAPTSTTMETSPSSETTTISESSSQSTIAPTSTTMETSPSSETTTISESSSQSTIRRHPRPWKQARPL............................................................. 897
65 6.000e-41UniRef50_X6NYI8 Uncharacterized protein (Fragment) n=1 Tax=Reticulomyxa filosa TaxID=46433 RepID=X6NYI8_RETFI  ali  118..PTYSPTGAPTYSPTYSPTNSPTHSPTYSPTDSPTYSPTFSPTNNPTYSPTFSPTGAPTYSPTYSPTYSPTNAPTDSPTPSPTNSPTYSPTPSPTYSPTGAPTYSPTDSPTYSPTYSPTYSPTESPTYSPTNAPTESPTESPTYSPTNSPTPNPTNAPTNSPTPNPTNAPTYSPTYGPTNAPTYSPTGAPTYSPTESPTESPTNAPTYSPTYSPTESPTNSPTPNPTNAPTYSPTNAPTYSPTNAPTYSPTNAPTYSPTANPTYSPTNAPTFSPTNNPTYSPTSNPTYSPTNAPTFSPTYSPTYSPTDSPTYSPTPSPTNAPTYSPTPSPTSAPTFSPTHSPTYSPTSNPTYSPTNNPTYSPTYSPTFSPTNNPTESPTYSPTYSPTSAPTDSPTNAPTFSPTYSPTYSPTYSPTYSPTESPTYSPTPNPTNAPTYSPTPSPTNAPTDSPTYSPTFSPTNAPTYSPTFSPTYSPTDSPTYSPTYSPTESPTYSPTYSPTYSPTYSPTDSPTYSPSYSPTYSPTYSPTYSPTYSPTNNPTDSPTYSPTDSPTFSPTTSPTSRPTQSPTSKPTYHPTSSPTFSPTGSPTATICYSPPPHISVPECTV................................................................................................................................................................................................. 721
66 6.000e-41UniRef50_F6XWB3 Uncharacterized protein (Fragment) n=1 Tax=Xenopus tropicalis TaxID=8364 RepID=F6XWB3_XENTR  ali  46  2....................................................................................................................KNKKTLKVKTRSGRISRPPMHKAKDYKFIKTGTLAHSSPSDSDDYSELS-GEDEDRKMENVSIAPQSFTVKHTLFQCETCEKSYMGKGGLLRHYRLYPSHGQMQ-----SSEINVSTVRGSKHKEGYRLLPHSIYLQAAPMLQKATRRFQSVTAY-------------SLSNTPKSISLKEKKKNMQIQVHLPSGNEVEKRSYDTQKTKASHLPKGPSCRGRQRRALKKAKMKEFLQQYEKEDIKELVLPYVTQFVSVYDFLLSKVEDDHPGKSSFPFIYKEFEQLHSMVELLAQEYLANKHECAEGPLEIKNHKVAESLG.......................................................................................................................................................................................................................................................................................................................................................................... 303
67 1.000e-40UniRef50_H0YKI3 Zinc finger protein 839 (Fragment) n=3 Tax=Boreoeutheria TaxID=1437010 RepID=H0YKI3_HUMAN  ali  99  2...........................................................................................................................................................................................................................................................................................................RYQGPRRRACSETLAESRTAVLQQRRAAQLPGGPAAAGEQRASPSKARLKEFLQQCDREDLVELALPQLAQVVTVYEFLLMKVEKDHLAKPFFPAIYKEFEELHKMVKKMCQDYLSSSGLCSQETLEINNDKVAESLGITEFLRKKEIHPDNLGPKHLSRDMDGEQLEGASSEKREREAAEEGLASVKRPRREALSNDTTESLAANSRGREKPRPLHALAAGT..................................................................................................................................................................................................................................................................................... 224
68 2.000e-40UniRef50_UPI000A3366BF zinc finger protein 839 isoform X3 n=1 Tax=Heterocephalus glaber TaxID=10181 RepID=UPI000A3366BF  ali  44  125........................................QRPLPGSRPSPVGLGVQ-PVAPGGPVPAKRAKAAPAPGGLGTTPTPLPASDPPSGPPAVSGSAHSSPAGWHTERVKKLKKSLKVKTRSGRVSRPPKYKAKDYKFIKTEDLADGRPSDSDDYSELSAGDEEEQQDPQALFAATSCALQPRAFRCPTCDKAYIGQGGLARHWRLNPGH--------------SSLQPAPFPEKGHTEASTGRLASLAPPTLLAPCQDRAETAQGGPQNAQCTEGVEAMVLEQDNKSHSALGFPRGDAEGPAESGTA------IIRSGAAQPSGGQAVAAGPSTCRSRARLQESLQQCGPEDLVELVLPQLAQVVTVYEFLLAKTKEGRAGQPHFPAVYKEFEELHRRVKAMCEEHLSRAGPASPDPLEVSAPQAAQEV-----------------------------------------------PAARKPQQAPLPSGGPEHPAAHGAAWEIPEP------GVPTASEGFTPPRSEGSRRMTVSNGDLSVSHPGPQLKVCADSEARCGSAGPAVLCGDSCGPAPCAQLREPKE------------------SDPDSGATPGSPGVCSTPSPE------------------------------AAGAEPGRPGAGPMAPPFEIAAMDIRPEGCAGRTDPAGLPL-----------TTGSHAQDLQQLLRGMEVHLGQGGLEHVVAVRDAVGFEITNGSPEVLSEAQEQIFIQAADGLLLPHAGSVV-TPESAVLVTGIAGR 749
69 2.000e-40UniRef50_A0A232F8F2 Uncharacterized protein n=1 Tax=Trichomalopsis sarcophagae TaxID=543379 RepID=A0A232F8F2_9HYME  ali  20 1281..PTSISAKQESTDANKPLGSSENPIQI--VQQGTTFHSMQHLTQAQLKQIAQVLHQRSQDSSNPNEKVVYRLVFPDEADLKMKSPTSLGRPKKSAIKPPTAPAKPVPEEEPEDSKDDRKKVVARTRSGRLSRPPRHMVRDYKHLHHLDFMQPDLDDSDGYSDYNTNGEDGSGHRTELLAGLEMPKRSDHFRCPTCSKIYLGRTRMARHFEMHPDHGNIDPPPTVDPDPNKTPLQDPLKRKGKKRGPWAYVTPEAKSERRQLKLREAISVCETTE............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 1581
70 8.000e-40UniRef50_A0A1S3R867 uncharacterized protein LOC106601004 isoform X1 n=25 Tax=Protacanthopterygii TaxID=41705 RepID=A0A1S3R867_SALSA  ali  24  310.QKNLALTSQGQQVKVSTNGSVSSSPQIIHITPMVG-QQQYFLQQNPGDPPIQLLLQSSTPVVGSLVPIVHKLPIPVQTPVQQPSGKAPVNGTAVKPATAAATTSVSVPASTVEKVKRKKAPNIKTRSGRVSRPPKYKVKDYKFIKTEDLAEGHQSDSDDYSEISVEEDEDGEDSKKGAASMSYSHKRKAFQCETCDKAYIGHGGLSRHYRLNPSHGELKSPPEGTPKTDSPKKPTEESNAHSVKNTSGPEKSDATEKTAAATSTTQQKVDTTAAQGVAASTRQAVGQVVVQAXXXXXXXXXXXXXTKGLPTVAAHPAVRRGRRGRPPKLGGGVASVEQQAQRRKARLKEVTHECDNEELMETVLPRLAKVMTVWEFLLMKVEKGRQPKAQFSDVYREFEQLHSQVKKMAQDYISNPQQGVHTALEVHNVDVAKSLGIVDEVNRLKVLNPPTATKNVRYMENSKMLPPTKRFKMENRVGVQIHQNGIETSKIESSEAKVENTASTSMKDNSPQTQAPTKSPAGPQATQTAIVKPQVVSSNPETNVTPMELIQDHLSNSMTESIDSAGGEETMETGQGASGTEPTAVLSISDMGPQATQTAIVKPQVVSSNPETNVTPMELIQDHLSNSMTETV----------DSAGGEAMETCQGASGTEPTEVLSTTDIADQMKELEKALATDPVPVDQQPRSSSTQPHQPQQSGLTQAASTSSGGQVVVQETQEGQEIYIQTEGLTMHLAEGQEGDM-ASERIVIVNGPDGTTMHIRAPEGVPLEAVHALL............... 1107
71 6.000e-39UniRef50_A0A2D4JUZ0 Uncharacterized protein (Fragment) n=1 Tax=Micrurus paraensis TaxID=1970185 RepID=A0A2D4JUZ0_9SAUR  ali  60  1......................................................................................................AKTLINEGKLPKEQKIKKSLKVTTRSGRISRPPKYKVKDYKFIKTEDLADCHPSDSDDYSELSLEDDECNKVKEELLNPFNYDLRPKLFKCQNCEKSYIGKGGLSRHYKINPGHGHQETSESSP............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 126
72 2.000e-38UniRef50_L5JP71 Zinc finger protein 839 n=3 Tax=Pteropus TaxID=9401 RepID=L5JP71_PTEAL  ali  55  46IQPTAGRPSQPPGRPPSVLGLSVASPQLLRAQPVLGTGTQLCFLSNSPSPPVQVFVQRPLPALRPVSAKTVAAPQALNGQGATLALLSASDPPAITSVSSSSANLFISNLHTKHSEKLKKSLKVKTRSGRISRPPKYKAKDYKFIKTEDLADGHLSDSDDYSELSVEEDEEQREKQALFDLPSCSLRPKTFKCHTCEKSYIGKGGLARHFKLNPGHGRPEPEPETVLPEKANGSMARGCVEGRTVSLTSPGLSTPALNGQPMEEALVSEPADGSYSALPGSEGHPGPGSGRPTAPAEPSAAVLEESRVAQPHAGP----------------GAAGARSTARSRARRRLAEFLHQCDREDLVELALPQLAQAVTVHEFLLMKVEKAHLAKPFFPAVYKEFEELHKMVKKMCHDYLCSSGPWSQEPLEINDNEVAESLGITEFLRRKAAHPGRSPRARTSQEAAGEA---TGGQKRDSEAAEEGLASVKRTRGAALRQDTAESPADGRGPRKP---------XCAPRVNGDTSRRPEEGHAVPAPDSNTSTPQAGQRLTAFADSAAGSGSAHPPLSCPGVGGPGLHTQ---PGTMTQEQAVAFPTEEAQGCSSDLSAGDSLGSWALCXXXXXXXXXXXXLPAGSGRAEAGESREMPDRHLGGQPASPSKALRAEVTAPPLDRASSM-----DCAYTTVPKLGPRPGQAGSPSADEGLGSHAGDLDQFPCGTGVHTDQRALGTVPAVGEAMAFEITNACRELLSQGQEQIFIQTPNGLLLSHPGSIVSGEEGIVILTQAEG. 807
73 2.000e-38UniRef50_UPI00035098A0 LOW QUALITY PROTEIN: zinc finger protein 839 n=5 Tax=Hystricomorpha TaxID=33550 RepID=UPI00035098A0  ali  43  137...................................PQAAGQSPKPGSWPGPVGLGVQ-PVGPQGPMPAKRVKATPALSSQGSMPTPVTASDLPVAAPQGSAHPSLSPAGSRTGQTEKLRKSSRVKTRSGRISRPPKYKARDYRFIKTEDLADGRLSDSDDYLELSSGDEEEQRDPRALFTVASCALRPRAFRCQACDKAYIGQGGLARHWRLNPGHSGL--------QPKASPERGQLEAGTGGPALPELCIPAVPRQDGAEAAQGSP---------QCVEVEEAMVLEPENASP----------------------ASGIQPGDTEGLAESSAAVAPPNAYRSRAQLQELLLQSGPEDLMELVLPRLVQVVTVYEFLLVKAKDSSLAQPSFQAVYKTFEELHARVKALCQEHLSRVGTASLQPLEVRDPQVAESLGIPGFLRKTEARPDHTVAQGHSPERAGLRLEEAGGWQRLHEAAQQAPAAQRPRQAALPIGDPERPAALGGGQETPGLGVPTTGKGFAPPAIGAAPALPEGSHGVTVSGGFTSVSHAGWQLTASADSGARRGSAGPGVLCGESHG--------------------TGAPLGEPKEHVPDAKAAQGSLGAYSTLSPAGEATGAEPGDPGARPM---------------------------APLPEEISPIDIVPVDCTRRTGPDRSPL-----------SIGSHSGDLKQLLHGLEVHISLGDLECEAAVGDSVAFEISNGCPEVLCQGQEKILVQTASGVLLSHLGTTTSQ-ENTVLVTGAGG. 803
74 5.000e-38UniRef50_UPI0001C14696 cellulosome anchoring protein cohesin region n=3 Tax=Clostridium thermocellum TaxID=1515 RepID=UPI0001C14696  ali  963......................................................................................................................................................................................................................................................................................QPAPIKAASDEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSEPTPSDEPTPSDEPTPSDEPTPSETPEEPPTDTPSDEPTPSDEPTPSDEPTPSETPE--EPTPSDEPTPSDEPTPSETPEEPTPSDEPTPSDEPTPSETP.. 1481
75 6.000e-38UniRef50_A0A2D4Q619 Uncharacterized protein (Fragment) n=1 Tax=Micrurus surinamensis TaxID=129470 RepID=A0A2D4Q619_MICSU  ali  42  4.............................................................................HGQKHKSITKDREDSSNVFLVPTCSAKTLINEGKLPKEQKIKKSLKVTTRSGRISRPPKYKVKDYKFIKTEDLADCHPSDSDDYSELSLEDDECNKVKEELLNPFNYDLRPKLFKCQNCEKSYIGKGGLSRHYKINPGHGHQETSESSP------------INRFSRMTQLVCAEKANCESSHQPSSPLPVTLALVSKNGLTTELEKILKQKVNSS.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 209
76 2.000e-37UniRef50_T1FWA6 Uncharacterized protein n=1 Tax=Helobdella robusta TaxID=6412 RepID=T1FWA6_HELRO  ali  23  225...QNLTQEQLAXXXXXXXXXXXXXXXXXXIQTNSTIQGQNKVTYKIVYPNQGINNNNNNNNQGTIKVKKSSETIANVLSNRFLMSGSNSSSHLSHHPKKKAISTEAADALMRLNKEQKKKHRPRTRSGRVSKPPQYMVKDYKHIHPVDYDEDYDDSDGGYSDFKLSSGEENDERKKECKKSSYSSKSKRFKCDYCEKSYIGKGGLNRHYKLNPTHGKPDDDGPLDMGDSYYSSDSLQSGVGMANTSDSITNFPSSFEHHHQKS-----SSKDTNQNNNNDDDVTLSLEVDTNA----GDYKQHGVDGYPEGSSRKGRRGRMSNLGGGT-GLGGSNGLSSAEKKKLRLIEVAKLCTDEDILDLFIQRCSSTISLWKILMSKTTKLYDS--SIDSLISEVSNLNEQVSTYLNEKLVP............................................................................................................................................................................................................................................................................................................................................................................................... 641
77 6.000e-37UniRef50_UPI00093D0A69 zinc finger protein 839 isoform X1 n=2 Tax=Hipposideros armiger TaxID=186990 RepID=UPI00093D0A69  ali  57  128VQPTTARLSQPPGRCTSVLGLSVARPQLLRAQPLLSAKPQPHFLSRSPQTCVPVFVHRPLPALRPVPAKRVAAPQAANGQGAMLAPLSASDPPALTSVSSSSANLLISNLHTNHTEKLKKSLKVKTRSGRISRPPKYKAKDYKFIKTEDLADGHPSDSDDYSELSVEEDEEQKEKQVLFDLSSCSLRPKTFKCQTCEKSYIGKGGLARHLRLNPGHGQLDPEMLLSEKANGSMIRGCADGRTLSLTSPRLSTPALDGQPVE-------------------DEEALASEPADGGSSALLGPERRPGPRSGCPAAPAQLGAAGLEESRAADLHRGTGAAGASTARTRARLQECLHQCDREELVELALPQLAQVVTVYEFLLTKVEKGHLAKPFFPAVYKEFEELHKMVKKMCQDYLRSSGPCSQEALEINSNEVAESLGITGEFLRRK---GRSLPACPSREVGREEEEAARWQKREKEAAEEELVSAKRTRRASLPKDTMESSAKSGGPGRAAVCAPTASEGLDPRVNGDASHRPEEGHTMPASGSHTSISQAGQQLKALADLAAGGRAADPAPHYQAVSGPGPHTQLGGPGLLTQGQGAAFPVQNAQGNASDLNAGDSPRSPGLGSSLMPAGGVAAALPGRSGNAEAGKLHEMPEYQLGGWQPSPGEALLMEVAAPPLEKVLPMGVVPADCADSTGSEPGPQLGRDGALSAEQSLSSHVGDLDQLSCGPGSHTDPRGLEGIVAVGEAMAFEITNGCHELLSQGQEQIFIQTSDGLILSHPGSIVSG-EDIVTLTDAAG. 904
78 7.000e-37UniRef50_UPI000697C8FE zinc finger protein 839 isoform X1 n=2 Tax=Chinchilla lanigera TaxID=34839 RepID=UPI000697C8FE  ali  38  257.......................................................................................................................................PSLVLSPPPVQVKESPAPQLVEEEEAMQEIKGEEEEQQDPQVLFAAASCALRPRAFRCQACDKAYIGPGGLARHWKLNPGHGRLQSAALPEKGHTEAGTGGLAPWKLCTPEPSTPAAPGRDRAEAAQGGL------------QCAEDEEAMVLEPENTGHSAAGLQCGEGPAGCRAAVAPWSRTTQLSACRSRARLQEVRGSYTVALIPWSFFGVSLQQCGQEDLVELALPRLAQVLTVYEFLLEKAKDSGAAQPRFPAVYREFEELHGRVKSMCQEHLGHAGPASQEPLEVSDPQVAQSLGITGFLRRTEAHPDCAASRCHSAEGPGQRPAEASGWLGACEATQQV-PEAQRAWRAALPRGGPECPAAHGGGLQSPRCVPTAGGGFAPPASGPTPPPSEGSHGMTVSSGDASVSHAGGQLKASADLEARHGSAGPAVLGGDSRGAALCAQLGE------------------AQETVPDTRPAQGSSGVCSALSPMGEAAGAEPGNLGARPTS----------------------------PLPEMLPVDIVPVGCAHKTGADGSPL-----------TIGSHASDLNQLLQGRKAHSGLGDLQRVTAVGDAVAFEITNGCPEGLPQ--EQIFVQTASGVLLSPTETTGSQ-ENIILVTGVG.. 848
79 1.000e-36UniRef50_UPI00067D441C LOW QUALITY PROTEIN: zinc finger protein 839 n=1 Tax=Microtus ochrogaster TaxID=79684 RepID=UPI00067D441C  ali  48  50................................................................................................................................................................................................................................................................................................................................................................................ASVYTLLIFTLTKVERXPGVKPFFPAVYKEFEELHEVMKRMCQDYLSSSDLCPQEPLEINNDEVARSLGITEYLRKKETHPSSAPECSSQEMKGKLQETSALKRERE----QAGPATVKKARTAALPTDVPECPAAISGCQQKPGSSHAPSEGSASAATENPSPCSEGSCGGMAPASDGSVPPVGQQLSASADLGARSVSADPALLYQDVRS-ALYSQVAEPRGLPSAQSSVFPEENAPEHTAKQDSEAIQRSNGVYGTPSSGEEVESLLLEESGNAEAGDLREMSQPHLSRQQASPSHALPTKAAAFPLQKTLPMNVLPAACVSRTMPEPGSHPGPDGSLPTNGGPGSEAGNVSWFLSRMEA-DGQRELETVAAVGEALASELSDLCQEVLSQGQEQVSIRTSNGLILSRPSTSVSXEENAVTVTNAKG. 478
80 2.000e-36UniRef50_UPI000643445B zinc finger protein 839 n=1 Tax=Condylura cristata TaxID=143302 RepID=UPI000643445B  ali  35  121...................PPSQWPGSLSGTPPLPRAAPWAGSPGGSPQPPLGLLVLKPLPALQPVPVRRAAAPVAPEGQGPSL---SAPGPPAATSAPSGPVNTAASDGPCERPEKVRKPLNVKTRSGRVSRPPKHKAKDYRFIKTEDLADGRLSDSDDYSELSLEEDEAPRREHLPFAAASCALRPKTFSCPACEKAYIGRGGLARHLRLHPSHGQLEPTLVPLEKAAGSMARGPQEGRARSPASSQLSTPALLPEEVAQRARPGLQKGQSADAGETAVPGL---GDGSASALPGSETRRGPGRVPSAARAEPSALGREQSRPGRPKAS---------AARCPARLKEFLQQCDPEDLVALALPTLAQAVTVYEFLLMRVGETRGGQPFFPAVYREFEELHAEVRKLCREYLSGSGPARTGPLQIGNSKLAESLGILEGPPREAVHGDSPAPTRTGGQE--EEPELACAPKRGPENAGGAPAWVKRARRGALPLDRSPGSHPKPASWAPAAGEGPAPGVHGSTSPCPADAREGPSSPRSGASADPEPPGLSGQGVGGPGLDTRAGARGLRALGLAEKDVPEDSSDWNAGRSLGSPVAAGAVPPLAGGPGCRAAARPRGPQASPPGGPPPRPGAAQLLARWPVTGPLGSHEGDAAAEQRGPEGALAKGHLELRAHGEEQGLTLTPGGPTCPTQAP....................................................................................................... 789
81 2.000e-36UniRef50_UPI0004CD3931 uncharacterized protein LOC103581025 n=1 Tax=Microplitis demolitor TaxID=69319 RepID=UPI0004CD3931  ali  23  532.KPNNSVLSKINNKKSKIMGTSVTAGQSDLAKPLGSNENQQGHTFHSSQKLTQSQLKQIAHVLQQRSVYRVVFPEELDLRIRNPMNLLKTRGGKRGRPKKKPTKSIIVEDDSEEAKDERKKHVARTRSGRLSRPPKHIVRDYKHLHHLDFMEPDLDDSDGYSDYCVSTDKVDSEEAAKDLLTGYRKISDHFRCPTCSKIYLGRTRMAKHFELHPDHGS--PEQLPPLTVEPELKQSPQYPQDQFKRKGKRRGPWAYITPEAKSERRQIKLQEALAACDSKEILKIAAKPVLNAQ......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 844
82 4.000e-36UniRef50_W5MU86 Uncharacterized protein n=1 Tax=Lepisosteus oculatus TaxID=7918 RepID=W5MU86_LEPOC  ali  27  1................................................................................................................................................LKTEALIAXHQSDSDDYSEISVEEEEAEESK-GDAAPINFNLNPKAFKCDTCEKAYIGRGGLSRHYRLNPAHGQMKPPAQAAAAPQGADGAGCEVGPPPATEPPVHATPTPVPASRAADGTELLPPGPPVAPAEGVDPPAPGPGVPSCAGPGRPRGPGRPKGPGRPGRPKVSGRPARRARPGRPPKYLGGVTTEQQAQRRRARLKE---QSDTEELMEMALPRLAKVMTVWEFLLMKVEKGRPSRPHFADVYREFEQLHSQVKKMAQEHFGSPGPGPHTPLEIRDPEVSRSLGIEDLVKKARLQGAASVVQPALR---VCKENNLSAGKRLMEV-------FKYPEVIFLMFIPSMRAKAHFCQQKAQNEPSALSQGPTVELNGSAVALEVDPSSRKALETENGFPVLETRNEPANVLLYQPVEVTLHGSQTEIQKQEELTVSEQAVVFTSLENDFTPEELVEEHTVNHEVMEVEPAGGMEGDVQSEQESGTVLLAIPQNDQQGGSAK---------PSEVLNDSDIADQMHQLEKALSRDVVPLDHSYRT-HNAEPRGQHQQTLAPIPASDSLQSEAEGQPEGVESVEQNGSLEHIISVGGTVEFKLSDANQELLSQGHEQIFIQTSEGLIMHHSGGDIAS-ERILIVTDTDG. 654
83 5.000e-36UniRef50_A0A1Y1VQW4 Uncharacterized protein n=1 Tax=Anaeromyces robustus TaxID=1754192 RepID=A0A1Y1VQW4_9FUNG  ali  447..........................................PTESTESVEPTETEESEETEIPKEIDETVKPTESTESVEPTEPTEPVEPTEPTEPVEPTEPTEPVEPTEPTEPVEPTESTETLEPSPSEPSEPVEPTEPTEPVEPTESTETLEPSEPSEPVEPTELTEPVEPTESTETLEPSPLEPSEPVEPTEPTEPVEPTESTETLEPSPSEPSEPVEPTEPTEPVEPTESTETLEPSEPSEPVEPTELTEPVEPTESTETLEPTEPSEPSEPVEPTEPTEPVEPTESTETLEPSEPSEPVEPTELTEPVEPTESTETLEPSPLEPSEPVEPTEPTEPVEPTESTETLEPSPSEPSEPVEPTEPTEPVEPTESTETLEPSEPSEPVEPTEPTEPVEPTESTETLEPTEPSEPVEPTEPTEPVEPTEPTETLEPTEPSEPVEPTEPTEPVEPTESTETLEPTEPSEPIEPTEPTEPVEPTESTETLEPTEPSEPVEPTEPTEPVEPTEPTETLEPTEPSEPVEPVEPTEPTEPVEPTEPTETLEPTEPSEPVEPTEPTEPVEPTESTETLEPTEPSEPVEPTEPTEPVEPTESTETLEPTEPSEPVEPTEPTEPVEPTEPTETLEPTEPSEPVEPTEPTEPVEPTESTETLEPTEPSEPIEPTEPTEPVEPTEPTEPTEPVEPTEPTEPVEPTEPTEPTEPVEPTEPTEPTEPVEPTEPTEPVEPTEPVEPTESTETVEPIT...................................................... 1149
84 6.000e-36UniRef50_L9L7J4 Uncharacterized protein (Fragment) n=1 Tax=Tupaia chinensis TaxID=246437 RepID=L9L7J4_TUPCH  ali  33VQAPSPPPPDLGVQAPSPPPPAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPPDLGVQAPSPPPSDPGGPAPSLSSPRPRSPGPQRLLPQTQESGPAAP................................................................................................................................................................................................................. 627
85 6.000e-36UniRef50_A0A2G5SK96 Uncharacterized protein n=1 Tax=Caenorhabditis nigoni TaxID=1611254 RepID=A0A2G5SK96_9PELO  ali  1391ITSEPTTVSTITSEPTPVSTITSEPTTVLTITSEPTAVSTITSEPTPVSTITSEPTTVSTITYEPTTVSTIISEPTTVSTITSEPTTVSTITSEPTPVSTITSEPTTVSTITSEPTTVSTITSEPTPVSTITSEPTTVLT----ITSEPTAVSTITYEPTTVSTITSEPTTVLTITSEPTTVSTITSEPTPVSTITSEPTTVLTITSEPTAVSTITYEPTTVSTITSEPTTVLTITSEPTAVSTITSEPTPVSTITCEPTAVSTITSEPTTVSTITSEPTPVLTITSEPTAVSTITSEPTTVSTITSEPTTVSTITSEPTPVLTITSEPTPVSTITSEPTTVSTITSEPTTVSTITYEPTTVSTITSEPATVSTITSEPTAVSTITSEPTPVSTITCEPTAVSTITSEPTTVSTITSEPTPVSTITSEPTPVSTITSEPTTVSTTTSELTTVSTIISEPTTVSTITSEPTTVSTITSEPTPVSTITSEPTTVSTITSEPTPVSTITSEPTTVLTITSEPTAVSTITSEPTPVSTITSEPTTVSTITYEPTTVSTITSEPTTVLTITSEPTAVSTITSEPTPVSTITCEPTAVSTITSEPTPVLTITSEPTAVSTITSEPTPVSTITSEPTAVSTITSEPTAVSTITSEPTPVSTITSEPTTVSTITSEPTPVLTITSEPTAVSTITSEPTTVSTITSEPTPVSTITSEPTPVSTITCEPTAVSTITSEPTTVSTITSELTIVS........................................................ 2129
86 8.000e-35UniRef50_K7JPA8 Uncharacterized protein n=2 Tax=Nasonia vitripennis TaxID=7425 RepID=K7JPA8_NASVI  ali  21  532IKKKTVPTSIPAKQESTNKPLGSSENPIQIVQQGTTFHSMQHLTQAQLKQIAQVLHQRSQDSTNPNEKVVYRLVFPDEADLKMKSPTSLGRPKKSAIKPPTAPAKPVPEEEPEDSKDDRKKVVARTRSGRLSRPPRHMVRDYKHLHHLDFMQPDLDDSDGYSDYNTNGEDGTGHRTELLAGLEMPKRSDHFRCPTCSKIYLGRTRMARHFEMHPDHGSIDPPPTVDPDPNKTPLQDPLKRKGKKRGPWAYVTPEAKSERRQLKLREAISVCENTE............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 838
87 9.000e-35UniRef50_UPI000809B5C9 zinc finger protein 839-like n=1 Tax=Cebus capucinus imitator TaxID=1737458 RepID=UPI000809B5C9  ali  81  1........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................MLPMDSVAVDCAHRTVPKPGPQPGPHRSLLTEGHLQSLSGDLNQFSCGREVHSGQRELESMVAVCEALAFEIFNGSRELLSQGQEQIFIQTSNGLILSPPGTVVSPEEDVVIVTNAEGR 119
88 3.000e-34UniRef50_UPI000626B3DD uncharacterized protein LOC105697810 n=1 Tax=Orussus abietinus TaxID=222816 RepID=UPI000626B3DD  ali  21  574.............KQNVSKPLGSSENPIQIVQQGRTFHSMQHLSQSQLKQIAQVLQRRGTSVSNEKIVYRVVFPEELDLRFRNPETLLKSKGSKRGRPKKNAVRPLIPSKPQDEPKDERKKVIARTRSGRLSRPPRHMLRDYKHLHHLDFLQPDLDDSDGYSDYNTNDDEESPKGLLSGLEVPKRKISDHFRCPTCNKIYLGRTRMARHFELHPDHGSLEPAPTAEPEVKQTFAQDPLKRKGKKRGPWAYVTPEAKSERRQTKLKEAISVCENVE............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 851
89 4.000e-34UniRef50_UPI000CD62854 zinc finger protein 839 n=1 Tax=Paramormyrops kingsleyae TaxID=1676925 RepID=UPI000CD62854  ali  26  327FQQTHMSVNQLNRKVNVSSGVNVTCPQIIHISPVVGE--QQYILHNAGDAPIQLLLQRPEPITGSVLPISQKIPLQTPIKAVVADPLHSKMTMDPTLAK---------KERQREKNNQKRPQKIKTRSGRVSRPPKYKVKDYKFIKREDLADGHQSDSDDYSEISVEEEEDEEGK-VSVAINNFNLNPKAFKCETCEKAYIGNGGLSRHYRLNPTHRTALCSQEPVSAPRQQNTVSKVSSGDAPSMIPSLKNTNSETALVPATAGQMVDTAFPSTAQVSSPEKALAPQNEQKSESINPERALTCTEQKLSSGPGRPKGPGRPGRPGRPPKHFGGSSMEQKTQRNKTRLKEVLQQCNNEELVEMVLPRLAKVMTVWEFLLMKVEKGCPSKPHFSDVYREFEQLHRQVKKMAQDHFIHNDPGPLADVELTDPQ-----------------------------------------------EFKTLPPAKRFKLEKATIESNGVCLNENMIPDVAELSGAPEKDTDLAMNGFLTPALEAKASVIHNHLEIKKANTGERLTVTESKESQLQVMDPQQ-AQMIETQMETETPKPEVVFTTFETDFTEEVLVEEHLPSTTETENPSSKIDNSSVNTSP-----------PQLISVVTEKGQSGLDMDTSEVLNESDVAAHMSHLQQTLSTDVIPLDHSYRSNDQEPQQP-------------------TETVNGLEQDCS---LGSSISLGGTVEFQLAEASQKH---DHEQILIHTENGLIMQHSEGSLAS-DRIVIVTDSSG. 1042
90 6.000e-34UniRef50_A0A1U8BVF4 zinc finger protein 839 n=25 Tax=Euarchontoglires TaxID=314146 RepID=A0A1U8BVF4_MESAU  ali  48  51IQPKTARQSEPP-RSSSSLGLCVSGPQLLRVQALGRAGSQLCFLRRSPQPPAPGLGQKPLPALQPVPSRRVKAPQAANGLGVTLNPLAASGPPAVGPVSSSSACLFIPAWHTVHTEKLKTSLKVKTRSGRISRPPKYKARDYKFIKTEDLADGHLSDSDDYSELSVDEEEEGTERRGLFHTEGCALRPKAFKCQTCEKSYIGKGGLARHFKLNPGHGHLEPEVLLSEKANGSLTLGCAASETRGLASPALSTPAALCTGAAEPAWRTSQNGQPAEVEETVVPEPESRSPPALLRPEKYLDPKNGSWASQAEFSTASLPQSRAV-----LPNSHPAAPSRLSVSRGAQLQEALQQCGREELVELVLPQLAQVVTLCELLVVKVERSRGAKPFFPAVYKEFEELYGVVKRLCQDYLRSSGLHSQEPLEINNDEVARSLGITEFLRRKETHPSSAPECSCQEMEEKLQEASGHKRERAWAVVVTGEGLASVKKARTADVPECPAAISGCQQKPGSSSAPATSKGSARAVIENPSPCYEGSCGEMVTASGRRVSSAGPQLLASADFEARSGSTDPDLLCQDVSRSALYSQVAEPRGLSPAQMPGFSEENVPEHSVEQNSGAVQRSTGVCGTPSSGGGVESLLLGEWGNAEAGDIREMSQPHLRGQQASPRHALPEEAAAFPLHSILPVTVPPAAGASKTVREPGQHPVPDGASSAKGHPGSEAGDVSQLLPRMEA-DGQREPETVAAVGEALASEISDMCQEVLSQGQEQILIRTPSGLILSNPRAIVSQEENTVIVTNTGG. 846
91 7.000e-34UniRef50_A0A1S8SG81 Uncharacterized protein n=2 Tax=cellular organisms TaxID=131567 RepID=A0A1S8SG81_CLOBE  ali  2.................SPVGPVIPVSPVGPVTPVSPVGPVTPVSPVGPVTPVSPVVPVAPISPVGPVTPVSPVGPVIPVSPVGPVTPASPVGPVAPVFPVGPVIPVSPVGPVIPVSPVGPVTPVSPVGPVTPVSPVGPVTPVSPVGPVIPVSPVGPVIPVSPVGPVTPLSPVGPVAPMSPVGPVTPVSPVGPVTPVSPVGPVTPVSPVGPVTPVSPVGPVIPVSPVGPVTPVSPVGPVTPVSPVGPVIPVSPVGPVTPVSPVGPVTPVSPVGPVTPVSPVGPVTPVSPVGPVTPVSPVAPVTPVSPVAPVTPVSPVGPVTPVSPVGPVAPVSPVGPVIPVSPVAPVTPVSPVGPVIPVSPVGPVTPVSPVGPVAPVSPVGPVTPVSPVGPVTPVSPVGPVTPVSPVGPVTPVSPVGPVTPVSPVGPVTPVSPVGPVIPVSPVGPVAPVFPVGPVTPVSPVGPVIPVSPVGPVIPVSPVGPVSPVSPVGPVIPVSPVGPVSPVSPVGPVTPVSPVGPVIPVSPVGPVIPVSPVGPVTPVSPVGPVAPVSPVGPVTPVSPVGPVIPVSPVGPVTPVSPVGPVTPVSPVGPVTPVSPVGPVTPVSPVGPVTPVSPVGPVTPVSPVGPVTPVSPVGPVTPVSPVGPVIPVSPVGPVTPMSPVGPVTPVSPVGPVVPVSPVGPVTPVSPVGPVAPVSPVGPVAPMSPVGPVIPVSPVGPVTPVSPVGPVTPVSPVGPVTPVSPVGPVTPVSPVGPVTPVSPVGPVAPMSPMSPASPVG-----PVTPVSPVGPVTPVS..... 773
92 8.000e-34UniRef50_W5MU96 Uncharacterized protein n=1 Tax=Lepisosteus oculatus TaxID=7918 RepID=W5MU96_LEPOC  ali  37  2.........................................................................................................................................................HQSDSDDYSEISVEEEEAEESK-GDAAPINFNLNPKAFKCDTCEKAYIGRGGLSRHYRLNPAHGQMKPPAQAAAAPQGADGAGCELNKRAAKRT------TDICLIFFFYWQILLYAWSCLDADTPLSVQPAPPGVPSCAGPGRPRGPGRPKGPGRPGRPKVSGRPARRARPGRPPKYLGGVTTEQQAQRRRARLKEILQQSDTEELMEMALPRLAKVMTVWEFLLMKVEKGRPSRPHFADVYREFEQLHSQVKKMAQEHFGSPGPGPHTPLEIRDPEVSRSLGIED....................................................................................................................................................................................................................................................................................................................................................................... 283
93 4.000e-33UniRef50_UPI00053F6C52 zinc finger protein 839 n=1 Tax=Fukomys damarensis TaxID=885580 RepID=UPI00053F6C52  ali  43  3.......PPQQLEAICVRVTSGDKKGQERPVRPSATTQPQQCLLPGSWPNPRGLGVQSEAPW-GPMLAKRVKTAPALSGQGAMLTPLPASAL-----AAPGSVHLSPAGWHTECAKKLKKSLKVKTRSGRVSRPPKYKAKDYKFIKTKDLVDGRPSDSDDYAELSAGDEEEQQDPWALFAAASCALRPRAFQCPACDKAYIGQGGLARHWRLNPGHGQLQPT---------------------PSPEKGHLASLEPPTLPAPGQDRAEAAQGGPQDTQYIEGEEAMVLEPENGSHSA-----LAFPRGDTEGPAEPGTTGVLQNGAARPCGGRAVATGPTTCRSRAQLWESLQQCGPEDLVELVLPRLAQVVTVYEFLLAKTKEGGAGQPRFPAVYKEFEELHSRVKTMCQEHL-GRAPATPEPLEIIDPQVAESLGITEFLKKTEAHPHCTAAWCHSRQGVHESAQEVPVARRS--------------------WGSFEAPAAHGGGWEMPGLCVPTA------GEGCAPPHCEGSCGMTVSGGDRSVSHPHPQFRASADSEARRGPSGPAVPCGDGCRPAPCAQLGEPEDSFPDPGAAPGSPGVFSTPSPVGEAEGARHRAPP.............................................................................................................................................................................. 564
94 6.000e-33UniRef50_A0A0P5RM60 Uncharacterized protein n=9 Tax=Daphnia magna TaxID=35525 RepID=A0A0P5RM60_9CRUS  ali  20  418...............................................................................................................SKEEREGKKKLLPRTRSGRVSKPPRHMVKDYKRLHHLDFAQPDLDDSDGYSDYRIDHEDSNAESSEDSKGPIKSVIPTSFHCTICKREYTTPHRLSRHFEQFPDH----------------------SSSVVTRRNSTVPVPAIEKKNGQHDKEDMEAEEESDSTETEKVVKRAVRTTTTASTIRGSX-----XXXXXXXXXXXXXXXXXXXXXXPPLVHSPALLSE----KRKIRLAEALELCTDEEVVDVAGPRLSAAMSSWEYLLLRVQQGNSSAPLIPRILNEVTSLFDRVSTMTTRHLHPADEEEHEPYQLTNPETARLLGLQCGTYFISKDERKLLEEDAVDSAQLCQATSSSSIPPAISVTTETSSPEPQLPVPVVVHETDDVSQQQDDAQMKADSAAAAASKLWEEL-------EEADHLPPTAGSESGIGGGPDGDHVDDDVVDSELMQVDEIVNQVVEGQTGGSQAPSP................................................................................................................................................................................................................. 880
95 7.000e-33UniRef50_A0A1S3FAG6 zinc finger protein 839 n=1 Tax=Dipodomys ordii TaxID=10020 RepID=A0A1S3FAG6_DIPOR  ali  46  1...........................................................................................................................................................................................................................................................................................................................................................................................MKVEKSHLEKPFFPAIYKEFEELHNLVKKTCQDYLSSAGPCPREPLEISNDKVAESLGITEELQQKEIHPDCTARKHVSAEMHVDKLEGAGRQKRESEAAGEGLATGKRPRRLVGPSDSPEPLVVDSRDPEESRPLCVTAEGFPPPVGGRAPLLWAGSLGTMVSDGDGGPLLGGQKLAALADLEWTSGCVGPALRCRCVTEPAHCTQVEDPGGSPSAPEAVLSEEKALAHAADLHTADGQRRPAGHGTIAARAGGEP-----PLGTEAENLGQLSGSHLDGQQACPSHVLLVDATGPLLENVSPMDMAPEDAASSTGPELEPWPGPDRLLSAPGSTGSHARGASQLSC-VGARVGPGELESKVAVGDAQAFTVTSRSQE----GQENILTQTPDGGVLSHLGTLMSQ-EDVVIVTDTEG. 413
96 1.000e-32UniRef50_A8WRF6 Protein CBG01854 (Fragment) n=1 Tax=Caenorhabditis briggsae TaxID=6238 RepID=A8WRF6_CAEBR  ali  2......................................................ATSTAETTTVPTSSAETSTIATSTAETTTVPTSSAETSTIATSTAETSTVPTSSAETSTIATSTAETTTVPTSSAETSTIATSTAETSTVPTSSAETSTIATSTAETSTVPTSSAETTTAETSTIATSTAETSTVPTSSAETSTIATSTAETTTVPTSSAETSTIATSTAETTTVPTSSAETSTIATSTAETTTVPTSSAETSTIATSTAETSTVPTSSAETSTIATSTAETSTVPTSSAETSTIATSTAETTTVPTSSAETSTIA---TSTAETSTVPTSSAETSTIATSTAETTTVPTSSAETSTIATSTAETTTVPTSSAETSTIATSTAETSTVPTSSAETSTIATSTAETTTVPTSSAETSTIATSTAETTTVPTSSAETSTIATSTAETTTVPTSSAETSTIATSTAETSTVPTSSAETSTIATSTAETTTVPTSSAETSTIATSTAETTTVPTSSAETSTIATSTAETTTVPTSSAETSTIATSTAETSTVPTSSAETTTAETSTIATSTAETSSVPTSSAETSTIATSTAETT-TVPTSSAETSTIATSTAETSTVPTSSAETGXXXXXXXXXPETSTIATSTAETTTVPTSSAETSTIATSTAETTTVPTSSVETSTIATSTAETSTVPTSSAETSTISTSTAETTTVPTSSAETTTAETSTIATSTAETSTVPTSSAETSTIATSTAETSTVPTSSAETSTIATSTAETTTVPTSSAETTTAETSTIATSTAE.. 740
97 2.000e-32UniRef50_H0YMU1 Zinc finger protein 839 (Fragment) n=3 Tax=Hominidae TaxID=9604 RepID=H0YMU1_HUMAN  ali  100  2.............................................................................................................................................................................................................................................................................................................................................................................................VEKDHLAKPFFPAIYKEFEELHKMVKKMCQDYLSSSGLCSQETLEINNDKVAESLGITEFLRKKEIHPDNLGPKHLSRDMDGEQLEGASSEKREREAAEEGLASVKRPRREALSNDTTESLAANSRGREKPRPLHALAA....................................................................................................................................................................................................................................................................................... 140
98 3.000e-32UniRef50_W5KWL4 Uncharacterized protein n=1 Tax=Astyanax mexicanus TaxID=7994 RepID=W5KWL4_ASTMX  ali  37  1.................................................PPIQLLLQKPAPVVSSISLPIVRKIQAPSVASTAVTPAVASTPTKITTVVTKVVAPTVEKEKPKVKNRQKKPLKIKTRSGRVSRPPKHKVKDYKFIKNEDLAESHQSDSDDYSEISVEDEEGEDGKKKGADD-GLSLRKKAFKCEMCEKSYIGLAGLNRHYRIKPSHDKNQTRSSTERDSKPSEEQSGKGATKTSLVKTAST-------------------------------QKVQADSTRPIEKRRPGRPKGSGNKGTSLPKRLGRKPKRGRRGRPPKHLTAAATKEQLEQKRRNRLTEFIQQYDDEDLIEIVLPRLAKVMTVWEFVVMKVEKGQQSKQQFPSVYHEFELLHNEVKRMAEEHF-SIAPASRPALDVTNMEVLKSLGISD....................................................................................................................................................................................................................................................................................................................................................................... 358
99 3.000e-32UniRef50_A0A088ASE5 Uncharacterized protein n=13 Tax=Apoidea TaxID=34735 RepID=A0A088ASE5_APIME  ali  20  591...KSTTIVNESTDASKPLGSSENPIQI--VQQGQTFHSMQRLTPMQLKQIAHVLQQRSQETTTSNEVYRVVFPEELDLQIRNPGNLLKNRGGKRGRPKKSTIRPSLLPEEQEELKDERKKVVARTRSGRLSRPPRHMVRDYKHLHHLDFLQPDLDDSDGYSDYNTNEEEESPKELLTGLEVPKRKISDHFRCPTCNKIYLGRTRMARHFEMHPDHGEQLPPPTPEPELKQNGGQDPLKRKGKKRGPWAYVTPEAKSERRQIKLQEAISVCENLE............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 877
100 3.000e-32UniRef50_UPI00074FFAB2 zinc finger protein 839 n=1 Tax=Gekko japonicus TaxID=146911 RepID=UPI00074FFAB2  ali  31  1........................................................................................................................................................................................................................................................................................................................................................................MELVVPHLTAFVTVFEFLLMKVKKDDPAKALFPDIYREFEELHAMVMKMCQEYFSN--PEIKEPLEIKNPKVAESLGMNCDLFGVQNIQVGSSSEHVKIVGEH-VFTEASGQKRAAERSDETLPLAKRSREQSLQENMNDYTSHHGR-----KEISATNEEESSAANGC-----------------CRSRLAQEQHESL-QLQAAMDCENPDLPCQPMHVGLENLQLSRTLGLCDEMQPSVNAEDLQEKPMDWNTASRLRGSEFYNSLASEESSRN................................................................................................................................................................... 263
101 4.000e-32UniRef50_A0A087QPC5 Protein IWS1 (Fragment) n=1 Tax=Aptenodytes forsteri TaxID=9233 RepID=A0A087QPC5_APTFO  ali  10  14.QPQAPPPRLGPASSQPQAPPPRLGPASSQPQAPPPRLGPASSQPQAPPPRLGPASSQPQAPPPRLGPASSQPQAPPPRLGPASSQPQAPPPRLGPASSQPQAPPPRLGPASSQPQAPPPRLGPASSQPQAPPPRLGPASSQPQAPPPRLGPASSQPQAPPPRLGPASSQPQAPPPRLGPASSQPQAPPPRLGPASSQPQAPPPRLGPASSQPQAPPPRLGPASSQPQAPPPRLGPASSQPQAPPPRLGPASSQPQAPPPRLGPASSQPQAPPPRLGPASSQPQAPPPRLGPASSQPQAPPPRLGPASSQPQAPPPRLGPASSQPQAPPPRLGPASSQPQAPPPRLGPASSQPQAPPPRLGPASSQPQAPPPRLGPASSQPQAPPPRLGPASSQPQAPPPRLGPASSQPQAPPPRLGPASSQPQAPPPRLGPASSQPQAPPPRLGPASSQPQAPPPRLGPASSQPQAPPPRLGPASSQPQ............................................................................................................................................................................................................................................................................................................................... 492
102 5.000e-32UniRef50_F1PGX5 Zinc finger protein 839 n=18 Tax=Boreoeutheria TaxID=1437010 RepID=F1PGX5_CANLF  ali  52  113...........QERPTPPLATIQPKPASLSQLPVRHSRVLGLRVQPVLNTGPQPRFPGNLPPVQVFIQRPLPTLQPVAPNGQGAALAPFSASDPPAATSVSSSSANSFISHTKHTEKLKKSLKVKTRSGRISRPPKYKAKDYKFIKTEDLADGHLSDSDDYSELSVEEDEEQRGKQALFDLSSCSLRPKTFKCPTCEKSYIGKGGLARHLKLNPGHGQLESEVSPSEKANGS-----------RSASRTSPQLPTPALLSEEAAPSAGAGLQNSQSIEVEEALVSEPENGSYSALLGPEGHPGPRRSDCSTAPAEANTAVLGRSSEAHLPEDARAAGVQSTSRARARLKEFLRGCDRDALVELALPPLAQVVTVYEFLLMKVETSHLAKPLFPAVYKEFEELHKMVKKMCQDYLSGSGLCSQEPLEISNNKVAESLGILELLRTRAACRSGGPGR-----AEPEDASQQKRANEVGATAEEGLAWAKRTRREAAPRDTLEPSVDGGGLQKPASCAPAASCAS--QGRGSASQHSEESHAMLVSDSDGSMLHTGRQLKAFADLEAKSGSVAPALSCQSISGPSLYSQLGEPGTRTRGQVAAFPEDNAQEQSVAWHAGDSLGSRRLCSPLLPPGAVESLLPSGSGSLE------VHDSHQKGQRSSSSDVLLTEVVGPRLEKVLSVNVVPADCAPRTVRELGPQPGQAALLSTGGDQGSRVGDLDHFPCGAEVHADQQELESVVAVGEAMAFEITDGCHELLSQGQEQMFLQTSDGLILSHPGSIVSGEEDMVLVAGAEG. 875
103 6.000e-32UniRef50_UPI000C6F6061 uncharacterized protein LOC106637311 isoform X1 n=2 Tax=Copidosoma floridanum TaxID=29053 RepID=UPI000C6F6061  ali  20  570ITQKLVTVKQDPI-DAVNDSLGSSDNPVQIVQQGDTYHSVNRLTQAQLKVIAEALQQRNQNSANSKILYRLSFNDELDLRMLQKADVNSSKNSKRGRPKKGSAKVPVKSEEQSESKDDRNKIVARTRSGRLSRPPRHMVRDYKHLNHVDLTQPDLDDSGGYSDYTSQEDEGPNQRTELLAGVEMPKRPDISKCPTCNKVYLGRSRIAKHFEMNPDHGSLD-----------------------------------SVEAELKQVLFEMSSWRSSDRLLFIHV--TFQQTTPHDSLKRKGKKRGPW---------------------------AYTTPEAKSERRQLKLREAMSACESSEIAKVAAKPVVSSLSLFDLLILKSENN------VRTFLSEIKQLVERVREKTSTMLTAVGNENDDQVVDLNEELCDVLELNSGFYRVNEP............................................................................................................................................................................................................................................................................................................................................................... 966
104 1.000e-31UniRef50_UPI000D2F201A proline-rich extensin-like protein EPR1 isoform X2 n=4 Tax=Medicago truncatula TaxID=3880 RepID=UPI000D2F201A  ali  127.....................................................................................................................................................................................................KISPPYVPIIPPKTPSPIHSPPNVPYTPPKVPSPGNQPPYVPITPPKTPSPIINPPNVPYTPPKTPSPENQPPYVPIIPPKTPSPIYSPPNTPYTPPKSTPPSPNQPPYVPTPPKTPSPIYNPPNVPYTPPKTPSPRNQPPYVPITPPKTPSPIHTPPNVPYTPSPTNQPPXVPITPPKTPSPIHTPPNVPYTPSPTNQPPYVPITPPKTPSPIHAPPNVPYTPSPTNQPPYVPITPPKTPSPIHTPPNVPYTPSPSNKPPYVPITPPKAPSPSNHAPNVPITPPKTPSPTYNPIPPSNVPYTPPKAPSPNNEPPYTPIPPKTPSPVSQPPYVPITPPKSPSPIHTPPNVPYTPPTTPSPSNHPPHVPIIPPTTPSPFSQPPYVPTPPKTPSPISQAPYIQTPPKAPSPSNNPRNVPTPPKTPSPISQAPYIQTPPNTPSPTSQPPYIQTPPNTPSSPTSQPPYISTPPKSTPPSSQTPISTPPKSTPSPSSNTPYIQTPSGAPSPISQPPYIQTPPNAHSPTSQPPYIQAPSTSSPSSSLPPGVAQTPSGNGIAPSPYQFNNPTSPSSSPSASSPVSTTTSPPASTPASSPVSTTTSPP.. 727
105 1.000e-31UniRef50_UPI000C203814 sporozoite surface protein 2-like n=1 Tax=Onthophagus taurus TaxID=166361 RepID=UPI000C203814  ali  80................................................................................................................................................................................................................................................................................................................................................................................ADSTGSREPTDPTEPTDPTEPTDPTEPTDPTEPTDPTEPTDPTDPTEPTNPTEPTDPTEPTDPTEPTDPTEPTDPTEPTDPTEPTDPTDPTEPTNPTEPTDPTEPTDPTEPTDPTEPTDPTEPTDPTEPTDPTDPTEPTNPTEPTDPTEPTDPTEPTDPTEPTDPTEPTDPTEPTDPTDPTEPTNPTEPTDPTEPTDPTEPTDPTEPTDPTEPTDPTEPTDPTDPTEPTNPTEPTDPTEPTDPTEPTDPTEPTDPTEPTDPTEPTDPTDPTEPTNPTEPTDPTEPTDPTEPTDPTEPTDPTEPTDPTEPTDPTDPTE-PTNPTEPTDPTEPTDPTEPTDPTEPTDPTEPTDPTEPTDPTDPTEPTNPTEPTDPTEPTDPTEPTDPTEPTDPTEPTDPTEPTDPTDPTEPTNPTEPTDPTEPTDPTEPTD.. 507
106 1.000e-31UniRef50_UPI000C9F4201 zinc finger protein 839 isoform X1 n=4 Tax=Octodon degus TaxID=10160 RepID=UPI000C9F4201  ali  42  112...................................PQPAGQSLLPRSQLSLVGLGVQ-PVAPQGPVPTKRVKAVPALGSQDPMPMPSAASGLPTETPAMPGSAHLFPSGSRAGPAEKFKKTPKVKTRSGRISRPPKHKAKDYKFIRTEDLAAGRPSDSDDYSDLSAGDEEEQQAPRALFAEASCALQPRAFRCQACDKAYIGQGGLARHWRLNPGHGWQQPEEGYT-----------EASPRDLAPPERGTPAPSRPEPRTLAVLRQRRAEAAQGSPQCVEDEEAMMLEPESSAAVDL--------------------RSGAAQPRACSQARLREVPAQPRACSQARLRESLQQCAPEDLVELVLPRLAQVATVYEFLLAKAKDGGTAQPCFPAVYREFEELHCRVSSMYQELLGRASPASGQPLDVRNPQVAESLGITGFLRKAEAHSDCTAAQHHSMERAGQRSEEARSWQGACEAAEQA-PTAWRPRQAVLPMTCPECPAAHSRDQEIPGSTPTAHLGFTPPASGTTPPPSEGSQGLAVSGGDTGVSHAGCQLKESADSEARCHASG..................................................................................................................................................................................................................................... 614
107 1.000e-31UniRef50_UPI00076FDC21 uncharacterized protein LOC107217774 n=5 Tax=Hymenoptera TaxID=7399 RepID=UPI00076FDC21  ali  20  572............EKTDTTKPLGSSENPIQIVQQGHTFHSMQRLTQSQLKQIAHVLQQRSQEAAMPRIVYRVVFPEELDLRIRNPVNLRGRPKKSAVRPPVAPPKPTVVPEEEPEEKDERKKVIARTRSGRLSRPPRHMVRDYKHLHHLDFMQPDLDDSDGYSDYNTNEDEESPKELLTGLEVPKRKISDHFKCPTCHKIYLGRTRMARHFEMHPDHGEQLPPPTPEPELKQAPVQDPLKRKGKKRGPWAYVTPEAKSERRQIKLKEAITVCE............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 847
108 2.000e-31UniRef50_H3GHZ6 Uncharacterized protein n=1 Tax=Phytophthora ramorum TaxID=164328 RepID=H3GHZ6_PHYRM  ali  230VTPAPTTPCPSEEVPSPTPTWVEITPAPTTPGPYE-EAPSPTPTYGVTPAPTTPCPSEEVPSPTPTWVEITPAPTTPGPYEEAPSPTPTYGVTPAPTTPCPSEEVPSPTPTWVEITPAPTTPGPYEEAPSPTPTYGMTPAPTTPCPSEEVPSPTPTWVEITPAPTTPGPYEEAPSPTPTYGMTPSPTTPCPSEEVPSPTPTWVEITPAPTTPGPYEEAPSPTPTYGVTPAPTTPCPSEEVPSPTPTWVEITPAPTTPGPYEEAPSPTPTYGVTPAPTTPCPSEEVPSPTPTWVEITPAPTTPGPYEEAPSPTPTGVTPAPTTPCPLEEVPSPTPTWVEITPAPTTPGPYEEAPSPTPTYGVTPAPTTPCPSEEVPSPTPTWVEITPAPTTPGPYEEAPSPTPTYGMTPSPTTPYPSTLVPPETTQPPTVAPYPSTPIPPETTQPPTVAPYPSTPVPPETTQPPTVAPYSTTQPPTVAPYSTTQPPKSTPSVTPATPEQQQQDQTQNGEKQQVQDQNQQQQQTDSSTSQQITTKT......................................................................................................................................................................................................................................................................... 763
109 2.000e-31UniRef50_A0A067RL71 Uncharacterized protein n=3 Tax=Termitoidae TaxID=1912919 RepID=A0A067RL71_ZOONE  ali  20  630......................................PEDLDLRDPRTLDKGTGLNTSLAXXXXXXXXXXXXPPKTNMRGSLGRGMDGSSGRRVG-VNASSADMDFDEDRDDTAKGERKKQLARTRSGRLSRPPRHMVKDYKRLHHLDFADDMDDSDGGYSDYQMSEHEAEDPPEKTDSAVPKRKISSHFRCPTCQKIYLGYNRMSRHFEMYPDHGSIEQLHMQNQTSSSNNNNNNDKSQTPTTN---------------------------------------------------SEPNEATKVGVGVRSTGLNGIVRTGTGRRRGKRRGPWAYTTPEAQRRKGKLREVLAACEASELAEVAGPAVAGVLSLWDLMLLRVEAVRAEESYVVTMCDELQALLEKVRTVVSDILKPLDVKVKSKLELQDELLCTTLGVASGTY----LVDDRKLQHFIGVTEPPDGQIVKRMRMNTQDDVKVEKEDIKPRSVNENHVMMDECSANSG.................................................................................................................................................................................................................................................................................................... 1058
110 3.000e-31UniRef50_A0A2T7NY15 Uncharacterized protein n=2 Tax=Pomacea canaliculata TaxID=400727 RepID=A0A2T7NY15_POMCA  ali  20  201....NQANSAPLGSSQNPIRIIQQGNQYTPVQQLTTEQLQQIMQVVRQQQLARNTQESGATATNTRIVYRVIYPSELHKGQQSVQQVTSRGTSAGTSAVQIQQTVQMPKRQSKEEKEERKKHRPRTRSGRVSKPPKHMVKDYKHIHVLDWDEDYDDSDGGYSDYKNSDEEGKERTKERRDMSGDSSRPKNYRCQQCDKSYIGRAGLGRHYRLNPSHGSLPEETPEEKEKANGLAATENSSVFSTVSINNTSTPAGTIVVTGASSVGSSIGNLSEDSNT-------------QDSIPSSTGATSPVTTRTRRPYRGRGGYRGRWAYYHQT----------APLRRKQKLKELIKTCEDEDLMEVVLPRLVKVITPWEFMLMKIESDGSAQPRVDQIYREFYALHKHVRRVCQECLHPSSDSTVHMLKLEDAAVAQSLGFETGMYEVREMPEQSPFRYKYLTSDPNGPAGTPAENRTIQVTPEELVSQQPSRRQKVTSLLNPSGTTGLVPATVTASSLLTSIASNQALTGNVVKQEQSKTGIMHSV-------AIQHHGTPAKQSQRQQQQRLILPGSSVSILNTASRTVSPRSVTTVVPANQQVIMVKSASLHSPQILAVSSPGVSSNPPS---STEIPLSQAANLVTVVPSTLTSNSLSLLQQTSCDVTSDISSMAPVDFMDTSGDSPVSSVSSSANSSGVIAVVSGSSLPNGLADSEVLNMS............................................................................ 939
111 4.000e-31UniRef50_A0A2I4D8E4 zinc finger protein 839 n=2 Tax=Atherinomorphae TaxID=1489913 RepID=A0A2I4D8E4_9TELE  ali  21  222.QQKNVAVSHPQVKLSAAGPLS--NAQIFHIQPVVNQGQQILLQQNPEDPPIXLLLQSPAPVVGSLLPLVHKLTGQPALTGPAPKPAAFSVRASTISAAKASTNKXPSSKTRAKKKKEKKGVKVQTRSGRVSRPPKYKAKDYKFIKTEDLAESHQSDSDDYSDMSEEEEQGERDEPGSSSSLSYSHKSRCHQCQTCDKSYIGPGGLNRHYKLNPSHGEPSLSVSTPTPPPDEDRLDETDTAREDEEDKRPAAAANTVRHMSTVSLQAECVPAASGLRGFRHXXXXXXXXXXXXXXXXXXXFLGTVAAGFVGRPV--------HRGRYPRSGVTPLTADQQVKRRRDRLLELVEQCEVEELTDVVLPHLTEVLSLWELLLAKVDCGSPTCTSFPEIYREFESLQAHVRQAAQEYISSPQ-SGDTPVEVRNIEVARSLGILDEVNRMKVVPGASPASSVTNKNARYLENS------------KMLPPSKRFKMENSITDDQRGSLPQTGG---AVGTPAVTHLKPSSVSVSPLVISEGSKLQTTSADPTSSLSA-QADSSQAPPPDAPMEVQEEGAMNLEQDTTVAGQVTEPHGGFGPRTKTAESSLDQTTDTPQPQQGDKSQAESQTTDTPQPQQGDKSQAESQTTDTHQPQWRDKSQAESQTTDTPQPQWRDKSQAESQTTDTPQPQWRDK-SQAESQTTDTPQPQRGAKSQAESSAESPEAKELQEGQEIYIQTEQLTXQLAEPGSNGIVIVNG------PEGTTMHIQAPEGVPLEAVQALL............... 1024
112 6.000e-31UniRef50_A0A2S2FI29 Mucin 17-like protein n=1 Tax=Acinetobacter defluvii TaxID=1871111 RepID=A0A2S2FI29_9GAMM  ali  7.......................................................................................................................................................................................PVSPVEPVSPVDPVSPVAPVSPVDPVSPVAPVSPVEPVSPVDPVSPVDPVSPVDPVSPVEPVSPVAPVSPVAPVSPVDPVSPVEPVSPVEPVSPVEPVSPVAPVSPVDPVSPVAPVSPVEPVSPVDPVSPVAPVSPVAPVSPIDPVSPVEPVSPVEPVSPVEPVSPEPVSPVDPVSPVDPVSPVDPVSPVDPVSPVEPVSPVEPVSPVEPVSPVEPVSPVEPVSPVEPSPVEPVSPVEPVSPVEPVSPVDPVSPVDPVSPVEPVSPVDPVSPVDPVSPVEPVSPVSPVGPVSTVEPVSPVEPVSPVEPVSPVEPVSPVSPVGPVSPVEPVSPVEPVSPVEPVSPVEPVSPVEPVSPVEPVSPVDPVSPVEPVSPVEPVSPVEPVSPVDPVSPVEPVSPVEPVSPVEPVSPVEPVSPVEPVSPVEPVSPVEPVSPVEPVSPVEPVSPVEPVSPVEPVSPVEPVSPVDPVSPVDPVSPVEPVSPVEPVSPVEPVSPVDPVSPVEPVSPVDPVSPVEPVSPVEPVSPVDPVSPVEPVSPVDPVSPVEPVSPVEPVSPVDPVSPVEPVSPVEPVSPVEPVSPVEPVSPVEPVSPVEPVS-PVEPVSPVDPVSPV...... 617
113 8.000e-31UniRef50_A0A1I8JJ81 Uncharacterized protein n=1 Tax=Macrostomum lignano TaxID=282301 RepID=A0A1I8JJ81_9PLAT  ali  1662..PEATGPTLSTESTQTVESSTVSGATPSSEAETASTASASTVSTAEPEATSAASVETPSVSVPEATGPTLSTESTQTVESSTVSGATPSSEAETASTASASTVSTAEPEATSAASVETPSVSVPEATGPTTESTQTVESSTVSGATPSSEAETASTASASTVSTAEPEATSAASVETPSVSVPEATGPTLSTESTQTVESSTVSGATPSSEAETASTASASTVSTAEPEATSAASVETPSVSVPEATGPTLSTESTQTVESSTVSGATPSSEAETASTASASTVSTAEPEATSAASVETPSVSVPEATGPTLSTESTQTVESSTVSGATPSSEAETASTASASTVSTAEPEATSAASVETPSVSVPEATGPTLSTESTQTVESSTVSGATPSSEAETASTASASTVSTAEPEATSAASVETPSVSVPEATGPTLSTESTQTVESSTVSGATPSSEAETASTASASTVSTAEPEATSAASVETPSVSVPEATGPTLSTESTQTVESSTVSGATPSSEAETASTASASTVSTAEPEATSAASVETPSVSVPEATGPTLSTESTQTVESSTVSGATPSSEAETASTASASTVSTAEPEATSAASVETPSVSVPEATGPTLSTESTQTVESSTVSGATPSSEAETASTASASTVSTAEPEATSAASVETPSVSVPEATGPTLSTESTQTVESSTVSGATPSSEAETASTASASTVSTAEPEATSAASVETPSVSVPEATGPTLSTESTQTVESSTRGRDWHCVCVYVSTAEPEATSAASVETPSVSVPEATGPTLSTES... 2457
114 9.000e-31UniRef50_A0A1E3C3Q5 Uncharacterized protein n=1 Tax=Clostridium sp. Bc-iso-3 TaxID=1848158 RepID=A0A1E3C3Q5_9CLOT  ali  1503............................................................................................................................................................................................................................................................................................................................................................................................................................................QPKAITAGGVIPTPTETVEPTPTPTETVEPTPTPTETVEPTPTPTETVEPTPTPTETVEPTPTPTETVEPTPTPTETVEPTPTPTETVEPTPTPTETVEPTPTPTETVEPTPTPTETVEPTPTPTETVEPTPTPTETVEPTPTPTETVEPTPTPTETVEPTPTPTETVEPTPTPTETVEPTPTPTETVEPTPTPTETVEPTPTPTETVEPTPTPTETVEPTPTPTETVEPTPTPTETVEPTPTPTETVEPTPTPTETVEPTPTPTETVEPTPTPTETVEPTPTPTETVEPTPTPTETVEPTPTPTETVEPTPTPTETVEPTPTPTETVEPTPTPTETVEPTPTPTETVEPTPTPTETVEPTPTPTETVE.. 1871
115 1.000e-30UniRef50_UPI000BBD7758 LOW QUALITY PROTEIN: proliferation marker protein Ki-67-like n=1 Tax=Astyanax mexicanus TaxID=7994 RepID=UPI000BBD7758  ali  204................................................................................................................................PPKSPLARPQVDQQEPRKVLESSDLSNENKKPVTPQSAKKKRRSSNVKAMDHSESVSLEDSISACPMDVSSVDTEATMPVKDTPAKQKRSSAASINSTSLEGSSTPVSRKKTPQATPQKFSADEVAQQILLEQSCKTPSPKTPTPAKSSSSPKAKTPSPKTPTPAKSSSSPKAKTPSPKTPTPAKSSSSPKAKTPSPKTPTPAKSSSSPKAKTPSPKTPTPAKSSSSPKAKTPSPKTPTPAKSSSSPKAKTPSPKTPTPAKSSSSPKAKTPSPKTPTPAKSSSSPKAKTPSPKTPTPAKSSSSPKAKTPSPKTPTPAKSSSSPKAKTPSPKTPTPAKSSSSPKAKTPSPKTPTPAKSSSSPKAKTPSPKTPTPAKSSSSPKAKTPSPKTPTPAKSSSSPKAKTPSPKTPTPAKSSSSPKAKTPSPKTPTPAKSSSSPKAKTPSPKTPTPAKSSSSPKAKTPSPKTPTPAKSSSSPKAKTPSPKTPTPAKSSSSPKAKTPSPKTPTPAKSSSSPKAKTPSPKTPTPAKSSSSPKAKTPSPKTPTPAKSSSSPKAKTPSPKTPTPAKSSSSPKKNPISKKATNQTQNPYTSQVVLQPKSKNTISQNPYTSQVDLQPKGKNTISQNPYASQVVLQPKGKNTISQNPYASQVVLQPKAKTPSPKTPTP....... 867
116 1.000e-30UniRef50_UPI0007B8A244 mucin-5AC-like isoform X1 n=4 Tax=Poecilia TaxID=8080 RepID=UPI0007B8A244  ali  19  1........................................................................................................................................................................................................................................................................................................................................................................MDAVLPRLTKMLSLWELLLAKLDCKGSACSCFPDIYHEFESLHAQVRQTAQDYIISPQGGAM-PVEVRNIEVARSLGILDEVNKMKVLPGASPVSSGNNKNVRYM------------GNSKMLPPSKRFKMENSIADHQNGTEVPKSAA-APVASATQAASLVKSCSVSVSPLESASAEPTSSSSTNASPDPTPSLAAPPAGPTQEQKEGPSAQDQDVHMADATVQDANTADATVQDANTADATVQDANTADATVQDANTAEATVQDIMAETTVQDLNMAEATVQDINNMAEATVHQVNGAKATIQEVNGAETAVQMTQPDSALSSSATSTTDRKRAESSPNPGPTPSPSAQPQPCDSSSQPKELQAGQEIYIQTEGLTVQLAEPGSDGIVIVNG------PDGTTMHIQTPEGVPLEAVQALL............... 427
117 2.000e-30UniRef50_A0A267H0A3 Uncharacterized protein n=1 Tax=Macrostomum lignano TaxID=282301 RepID=A0A267H0A3_9PLAT  ali  25......................................................................................................................................................TQTIQGSTTANTEPVTATVKTELSTTEGDLTASEDTTQNPSMSAEPPTDKTMNFSPSAETPTDSTMDPSPSAGPLTDSTMDPSPSAETPTDSTMDPSPSAEPLTDSTMDPSPSAETPTDSTMDPSPSAETPTDSTMDPSPSAEPSTDSTMDPSPSAEPLTDTTMDPSPSAEPSTNSTMDPSPAEPSTDSTMDPSPAGPSTDSTMDPFPSAEPLTDSTMDPSPYAEPLTDSTMDPSPAGPSTDSTMDPSPSAEPSTDSTMDPSPSAEPSTDSTMDPSPAEPITDSTMDLSPSAETSADTSTNSSIATESITISSTNSPSPSTETTLHPLTTGPPPQTDTTINTLTTGPSPPTDTTVNPLTTGPSTPTDTTVNPLTTGPSTPTDTTVNPTTGPPSPAETTVDPTTGPPPPSDTTVNPLTTGPSTPTDTTVNPTTGPPSPAETTVDPTTGPPSPAETTVDPTTGPPSPAETTVDP---TTGPPSPAETTVNPTTGPPSPAETTVDPTTGPPPPSDTTVNPLTTGPSTPTDTTVNPTTGPPSPAETTVDPTTGPPSPAETTVDPTTGPPSPAETTVDSTTGPPSPAETTVDPTTGPPSPAETTVNQTTGPPSPAETTVNPTTGPPPPSDTTVNPLTTGPSTPTDTTVNPTTG. 669
118 2.000e-30UniRef50_A0A2R5L4M4 Uncharacterized protein (Fragment) n=1 Tax=Ornithodoros turicata TaxID=34597 RepID=A0A2R5L4M4_9ACAR  ali  18  170IQPVSTSSFQPPKQTTAPLGSSENPIQIIHSTQVLSSEQLQQIAHVLQQQQVNRAIQNGGPQTNTRIIYRVIYPSEIGGKGSTPSPKTPGRGRGGYSGRSRGRPRGRGWSRRVVEDDEHRSHRPRTRSGRISKPPSYMVKDYKRIHHLDFDDEPYDDSDGYSDYQVSDEDERRERK--SHSSGHGGRPRNYKCGTCGKQYIGRASLARHLRLYPDHGNASEEMSTHDENSNSSMSGHAQNSPAANPGAQAGMTRARYSDMAAIRRKSRLRESIKVCSDEELMEIVMPRLAESVSLWKSEKGDPPRPQVPDMLLNLEELLGEIQKLGRECLRSAEVNQDGEPAET---------LPPGGQYVKIEDEAVAHALGLATGLYAVLEENAPGQPQV--------RHRKRTRSSDGE-----------------KELAEVLAVGDVQAVNEVLGDSSIVEFVTPEEMVAAL------------HGEPLPPNKRLRLDDT--DGLVVLPAGAVSIDTSKSDGGDAIMEAALNSDSLSENMLENLEFTGLQXXXXXXXXXXXXXXXXXXQTEAAPAAAEADAQQVEQLSQEQAQQQLQQTAETLRFVAVN---PGQKIQILPGQSLLNRNFVRVVTSSEGPPSPTVQQAQPEDAAAEEPASAQEPAAAEEALTVVMQENEEEPPAEQVPAEVEAGAAEAEMIVAEAPTSEPQGCTSDGVSSDGARMETMVQVVESHGDDDSEQELAQVVCAAEDAAPEGSAVVRQYLLPDGQII................................ 924
119 2.000e-30UniRef50_UPI0004628ABC zinc finger protein 839 n=1 Tax=Anolis carolinensis TaxID=28377 RepID=UPI0004628ABC  ali  22  81...............................................STPGPAVAHPKSLTTVQPVEKNSKILGLGVNPQIIQIHPTMGIESQQIFLHNSSKPTVQLLLHSPLHLLGQISVGKITTH-GQKNKPAEKAPTD--------------SSNSGLISANSLIKYKKQKEQKIKKSLKVKTRSGRVSCPPKYK--------AKDYKFIKTEDLADCHQSDSDDYSELSLEDDEGGKGTETCTLFDSLKLRPKLFKCQSCEKSYIGQGGLARHYKLNPNHGQQEPFQSFLINRPQKKTLLENIGKRSSEAPSVTATLV--------NKSGIDTELEKDFLKENERQLSQHFPNEDFMEQAVPHFTKLVTVFEFLLMKVEQKYQKKALFPDVYREFEELHAMVKRMCQDYFGN--PELRKPVEVNNEKVAESLGITDCFLLLKKTQVDCSPEY-IETTSDCVFTKTVEQKCATEPSDEMLPLAKKCRVEYLPENINIDYSNHSRKE.................................................................................................................................................................................................................................................................................................. 510
120 5.000e-30UniRef50_G1T7H8 Uncharacterized protein n=2 Tax=Oryctolagus cuniculus TaxID=9986 RepID=G1T7H8_RABIT  ali  57  7IRPQAARQDQLPGRNPCLVGPRATSPQLLRGQPLLKARPQPPAPQLLVQRPVP--------------------------------AKRAPGPPAVTSASASSAHSFISNSPTEHTEKLKKSLKVKTRSGRISRPPKYKAKDYKFIKTEDLADGHVSDSDDYSELSVEEDDDRREKQALFDLASCSLRPKTFQCQSCEKSYIGKGGLARHFKLNPGHCL----GRLPETAHGSLIQGCVAAGPVSLTSPELATPTEEGPLSC-CARGAESAHHGLQNGQSTEAEEVLVTEPESKSPAALLGSQTHLGCAGSGDPETPAEPSAAEAGAAVLPQSRA--GGQRASRGRAELQQLLQQCDPEDLVELALPQLARAVTLYEFLLMKVEKGHLAKPFFPAVYKEFEELHKMVKTLCQDYLSGSSPGPQEPLEVNNDAVAESLGITEEFMRKRDMCTDCLAAQCPGPEGRERLEEASGQKRGSEATQDLQASVKRTRTETLPEDTAESPAAEGTGQAKPRPLCDPAAGLACPANENASPRSESSQAVTGCDGGRSLVHEGRQLKAFADSEARSGCVGPAPCCSDRGGAPPCIQLGEPARLARLQQAPLPDRKALGHSSDQDTGDSPRGPAACSTLSAGGGVQPLLLGASGSRGR------RDAHLPGQQARPSPDLLTAAAAPPLEKAVPAGVGPVDCACSTVSQPGPQPGKDGSLSTRGGVESHTGNLNQFPCGTEVHGSQRELEGMVAVGEAVAFEIPSGC-------HEQILIQTPDGLILSHPGTIVSQ-QDVVIVTEAAG. 751
121 7.000e-30UniRef50_A0A1Z5JXH1 Uncharacterized protein n=1 Tax=Fistulifera solaris TaxID=1519565 RepID=A0A1Z5JXH1_FISSO  ali  131...................PPSPGKSNQPPKKTKNTNGKGXXXXXXXXXXXXXMSKKSDKKNKGKDDGKMGAKSPVRSPVRSPVRSPVRSPVRSPAGSPVRSPIRAPTISLPERVPTFIKRFIEFVPTVLEELPTFRNDPQTRAPVIEDRVPTSKPSSSPSESPSRAPIKRPSSAPSREPSPEPSARPSASPIAQPSAAPSGQPSPSPTDNPTAAPSEVPPTNVPSMNPTLAPSTAPTVQPSRQPTTGPSRKPSSEPTIEPSSSPTALPSGTPTEKPSQLPTQKPSPGPSVGPSAVPTREPSSFPTTLPSSSPTVGPTVAPSMNPTRTPSNEPSMKPSSSPTEVPSLSPSNQPTKGPSREPSGVPTAEPSSSPTSRPSAVPTSPPSTSPTDNPTEAPSRNPTNVPSSGPTMTPTSTPTKVPSGSPSLQPTTSPSREPSAAPSPGPSATPTSKPSVTPSVRPSAAPTNAPSLVPSILPTPVRSAVPSSDPTVSPSIVPSASPSRQPTIGPSMEPSVEPTVKASNTPSLSPSSLPTTKPSSSPSQEPSPGPSISPSASPTTNPSDVPTSPPSTSPTDSPTIMPSSRPTSGPTNVPSKSPTSKPSAVPTNQPSQQPTRGPSIEPSTGPTTQPSSSPTMSPTSVPTPQPSRLPSREPTVEPSAGPTVEPSASPTASPSGVPTARPSTTPTDGPTVAPSMGPTNSPSNEPSEKPSSSPTAGPTLSPSDQPTKGPSREPSTNPTTVPSATPTTKPSAVPTSRPSTNPTDSPTVTPSSGPTTTPTSAPTIVPSGTPSRQPTNSPSR 913
122 1.000e-29UniRef50_K9GWP5 Uncharacterized protein n=1 Tax=Penicillium digitatum (strain PHI26 / CECT 20796) TaxID=1170229 RepID=K9GWP5_PEND2  ali  870..PATAEEPPATTEEPPATAEEPPATTEEPPATAEEPPATTEEPPATAEEPPATTEEPPATAEEPPATTEEPPATAEEPPATTEEPPATAEEPPATTEEPPATAEEPPATTEEPPATAEEPPATTEEPPATAEEPPATTEEPPATAEEPPATTEEPPATAEEPPATTEEPPATAEEPPATTEEPPATAEEPPATTEEPPATAEEPPATTEEPPATAEEPPATTEEPPATAEEPPATTEEPPATAEEPPATTEEPPATAEEPPATTEEPPATAEEPPATTEEPPATAEEPPATTEEPPATAEEPPATTEEPPATAEEPPATTEEPPATAEEPPATTEEPPATAEEPPATTEEPPATAEEPPATTEEPPATAEEPPATTEEPPATAEEPPATTEEPPATAEEPPATTEEPPATAEEPPATTEEPPATAEEPPATTEEPPATCELQ.................................................................................................................................................................................................................................................................................................................................................................... 1310
123 1.000e-29UniRef50_A0A1S3J2U6 zinc finger protein 839 n=1 Tax=Lingula unguis TaxID=7574 RepID=A0A1S3J2U6_LINUN  ali  17  141..PSNIDPAAPLGTSDNPIRIVQQGNQYTSLQQLSAEQVAQIMQVLQNQHVAKKTQESSSPQTNTRIVYRVIQPSELHKNGSGLISTPSQLTRTISQQTPGSVTGTKRQYRKRHKGEDDDKHRPRTRSGRVSKPPKHMVQDYKHIHPVDWDEDMDDSDGGYSDFKYSEEEDGEGRQKDHKDSNYIHRRKTNKCETCDKTYIGRGGLARHYRLYPSHGRLEDDPTHSNSEKTNGLLSVSEDS----NTQDSFSKNTTGTSSAVTKPTSNVSRAMNRARNSLLQENN-----------------------------PHKRKAKLRDIVRQCENEELMEVVLPKLAKVITTWEFLFM--KAESSKSGKPVFQEMFKEFESLFKQMQKS------------------------CEEYLRPLPDGESKQLEITDTKLAESLGLNDRVYLPANSDDSNTFHYKLLTADARNLTSTATNKRTLELVSADQLVTQPSKKMKVKVDAPAVTVLPSMHPEQPEEAVTTHVEKVQPTNQQVVTHDPQSATIEVNSEEQQVVDENGELNEITGENVETHVIDPGASIIQTEDGTILIQNPDGTTVQLHADQGIPLETVQALLAMENDGQIQ.................................................................................................................................................................................... 754
124 1.000e-29UniRef50_A0A2H6NJL5 Uncharacterized protein (Fragment) n=2 Tax=Micrurus TaxID=8634 RepID=A0A2H6NJL5_MICLE  ali  34  2..............................................................................................................................................................................................................................................................................ETESEQQSDISAENRKSEEPYSIHLGPGKRKRQ--RRSYQPKMANRSRCSTAFSSLGQLSFNSLNNLTNSRFKRKAKLKELIQHCTNEEFMELVVPRLTTVVTVFEFLLMKAEKKCQTHAVFPDVYQEFEVLHSMVKKMYQDYFNNSEL--KQPLEIKNHKVAESLGITDCCVEVPKIQRNSFPEC-IESTDKPILLHISGQK...................................................................................................................................................................................................................................................................................................................................... 204
125 2.000e-29UniRef50_UPI000A1C67E4 mucin-5AC-like n=1 Tax=Boleophthalmus pectinirostris TaxID=150288 RepID=UPI000A1C67E4  ali  347..PTSSPPSDPTENPTSSPTSAPTENPTSSPPSDPTENPTSSPTSAPTENPTSSPPSDPTENPTSSPTSAPTENPTSSPPSDPTENPTSSPTSAPTENPTSSPPSDPTENPTSSPTSAPTENP---TSSPPSDPTENPTSSPTSAPTENPTSSPPSDPTENPTSSPTSAPTENPTSSPPSDPTENPTSSPTSAPTENPTSSPPSDPTENPTSSPTSAPTENPTSSPPSDPTENPTSSPTSAPTENPTSNPTSDPTVNPTSSPTSDPTVNPTSSPTSDPTENPTSSPTSDPTENPTSSPTSDPTENPTSSPTSDPTENPTSSPTSDPTENPTSSPTSDPTENPTSSPTSDPTENPTSSPTSDPTENPTSSPTSDPTENPTSDPNYPTTTSAPMGTYYK.................................................................................................................................................................................................................................................................................................................................................................................................................. 738
126 3.000e-29UniRef50_Q8H6Q5 Elicitor-like mating protein M81 n=1 Tax=Phytophthora infestans TaxID=4787 RepID=Q8H6Q5_PHYIN  ali  1066..PPETYAPETTAPATYPPETYSPETTAPSTYPPETYAPETTAPATYPPETYSPETTAPSTYPPETYAPETTAPATYPPETYSPETTAPSTYPPETYAPETTAPATYPPETYSPETTAPSTYPPETYAPETTAPATYPPETYSPETTAPSTYPPETYAPETTAPATYPPETYSPETTAPSTYPPETYAPETTAPATYP-PETYSPETTAPSTYPPETYAPETTAPATYPPETYSPETTAPSTYPPETYAPETTAPATYPPETYSPETTAPSTYPPETYAPETTAPATYPPETYSPETTAPSTYPPETYAPETTAPATYPPETYSPETTAPSTYPPETYAPETTAPATYPPETYSPETTAPSTYPPETYAPETTAPATYPPETYSPETTAPSTYPPETYAPETTAPATYPPETYSPETTAPSTYPPETYAPETTAPATYPPETPYPSLICYPAPTTETPTTYAPSDSPNYPTETPESTDAPTYAPTSTPTETSVVTYAPTYPPTPIVTYKPTSTPKSTNPGQANQSPNQ............................................................................................................................................................................................................................................................................... 1590
127 3.000e-29UniRef50_UPI000B7B5B54 zinc finger protein 839-like n=1 Tax=Papio anubis TaxID=9555 RepID=UPI000B7B5B54  ali  81  10.................................................................................................................................RVSRPTKYKAKG-KFIKRDDLADGHLSDSDDDSELSVEED--QRERQALFDLSSCSLRSQSFKCQTCKKSYVGRWGLAQHFKLNPGRGQLDPEMVLSEKANESTVRGCTVERTLGLSSPGLSMPAAP............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 133
128 5.000e-29UniRef50_A0A2P4SCN1 Uncharacterized protein n=1 Tax=Bambusicola thoracicus TaxID=9083 RepID=A0A2P4SCN1_BAMTH  ali  27  3..........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................PMSSGEELLPSAKRTKLEDVMENVNNAYSSQDEVKEKSGNLCTLFEKDGLNPLNGEILLPEDRHVTCCT--TGSMLPAQEEHNLLVDSEVRINDENSGTFSQTLEMRIQYSQPVDRQAPVLPVEAGGSPELTEAHLVSQNTAGGLSAPEPCNSV-SEHAVGIQSTGLAVSEENGLNQKCQTPQEENQQSEQLHDAGM-TQMQEMGKAFSTH-VPINYPHGAQAELHQNPVQEASLSAGVNHDCIYNNVSEFPCGTE---EQRELENAVGVDQTVAFEITDESHDFLTQGHEQIFIQTSDGLILSHPAAVLSQAEGIVIVTDSDG. 338
129 5.000e-29UniRef50_UPI000328A277 zinc finger protein 839 isoform X2 n=1 Tax=Dasypus novemcinctus TaxID=9361 RepID=UPI000328A277  ali  50  84.....................................................................................................................................................................................................................................................................................................................................................................................................................................................TEEFLRKREVCADCAPSHCSSPEVHGEEPEEASGRKRGNEVTEEVLASTKRTRRETLPKDAAWSLAAPSRGQEKPRPLRATAEGFAPQVNGNPYHYSEESHTVTDSDSERSIFHAGQQLKAFANLEARSGSADSVVLCQDTSGLALCTPLAQPGEPAQEWVAAFPTERAQEHAADQGAGHSLCSSGLRSTLGPDGGPSSLPPGRDAD-------------HHGQPPSPCCVSPAAVTPPLPERTLSVDTGPEDRA-------QNVCEPGRQLSAEGSLESHVSGFAQFSCGIEECSAQRELESIVAVGEAVALEIASGCRE-LSQGQEQMFIQTSDGVILSHPGTIVSQEEDIILVAEVE.. 424
130 6.000e-29UniRef50_A0A267EUF8 Uncharacterized protein n=4 Tax=Macrostomum lignano TaxID=282301 RepID=A0A267EUF8_9PLAT  ali  28..................................................................................................................................ATAAPATLEAGSTEQITTAQQTTALRDNAVPTTTESGLHPATVNAPGLFSTTISDVVTSAKDTTDEPIAVASTASNTALSTTSQLAAETQLRVPPTTHLLVTAAPLTTSGATTDRLTTMGETTDRLTTMGETTDRLTTMGETTDWLTTMGETTDRLTTMGETTYPLTTTRTTTDPLTTTRTTTRSTTDPPTTRAATHPLTTTGVTTNRLTMPGTTINLKTTSGASADSSTTSRTTDPHTITQQLRATITLIATTAQRTTDKQLTMQPTKQSTTLPTMQPTTKQTLITRQPTTVQPTTSQPTTSQPTTAKPTTAQPTTSQPATTQPTTAQSTTPQPTTSRPATTQPTTVQPTTSQPTTAQPTTAQLTASQPTSQPATSQPTTVQPTTSQPTTAQPTTAQLTASQPTAVQPTTSQPTTAQPTTAQLTASQPTSQPATTQPATSQPTTVQPTTSQPTSQRTTSQPTTSQPTTAQPTTAQPTTAQPTAQPTTAQPTTAQPTTAQPTTSQPTTTQPTTSQPATSQPTATQPTTSQPATSQPTTSQPATSQRTTSQPTTSQPTTAQPTTSQPTTAQPTTAQPTTAQPTTAQPTTAQPTTAQPTTAQPTTQPTTAQPTTAQPTTSQPTTAQPTTAQPTTAQPTTSQPTTAQPTTAQPTTAQPTTAQPTTAQPT... 694
131 6.000e-29UniRef50_UPI0006C9B870 LOW QUALITY PROTEIN: uncharacterized protein LOC100993504 n=3 Tax=Catarrhini TaxID=9526 RepID=UPI0006C9B870  ali  83  331VQPQSARQSQPPRGNSRLVGLHVTSPQLLRVQPLVRTEPRSCFLH---QPPAQGFVQRPLPALXVVPAKRVPAPKAPNGQGTTLTPLSASSSPTVTXVSSSSGRLFISNLHTKHTEKLKPSLKVKTXLRQVSRPAKYKAK-AEFIKRDDLADGHLPDSDDYSELSVEED--QRERQALFDLSSCSLRPKSFKCQTCKKSYIGKWGLAQHFKLNPGHGQLDPEMVLSEKANGSNLRGCTEERTLSLTFPGLSMPAAPREGGARSCLVRESARGGLQ............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 599
132 7.000e-29UniRef50_UPI000C6D04F5 uncharacterized protein LOC111630978 n=1 Tax=Centruroides sculpturatus TaxID=218467 RepID=UPI000C6D04F5  ali  14  195...PPKSTSAPLGSSANPIQIIQQGNTYHSTQVLTQDQLQQIAHVLQQQQVSKALNNGGNPATNTRIIYRVIYPSELNKTSDSERDHDGSFQRGGPS-SRGRGRPRKGWGKKNEEDENKTEGPELSR----------------------------------------EEKEKRKKHRPRTRSGRISKPPAY--------------MMRDYKRIHHLDFDEEPYDDSDGGYSDYQVSDEDGEKRSCHLPPGVTTAKPRNYKCRYCDKAYIGRGGLARHFRLNPSHEDGSTQDENSNSSMASAVGSTTMSSGHQMNFGRHGSTRGDDDHHHPRS--YNSEIASARRKAKLKDFLNHCQEEELMEVVMPHLSQNITLWEFLLMKTESSNPSQPHIPAILDHFDSLLKHIQKVAKTCLAPTSPDRKDDYQVHSEDLARSLNLQIGVYEVKQFAEKASFGMKRPAPDVE---NMKTGEEANQIADQMNPSKKQCMDESTLSDQILNESVDNIDLSGLRGSLVSEMGNNQRNALLHQQVTDESVLNSFDLSGDNYNVEGKLTSTSQNAMVTSSVGTVSKSQMQGISQQPTLQVSSKIDETNENHEVLEGSIGSSHGTTEDSSNMLVNNRENISVITSDGSLSTVVNVQGTATTLNEYSSVTGLMTGEGNNSSVPPGTNVVISVPDSTMSGQHNAMETEDSSTCAEVNSSDMSVVNTVEANNEMTEANSKILPEGNQITSEGKKVEMNQVVCAESADDGTAVIRQLVLPDGQVIGTWSMCGQVVTELGDQLSQPNNVVIVQNPDG. 969
133 8.000e-29UniRef50_UPI000B45EB74 uncharacterized protein LOC110456831 n=1 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=UPI000B45EB74  ali  273.KPTPPTQSSKPTPPRRSSKATPPTLSSKPTTPTRSSKPTPPTQSTKPIPPTQSSKPTPQTRTPKPTPPTQSSKPTPPTRSSKPTPPIRSSKPTPPTPSSKPIPPTRSSKPTPPTRSSKPTPPIPTPPIRSSKPTPPTPSSKPPTRSSKPIPPTRPSKPTTPTQSSKPTPPTLSSKPTPPTRSSKPIPPTRPSKPTTPTQSSKPTPPTRSSKPTPPTLSSKPTPPTRSSKPTPPIRSSKPTPPTQSSKPIPPTRSSKPTPPTRSSXXXXXXXXXXXXRSSKPTPPTRSSKPTPPTRSSKPIPPTQSSKPTPPRRSSKATPPTLSSKPTTPTRSSKPTPPTRSSKPTLPTRSSKPTPPTLSSKPTPPTRSSKPRPPTRSSKHTPPTQSSKPIPPTRSSKATPSTRSSKPTPPTRSSKPTPPTRSSKPTPPTQSSKPIPPTRSSKATPSTRSSTPTPPTRSSKPTPPTRLSKPTPPIYDHQNPH............................................................................................................................................................................................................................................................................................................................. 777
134 1.000e-28UniRef50_S9XBB3 Zinc finger protein 839 n=1 Tax=Camelus ferus TaxID=419612 RepID=S9XBB3_CAMFR  ali  42  42.................................................................................................................................................................................................................................................................STGPQPCFLSTSPQPLAQCQTCEKSYIGKGGLARHFKLNPGHSHVEPEMSLSEKANGSVGPTEGRPVSLASPEPPPLALLSEDGARSAGGGLQFLHQCDQEDLVELALPQLARVVTVYEFLLMKVAES-------------------------------------------------LGITEEFLKKRETCTDCVPPKCTSQEMDREGPGEAGRRKRGNQTTEEGLASVKRTRRETLPQDT-EPSANIGGQQRPALWVSAASEGFGPGVNGCTSHLADDSPPRPASERDGSTAHAGQRLKAFADLAAGSGSADPAPWCRDVSGL----------GALALGWVAAVPENTQEHWTDAATGDSLRSWRLCSSSTSAGGVGSLLPGGSGSAEAGNLCEVRDSPVTG----PGEVLLAQAAAPPLDKVLSLDIGPADHAYGSVSEPGPQ------LCPEGGLGGHVGDLDQLPCGTETHTDQGELEHVAAV----AFEVTNGCH-----GQERIFIQTPDGLILSHPGPVVSAEGDIVIVTNAEG. 505
135 1.000e-28UniRef50_A0A0C9QB86 ZNF839_0 protein n=4 Tax=Opiinae TaxID=68883 RepID=A0A0C9QB86_9HYME  ali  22  471.........................NPIQIVQQGHTFHSNQKLTQTQLKQIAQVLQQRGQPGSKEKVVYRVVFPEELDLRIRNPGNLLKTRPKKAPGRHVAAVKVGMTDEENDELKEDRKKVVARTRSGRLSRPPRHMVRDYKHLHPLDFMQPDLDDSDGYSDYNTNTINEGEETKVLLTGLELPKRSTHFRCSTCNKMYLGRARLAKHFELFPEHGSIELLPSSTLTSNGPLTVDSFKRKGKKRGPWAYATPEAKSERRQTKLREALSVCDSGE............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 744
136 2.000e-28UniRef50_A0A0L0CRH4 Uncharacterized protein (Fragment) n=4 Tax=Schizophora TaxID=43738 RepID=A0A0L0CRH4_LUCCU  ali  54.....................................................................................................................................................................................................................................................................................PPPEQPFTYPPPVVSTRAPVTTPKPTTRVPATYLPPTNKPQTPATTRATPKPTTRAPVTTPKPTTRVPATYLPPTNKPQTPATTRATPKPTTRAPVTTPKPTTRVPATYLPPTNKPQTPATTRATPKPTTRAPVTTRATPKPTTRAPVTTPKPFVPSTYLPPTNKPQTPATTRATPKPTTRAPVTTRATPKATTPKPFVPSTYLPPTPQTPATTRATPKPTTRAPVTTRATPKPTTRAPVTTPKPTTRVPATYLPPTNKPQTPATTRATPKPTTRAPVTTRATPKPTTRAPVTTPKPFVPSTYLPPTNKPQTPATTRATPKPTTRAPVTTRATPKPTTRAPVTTPKPTTRVPATYLPPTNKPQTPATTRATPKPTTRAPVTTRATPKPTTRAPVTTPRPTQRSTPGPTYLPPDAPATTRATPKPTTRAPVTTPRATPKPTTRAPVTTPKPTTRVPATYLPPTNKPQTPATTRATPKPTTRAPVTTRKPTTRVPATYLPPTNKPQTPATTRATPKPTTRAP.. 575
137 2.000e-28UniRef50_A0A1V9X9D5 Microtubule-actin cross-linking factor 1-like n=1 Tax=Tropilaelaps mercedesae TaxID=418985 RepID=A0A1V9X9D5_9ACAR  ali  11 3236..................................................................................................................................................................................................................................................................................QSTSTVIRRAAPSAERERSPSPKKTTESLGRHLSKHEEASFSSSEYQSTRRLVSPPKSATTVQEASTVTTTTTTVKAGSPETVEVATTPSPTKFESERETTTTSSPPSVSAHPLRTSSPDRTSETTEYFARGSSRSASPLESSSFSTTMTEESTSVRSKSSLPEETVLRATSASEDVTSVTSETFKISESISKTSSRSASPTKSPAREPSPTKSPTREPSPTKSPTREPSPTKSPTREPSSTKSPLTEPSPTKSPLTELSPTKSSLREPSPTKSPTREPSQTTSPTELPTRDTSPTESLTRELSSMKSPTREPSPTKSPTREPSPIKSPTREPFPTKSSPREPSPTKSSSPTKSPPREASPTKSPPREASPTKSSPREASPTKSPSREPSPTKSPPPSPTKSPPRESSPTKSPPREPSPTPPREPSPTKSPPKESSPTKSPPRESSPTKSLPREPSPTKSPPREASPTKSPPREASPTKSPLRE-ASPTKSPPREASPTKSPPREATPMKSPPREATPTKEA... 3841
138 2.000e-28UniRef50_A0A061I100 Zinc finger protein n=1 Tax=Cricetulus griseus TaxID=10029 RepID=A0A061I100_CRIGR  ali  45  22..............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................TGEGLASVKKARTAVLPTDVPECPAAVSGCQQKPGSPRAPSKGFAPAAIENPSPCSEGSCGEMVPSSGRGVPPAGQQLTAAADFEARSGSPDPALLRQDVSRSALYSQVAEPRGLPPAPLSGFSEENVPEHSVGQNSGAIQRSTRVRGTPPSGGGVESLLLGGWGNAEAGDLREMSRPHLRGQQASPSHSLPAEAAAFPLHSVLPVTVPPAACASNTVPEPGPHPGPDGSLSTNGGPGNKAGDVSQLRSRMEA-DGQREPETVAAVGEALALEISDVCQEV-SQGQEQILIRTASGLILSNPRATVSREENTVIVTNTGG. 344
139 2.000e-28UniRef50_A0A0P5XVZ6 Uncharacterized protein n=3 Tax=Daphnia magna TaxID=35525 RepID=A0A0P5XVZ6_9CRUS  ali  19  548...............................................................................................................SKEEREGKKKLLPRTRSGRVSKPPRHMVKDYKRLHHLDFAQPDLDDSDGYSDYRIDHEDSNAESSEDSKGPIKSVIPTSFHCTICKREYTTPHRLSRHFEQFPDHSSSVATRRNSTVPVPAIEKKNGQHDKEDMEAEEESDSTETEKVVKRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSTIRGSXXXXXXXXXXXXXXXXXSPALLSEKRKIRLAEALELCTDEEVVDVAGPRLSAAMSSWEYLLLRVQQGNSSAPLIPRILNEVTSLFDRVSTMTTRHLHPADEEEHEPYQLTNPETARLLGLQCGTYFISKDERKLLEEDAVDSAQLCQATSSSSIPPAISVTTETSSPEPQLPVPVVVHETDDVSQQQDDAQMKADSAAAAASKLWEEL-------EEADHLPPTAGSESGIGGGPDGDHVDDDVVDSELMQVDEIVNQVVEGQTGGSQAPSP................................................................................................................................................................................................................. 1052
140 3.000e-28UniRef50_A0A2G5DNC1 Uncharacterized protein n=14 Tax=Aquilegia coerulea TaxID=218851 RepID=A0A2G5DNC1_AQUCA  ali  391................................PGTPGRPEEPGRPGEPSRPGEPSRPGEPSRPQEPGRPGEPSRPGEPGRPEEPSRPREPGRPGEPSKPGEPGWAYFECQRRCRQVPQHQQQQCRQRCEKGYRPGTPGRPEEPGRPGEPGRPQEPGRPGEPSRPGEPSRPGEPGRPEEPSRPGEPGRPEEPGRPGEPSRPEEPGRPGEPSRPGEPGWAYYECQRRCLQVPQHQQQQCRQRCEKDYRPGTPGRPEEPGRPGEPSRPGEPSRPGEPSRPEEPSRPGEPGRPGEPSRPEEPGRPGEPSRPGEPGRPEEPSRPGEPGWTYYECQRRCLQVPQHQQQQCRQRCEEVYRPGTPGRPEEPGRPGEPSRPGEPSRPEEPGRPGEPSRPGEPGRPGQPSRPEEPGRPSEPSRPEKPGPGEPSRPGEPGRPGEPSRPEEPGRPSEPSRPGEPSRPEEPGRPGEPSRPGEPGRPGEPSRPGEPGRPEEPSRPGEPSRPGEPGRPGEPSRPGEPSRPGEPGRPGEPGRPEEPSRPGEPSRPGEPSRPGEPSRPGEPGRPGEPSRPGTPGRPGEPSKPEEPGRPSEPSRPEEPSRPGEPGRPGEPSRPGEPGRPEEPGRPGEPSRPGEPGRPEEPSRPGEPGRPEEPSRPGEPGGPGEPSRPGEPGRPEEPSRPGEPGRPEEPSRPGEPSTPEEPSRPGEPGRPGEPSRPGTPGRPGEPSRPGEPGRPGEPSRPGEPGRPEEPSRPGEPGRPEEPSRPGEPSRPEEPSRPGEPGRPGEPGKPGEPSRPGEPIRPGVTGPPG. 1157
141 3.000e-28UniRef50_UPI00073FCF90 zinc finger protein 839 n=1 Tax=Lepisosteus oculatus TaxID=7918 RepID=UPI00073FCF90  ali  22  239..PGGGGGGGPLELAAGAPPLAIMQNASRQLQHVAK----QVALQQSQSQNGTRLIQKKQLETIRIQVRSQTLPEPKESPLPPLAVFHPKSVAAGQPVPKLSVTPAVGLGGPQIIHIQPVMGAGA--------PQQFVLQSSGEPPIQLLVHRQVPSDSDDYSEISVEEEEAEESKGDAAPINFNLNPKAFKCDTCEKAYIGRGGLSRHYRLNPAHGQMPATEPPVHATPTPVPASRAADGTELLPPGPPVAPAEGVDPVGPLSEPVVALQGQKADTPLSVQPAPGPGVPSCAGPGRPRGPGRPKGPGRPGRPKVSGRPARRARPGRPPKYLGGVTTEQQAQRRRARLKEILQQSDTEELMEMALPRLAKVMTVWEFLLMKVEKGRPSRPHFADVYREFEQLHSQVKKMAQEHFGSPGPGPHTPLEIRDPEVSRSLGIEDLVKKARLQGAASVVQPALRVCKENNL--SAGKRLMEHESESSFLPAKRIRIENSAVETNGVYLNQNGIQNTAQQGTIQAQNEPSALSQGPTVELNGSAVKGALEVDPSSRKALETENGFPVLETRNEPANVLLSQTEIQKQEELTVSEQAVVFTSLENDFTPEELVEEHTVNHEVMEVEPAGGMEGDVQSEQESGTVLLAIPQNDQQGGSAK---------PSEVLNDSDIADQMHQLEKALSRDVVPLDHSYRT-HNAEPRGQHQQTLAPIPASDSLQSEAEGQPEGVESVEQNGSLEHIISVGGTVEFKLSDANQELLSQGHEQIFIQTSEGLIMHHSGGDIAS-ERILIVTDTDG. 1075
142 3.000e-28UniRef50_UPI000C1FE7F4 uncharacterized protein LOC111419441 n=1 Tax=Onthophagus taurus TaxID=166361 RepID=UPI000C1FE7F4  ali  20  23......................ISLPQLDHILPVSSLQLNNLGLSELSQQDTPQDNQPQVTQTNPFNIDEENGSLITNIVYKVIKPEDLDKPASIKYLPRGRPRKKVCLEKTTIIEPEVKKVQARTRSGRITKPPKHIEVDFKKI---DITDDSELKTAEFEPLKTNDSEV-KQEPLLILNQHCKKRPPRYRCPTCNKAYLGKAKILNHFEKHPDHGSISPNVTFKNTATWDFLISTAQKFKGSKVTKFCDELTTLIENAKKIAKYLFKPFKEDQESYIIKNELA.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 290
143 5.000e-28UniRef50_UPI000C6F6827 zinc finger protein 839 n=2 Tax=Seriola TaxID=8160 RepID=UPI000C6F6827  ali  21  401.............QKSVASPIRVQTPSTVKTTATSIIKTPPSSAAKTVSVPLIKNPTNGTTAATSKSSVKPPAVAVPVQTTTPARPATVTTPPAALPPGHGVKDKEREKEKKKVKKREKKTVKVQTRSGRVSRPPKYKAKDYKFIKTEDLADSHQSDSDDYSDMSVEEEENDGPSPGASTSLTYSHKSRSHRCQTCDKAYIGPGGLNRHYKLNPTHGDPDPPGSQP----GNIPGTLRDISQPQEMTVREEEKKKEDKPATMATNRVEGGPAAAVGLRGLHHXXXXXXXXXXXXXXXXXXXXXXXXLAPPPKVTVGLVSKRGRRGRPPKLSVTTVTAXXXXXXXXXXXXXXXXXXXXXELMDIVLPRLTKVLSLWDLLLAKVERSGSARTRFPDIYREYESLQVQVKQAAQDYIISPQ-GGATPLEVRNIEVARCLGILDEVNRMKVVAGASPNCSLTNKNVRYMENS------------KMLPPSKRFKMENSVPVQQNGIETHRTSGLTVTPTSVTPVTAVTPVNSSLKSCSVSVSPLVIPGGSKLLTTTADSASSSSGFTSAKMTSTKAPLPATPMEITPGEDQGEGPLQTDVQVETLPAGQDQVLSTTDIAAQMKELEKALGSSPETTADTKTLESGCVQTSGSTTIQTLESNTAQALESSTTQTPGSTTIQTLESSTAQESSTAQTLESSTAQTLASSQLQQRDSSQSDSTTDACEAKELQEGQEIYIQTEGLTVQLAEPGSDRIVIVNG------PDGTTMHIQTPEGVPLEAVQALL............... 1157
144 9.000e-28UniRef50_U6D9J8 Zinc finger protein 839 (Fragment) n=2 Tax=Laurasiatheria TaxID=314145 RepID=U6D9J8_NEOVI  ali  48  1..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................APATSKGCAPHVSGSGSYDSAESHTTLVSKSDRSVLPADEQLKALADLEAKSGSAAPVLSHQHVRGPSLCPPLEEPRTQTQGQVAAFPEENIPEHSVAWKVGDSLRPRALCGTLTPTGGADSLPPSGSGSLE------MQDSPQRGQRSSPSHVLLMEDTGPPPARVLSVDTVPADCAHRTVRERGL--GQAGSPSSDGGQGSQAGDSHPFPCGPEASADQGGLESIIAVGEAVAFEITHRCHE-LSQGQEPLFIQSSDGLILSHLGSLVSGQEDLVLVAGADG. 275
145 1.000e-27UniRef50_A0A0T6AU38 Uncharacterized protein (Fragment) n=1 Tax=Oryctes borbonicus TaxID=1629725 RepID=A0A0T6AU38_9SCAR  ali  24  35....TTQLIQIPKVDVCNLGLQIQTPKTVKVEPV---------------PILASNINSILPSSNVEISDKLHEDKASHYVYKVVKPEDLNKPIVKTHLTRGRPKKRLKQNNSSEEETSKVVKQARTRSGRITKPPKHIEKDFKKIDISDNSKLDLTDLKTSEFEPLRTNETPSEEPLRILEQHHKRKPPRFRCPTCNKAYLGRIKMVNHFQKHPDH....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 243
146 2.000e-27UniRef50_A0A2H2I6J0 Uncharacterized protein n=1 Tax=Caenorhabditis japonica TaxID=281687 RepID=A0A2H2I6J0_CAEJA  ali  248...STSPVTGYPDASTSPVTGHSDGATSPQPTSPVSEITTEEPCLNSTEPTTPTGHSGSTESATSPASILPAAVPYIRLGRTSTSPDIQMLRPSPVTGHSDGATSPQPTSQVSEITTEEPCLNSTEPTTPTGHSGSTESATSPASIVPEASTSPVTGYPDASTSPVTGHSDGATSPQPTSQVSEITTEEPCLNSTEPTAPTGHSGSTESATSPASILPEASTSPVTGYPDASTSPVTGHSDGATSPQPTSPVSEITTEEPCLNSTEPTTPTGHSGSTESATSPASIVPEASTSPVTGYPDASTSPVTGHSDGATSPQPTSPVSEITTEEPCLNSTEPTTPTGHSGSTESATSPASIVPEASTSPVTGYPDASTSPVTGHSDGATSPQPTSPVSEITTEEPCLNSTEPTTPTGHSGSTESATSPTSISPEASTSPVTGYPDASTSPVTGHSDGATSPQPTSPVSEITTEEPCLNSTEPTTPTGHSGSTESATSPASISPEASTSPVTGYPDASTSPVTGHSDGATSPQPTSPVSEITTEEPCLNSTEPTTPTGHSGSTESATSPTSISPEASTSPVTGYPDASTSPVTGHSDGATSPQPTSPVSEITTEEPCLNSTEPTTPTGHSGSTESATSPASIVPEASTSPVTGYPDASTSTVTGHSDGATSPQPTSPVSEITTEEPCLNSTEPTTPTGHSGSTESATSP................................................................................................ 958
147 2.000e-27UniRef50_X1WCH5 Zinc finger protein 839 n=10 Tax=Otophysi TaxID=186626 RepID=X1WCH5_DANRE  ali  26  304LQPQNLSTSQPLVKVSTVGTL--SSPQIIHITPVP--GQQQYFLQNPSDPPIQLLLQKPAPVVSTISVPISKVHVSPPPATPPPPPAKITMPTKVVTVETKTSTPPVAENVQKVKNRQKKPLKIQTRSGRVSRPPKHKVKDYKFIKNEDLAESHQSDSDDYSEISVEDEEGEDRKRKTSD-VTLNLRDKAFKCDTCEKSYIGVAGLSRHYKLYPTHDKNPTPVQAEDLSKTRDEQPSETEETDIIHVKTVSTQKVQEFGKVEXXXXXXXXXXXXXXHPRRPGRPPKRGRPGRPPKFP-----------------------------------RGMTLEQQAQRQRNRLKEFIKQYDDEDLMEIVLPRLARVMTVWEFVMMKVEKGYPSKQQFPNVYHEFEELHSQVKNMALEYL-HTSPASRPAIEVNNIGVLQSLGITD--PNALKLLTSSEGQQSQKTNQLEPRANQATKSLRSIENAKMLPPAKRFKIENPSEETNGYQINQNGIQKDEPVDDSVLLRPQVVLTRLENLTSVDLTAADEAQSAENTTPTRTEEEPMTEVPSADSDTTKPTEDPEISKVLNSSTTVDIADQVKELEQALSTDTEHKNSTQEPTQQALEDGQAEAVEDPEAGQVVQQESP.............................................................................................................................................................. 927
148 3.000e-27UniRef50_M3WZA3 Uncharacterized protein n=17 Tax=Laurasiatheria TaxID=314145 RepID=M3WZA3_FELCA  ali  56  7...........PTPPLATLQPRTAGLSQPPRGAPGVLGLRAQPRFPSNSPPIRVFVQRPLPALQLV---------APQGLGATPAPLSASDPPAVTSVSSGSANFFISSLHTKHTEKLKKSLKVKTRSGRISRPPKYKVKDYKFIKTEDLADGRLSDSDDYSELSVEDDDDQRGKRALFDLSSCSLRPKTFKCQTCEKSYIGKGGLARHLKLNPGHGHPEPEVSLSEKANGSTTRGCAEGRTASLPSPGLPTSALLGEEGAQSPPCGLQNSQSVEVEDALVSE---PEDGNYSAFVGSERHPGPRRIEFAAAPAEASEAVLGRGGAAHPRSGACVAGAQSASAARARLEEFLQQCDREALVDLVLPQLAQVVTVYEFLLMKVETGHLAKPLFPAVYKEFEELHKRVKKMCQDYLSGSGLCSQEPLEISNDKVAESLGITEFLRRREARTECVPAQHTSGDTSQAELEEAGQQKRGNETADGAPAWVKKTRRDPLPQDTTDGGA------------PAANQGPAPPASGNAPRRPEGSRTAPVSGR------AGRQLQAFADAEAKSGCGAPALSCENVSGLSLCPQSGEPGTHTQGCVPALPGENAQERSADWNTGNSLGSGDLCRTLMFPGGVASLPPSGPGDLERHG------SLWKGPRSGPSDVLFPEAAGPLLERVLSVDVGPADCVPRTVPEPGPQPAQARSLPTDGGQGSHAGGVDHFPAGPEAHADQRELESIVAAGEAVAFEITNGCHEFLSQGQEQIFIQTSDGLILSHPGSVVSGEEDVVIVAGMEG. 763
149 3.000e-27UniRef50_UPI000678B7E2 collagen alpha-5(IV) chain-like n=1 Tax=Papilio xuthus TaxID=66420 RepID=UPI000678B7E2  ali  446.........................................................................................................................................................HVSKGTKGSPVTPGSPGTKXXXXXXXXXXXXXSPATPGLPATPGTPATPGTKGTPGTKGTPGTKGTPGTPGSPATPGTPATPGTKGTPGTKGTPGTKGTPGTKGTPGTKGTPGTKGTPGTKGTPGTKGTPGTKGTPATPGTPGTPGTKGTPGTKGTPATPGTPGTPGTKGTPGTKGTPGSKGTPGTKGTPGTKGTPGTKGTPGTKGSPATPGTKGTPGTPATPGTPATPGTKGTPGTKGTPGTKXXXXXXXXXXXXXSPATPGTPATPGTKGTPGTKGTPGTKGTPGTKGTPGTKGSPGTPGTKGSPATPGTPATPGTKGTPGTKGTPGTKGTPGTPGSPATPGTPGTKXXXXXXXXXXXXXSPATPGTPATPGTPATPGTPATPGTPATPGTDGSPGQDGTPGTNGSPGQDGTPGTNGSPGQGGTPGTPATPGTPATPGTPATPGTPATPGTPATPGTPASPGSDGSPGQDGTPGTNGSPGQDGTPGTNGSPGQGSTPGTPATPGTPATPGTPATPGTPASPGTPATPGTPATPGTPATPGTNGSPGQDGTPGTNGSPGQDGTPGTNGSPGQGSTPGTPATPGTPATPGTPATPGTPATPGTPATPGTPATPGTPATPGTLATPGTPATPGTPATPGTPATP... 1088
150 3.000e-27UniRef50_UPI000874EDFE uncharacterized protein LOC108905784 n=1 Tax=Anoplophora glabripennis TaxID=217634 RepID=UPI000874EDFE  ali  21  16....AVSAIRLSENDISNIALSVSQPADINILPSSSQKLEQVCLEKSS---------KISAIGRVVDVDMEVETQNVNEQVNFVYEIVYPNLKPIYNLKRGRPKKKKVEELPVEISKNVKPV-PRTRSGRVVKFPKYIEKDFKKMETEDYSEEHDVKTTEFERF--EEDNKQVKKTNEIQLEFHQRKRKQYRCPKCKKAYLGKSKMIQHIKKYPDHGPIP................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 228
151 4.000e-27UniRef50_UPI000B45F559 extensin-like n=1 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=UPI000B45F559  ali  1.......................................PPHPATVISTTTPPIESHKPHLPTKHLPTERQSAEQPLHPATVTSPISPPSDSHQHNLPTQHLPTQRQSLAPSPHPAPPHSATVASLTSPPSDSRQSHLPTQRQSPAPPHHAATVTSTTSPPSDSHLHHLPTQR-KSPSPLPHPAPPHPATVNSPTSPPSDSHQSHLTTQRQPPAQPSHPATVISPTLPPSTSLPSDSHLPHLTTQRHLTAQRQSLAPPLHPATRQSPAPPPHPVPHHPATVTSPTSLPSDSHQPHLPNQRDSSAHLHTQRQSSPPPQHPATVTRTTSPPSESHQHHLSTQRQSLAPPSTQRKSPAPPIQRKSPALPLHPAXXXXXXXXXXXXXHPAPPNRATVTSTNPPPRTQRQASXXXXXXXXXXXXTITSPTSLPSDSHQPHLPNQRDSPAPPSHPATVTSTTIPPSDSHQHHLPTQRQSPAPPLHSAKVTSPTSPPIDSHQHHLPAQRQSSVPPSHPAPPHPATVTSTTSPPSDSHQHSPPSSESHQHHLSTQRHSPAPPHHPVKVTSHTSPPSTSPPSDIHKPHIINQRQSPVPPLHLATVTSSISPPSTYRPNDTPPHPATVISTTTPPIESHKPHLPTKHLPTERQSAEQPLHPATVTSPISPPSDSHQHNLPTPTQRQSLAPSPHPAPPHSATVASLTSPPSDSRQSHLPTQRQSPAPPHHAATVTSTTSPPSDSHLHHLPTQRKSPSPLPHPAPPHPATVNSPTSPPSDSHQSHLTTQRQPPAQPSHPATVISPTLPP.. 760
152 4.000e-27UniRef50_W4XQS8 Uncharacterized protein n=1 Tax=Strongylocentrotus purpuratus TaxID=7668 RepID=W4XQS8_STRPU  ali  3......................................................................................................................TGQSTQLTTTDPTTDVLTTTSSDPSTIEFNTTSVTTLETTTDNATSNPGTPVTDDTDATTTATYTHTSALTTGLTSTSTPDPTATLSTVASGRSAPTTLLETSDPGVTTGTQETIGASATTSGTTLDPSASTVASAAPDPSAPTTPPEASNPGVTTGTPETPDSSAPTVAQETPDSSAPTVAQETPDPSAPTVAPETPNPSAPTAAPGSPDPSAPTVAPETPDPSAPTAAPGSPDPSAPTVAPGSPDPSVPTVAPETPDPSVPTVAPETPDPSAPTVAPETPDPSAPTAATKTPNPSAPTAAPGSP-DPSAPTVAPETPGPSAPTAAPETPDPSAPTAAQGTPDPSASSTTEREEEGTTPPVTTNAIRTVTITDFLSSDTLTTMQVTTSSPASATQSMTTLSDPSTTELHTTGVATPETTSNPGTPVTHDTNATTTATYNHTSALTTGLASMSTPDPTVPAATLSTVASGRSAPTTPLGASDPGVITGTQETIGPSATTSGTTLDPSASTVASETPDLSAPTASGTPDPSAPTVAPETPDPSAPTVAPETPDPSVSTVAQETPDPSVSTVAPGSPDPSAPTVAPETPDPSAPTVAPETPDPNAPTVAPETPDPSVSTVAQENPDPSAPTVAPETPDPSAPTVT-------LETPDPSAPTAAPETPDPSAPTAAPETPD.. 673
153 5.000e-27UniRef50_UPI00096AF98B uncharacterized protein LOC109598344 n=1 Tax=Aethina tumida TaxID=116153 RepID=UPI00096AF98B  ali  18  13............KKGVKSIRLTKANNQI----PISDTQLDAIVTCEPS-------VQHELN-LQPLDTNIQLIPNIEETQTVIYQVVYPEDLDKPTNTKRGRPKRKVPQDTKPPEVPVEPPKSARTRSGRLVKLPKHIEKDFKKI---EITDEPEIKTSEFVRFEESNKNDNVVYQELEVHQKKRTISAQYRCPKCQKAYLGKAKMVQHLEKYPDHGPLSDTFNKLNFDVWNYLVDITQKSPPGRR......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 232
154 6.000e-27UniRef50_A0A2D4BIX1 S-antigen protein n=2 Tax=Eukaryota TaxID=2759 RepID=A0A2D4BIX1_PYTIN  ali  388.QPTYAPEPQPTYAPEPQPTYAPEPQPTYAPEPQPTYAPEPQPTYAPEPQPTYAPEPQPTYAPEPQPTYAPEPQPTYAPEPQPTYAPEPQPTYAPEPQPTYAPEPQPTYAPEPQPTYAPEPQPTYAPEPQPTYAPEPQPT-YAPEPQPTYAPEPQPTYAPEPQPTYAPEPQPTYAPEPQPTYAPEPQPTYAPEPQPTYAPEPQPTYAPEPQPTYAPEPQPTYAPEPQPTYAPEPQPTYAPEPQPTYAPEPQPTYAPEPQPNLCPGTSADPEPTYAPEPEPTYAPEPEPHPTYAPEPEPTYAPEPEPTAPEPEPTYAPEPEPTYAPEPEPTYAPEPEPTYAPEPEPTYAPEPEPTYAPEPEPTYAPEPEPTYAPEPEPTYAPEPEPTYAPEPEPTYAPEPEPTYAPXPEPTYAPEPEPTNEPEPTFSPVTIEPNPSGGDDTVT..................................................................................................................................................................................................................................................................................................................................................................... 828
155 6.000e-27UniRef50_A0A2P4SBW2 Uncharacterized protein (Fragment) n=1 Tax=Bambusicola thoracicus TaxID=9083 RepID=A0A2P4SBW2_BAMTH  ali  46  14IQSKTVMLSQSVGRNSSVPGLGIINPQIIKIQPVTGEQQQQLFLHSSSEPPIQLLMQKPQPSHGSVPANKIPTSKVLNGQKTARATVSPARSSNTAAGSTNTLMPCL--EKKQKEDKLKKSLKVKTRSGRISRPPKYKAKDYKFIKMEDLADGHQSDSDDYSELSIE........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 179
156 9.000e-27UniRef50_A8Y4K4 Protein CBR-CLEC-223 n=2 Tax=Caenorhabditis TaxID=6237 RepID=A8Y4K4_CAEBR  ali  226.................................................................................................................................................................................................................................................................................................................................................................QTSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTSEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVSSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSNSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTTAEPSSSTTEVPSSSTKAEPSSSTTEVPS----SSTTAEPSSSTTEVP.. 665
157 1.000e-26UniRef50_A0A2T7NT42 Uncharacterized protein n=3 Tax=Pomacea canaliculata TaxID=400727 RepID=A0A2T7NT42_POMCA  ali  17.....................................................................................................................................................................VAPAPRPMVLPAPAPTEHKRTANSQQPTANSQQPTANSQQPTANSQQPTANSQQRTANSEQRTANSEQRTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTAKTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPNSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPTANSQQPT..... 645
158 2.000e-26UniRef50_A0A2A6B4Q9 Uncharacterized protein n=1 Tax=Pristionchus pacificus TaxID=54126 RepID=A0A2A6B4Q9_PRIPA  ali  1251....PSSTEFSSTIEPTSTMSTEGSTAPSSTEFSSTIEPISTMSTEGSTAPSTNEFSSTIEPTSTMSTEGSTAPSSTEFSSTIEPTSTMSTEGSTAPSSTEFSSTIEPTSTMSTEGSTAPSSTEFSSTIEPTSTMSTEGSTAPSTNEFSLTIEPTSTMSTEGSTAPSSTEFSSTIEPTSTMSTEGSTAPSSTEFSSTIEPTSTMSTEGSTAPSTNEFSSTIEPTSTMSTEGSTAPSSTEFSSTIEPTSTMSTEGSTAPSSTEFSSTIEPTSTMSTEGSTAPSSTEFSSTIEPTSTMSTEGSTAPSSTEFSSTIEPTSTMSTEGSTAPSSTESSTIEPTSTMSTEGSTAPSSTEFSSTIEPTSTMSTEGSTAPSSTEFSSTIEPSSTMSTEGSTAPSTEISSTIEPTSTMSTEGSTAPSSTEFSSTIEPTSTMSTEGSTAPSSTEFYSTIEPTSTMSTEGSTAPSSNEISSTIEPTSTMSTEGSTAPSSTEFSSTIEPISTMSTEGSTAPSSTEFSSTIEPTSTMSTEGSTAPSSTEFSSTIEPTSTMSTEGSTAPSTNEFSLTIEPTSTMSTEGSTAPSSTEFSSTIEPTSTMSTEGSTAPSSTEFSSTIEPTSTISTEGSTAPSSTEFSSTIEPTSTMSTEGSTAPSSTEFSSTIEPTSTMSTEGSTAPSSTEFSSTIEPTSTMSTEGSTAPSSTEFSSTIEPTSTMSTEGSTAPSSTEFSSTIEPTSTMSTEGSTAPSSTEFSSTIEPTSTMSTEGSTAPSTNEFSLTIEPTSTMSTEGSTAPSSTEFSSTIEP... 2044
159 2.000e-26UniRef50_X6NJ56 Uncharacterized protein (Fragment) n=1 Tax=Reticulomyxa filosa TaxID=46433 RepID=X6NJ56_RETFI  ali  1...............................................................TPSQQPSDSSTNQTITRRPTTRPTNQNTTDVPTFGTANETTTTRPTNETTTSPPTARPSNQTTTSLPTNKITTRQPTNRPANLTTTSAPTIKRPTNQTTTSPSTIRPTNNRTTTMQPTNQTTTSLPTTQQPANQTTTKQPTIWPTTKVPTNQTTTIRPTNQTTTRQPTSRPTNQTITSLPTTQRPTNQTITTTKRPTNQSTNQTTTTQQPTNQTTTNVPTTKQPTNRTTTKQPTSQPTNQTITSLPTTKRPTNQTTTSLPTIQRPTNQTTTKQPTSRPTNQTTTTNLPTTQNPTNQTTTKRPTSQPTNQTITNPPTTEQPTNQTTTKQPTSPPTNQTTTTNLPTTQRPTNHTTTKQPTIRPTNQTTTSLPTIQRPTNQTTTKQPTSRPTNQTTTSLPTSQRPTNQTTTKRPTSQPTNQTITSSPTSEQPTNQTTTKQPTGRPTNQTTTTNLPTTQRPTNQTTTKQPTSRPTNQTTTSLPTSQRPTNQTTTKQPTSRSTNQTTTSLPTTQNPTNQTTTKRPTSRPTNQTVTSPPTTGQPTGRPTNQTTTILPTTQRPTNHTTTKQPTIRPTNQTTTSLPTSQRPTNQTTTKQPTSRPTNQTTTTNLPTTKNPTNQTTTKQPTSRPTNQTITSLPTSGQPTNQTTTKQPTSRPTNQTTTTILPTTQRPTNHTTTKQPTSRPTNQTTTNVPTTKRPTNQTMTSVPTTQQPTNQTTTKQPTSRPTNQTTTGVPTTKQPGN 736
160 2.000e-26UniRef50_H0ZRF0 Uncharacterized protein n=19 Tax=Aves TaxID=8782 RepID=H0ZRF0_TAEGU  ali  30  1.........................................................................................................................................................................DKLKKSLKVKTRSGRISRPPKYK--------------AKDYKFIKMEDLADGHQSDSDDYSELSIEDDEEGKVKGKDALFSSSNYNPKTFKCQTCEKSYIGKGGLARHYKLN--------PDHGQLEPSQKIPLNKPNGTTSLEETIDSKGGEQVKSDSNTSSALSFSLAEIIFVYTRL---IQQCDNEDLMELALPRLTKLVTVYEFLVMKVEKGHPAKAYFPDVYREFEDLHNMVKKMAYDHLSNS.............................................................................................................................................................................................................................................................................................................................................................................................. 226
161 3.000e-26UniRef50_K1WY59 Uncharacterized protein n=1 Tax=Trichosporon asahii var. asahii (strain CBS 8904) TaxID=1220162 RepID=K1WY59_TRIAC  ali  735..PSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPSTQVVPFTLGISVGISVVTPTGLIPS................................................................................................................................................... 1385
162 3.000e-26UniRef50_A0A0L7R6K8 Putative threonine-rich GPI-anchored glycoprotein n=1 Tax=Habropoda laboriosa TaxID=597456 RepID=A0A0L7R6K8_9HYME  ali  79...............................................................................................................................................................................................PKGTCTNISTTSTTEPVTWPPPSPTTVTVTKSSSSPTTKPITESSSSPTTEPVTVQSSSPTTEPVTVPASSPTTEPVTVPSSPTTTESVTVPSSSPTTEPVTESSSSPTTEPITVPSSPTTTESVTVPSSSPTTEPVTESSSLPTTVTVTETSSPTSSETVIESSSVPTTEPVTESSSSPATVTVTETSSPTTTESVTVPSSSPTTEPVTESSSLPTTVTVTETSSPTSSETVIESSSVPTTEPVTESSSSPATVTVTETSSPTTTESVTVPSSSPTTEPVTESSSLPTTVTVTETSSPTSSETVIESSSVPTTEPVTESSSSPATVTVTETSSPTTTESVTVPSSSPTTEPVTESSSSPTTEPITVPSSPTTTESVTESSSSPTTVTVTESSSPTSSETVTESSSVPTTEPVTESSSSPTTEPVTVPSSSPTTEPVTESSSSPTTVTVTETSSPITTESVTVPSSSPTTEPVTESSSSPTTVTVTETSSPITTESVTVPSSSPTTEPVTESSSSPTTVTVTETSSPITTESVTVPSSSPTTEPVTESSSSPTTVTVTETSSPITTESVT---VPSSSPTTEPVTESSSSPTTVTVTETSSPITTE.. 681
163 3.000e-26UniRef50_A0A210Q516 Zinc finger protein 839 n=1 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=A0A210Q516_MIZYE  ali  17  158..PVNQASGAPLGSSQNPIRIIQQGNQYTPVQHLTTEQLQQIMQVVQEQQVAKSTAQEGSPQTNTRIVYRVIYPSELHKSGGSGTPITLQSQGQQTVVLSQSSR-----------------------------------RPYKKRKLEEDPDKQQDGPD-----LSKEEKELRKKHRPRTRSGRISKPPKHMV-----------KDYKHIHVLDWDEDYDDSDGGYSDFKYSEDEREEREGSESIGIETGVGHPRPKNWKCETCHKSYIGRGGLGRHYRLNPEHGSVDDLPEETLHSFARVSHNGLSNSTGNLSEDSPSTGTPNKMFHQRGGYRGRNFENPLKRKNKLRDLIRQCEDEELMEVVLPRLAQVITLWEFLLMKVEKGKPSLPHVDDIYHEFEALSKQVQKFCKTYLKPLANTENKKLKVENKGMAEVLNLELNTYEVKEIPASELSTFHYRQISSDPARVDISLKPRVKRVEKMAAGKQLTRTTLGGSGGNNFVFTTGRPVVMEASNGKMSSSSTTAVQSVTPVSSTQPRFVTVSPSHGGTVLTSSNTNSLAQGVGKQSSSMPVVIQTVESKPGIKPSVVGGISLLPPNLASLA--NAQKASTSQPVTVSMTSNLVQSSTPTNTIVIQSLPNQSPSSANDNQQNSVTSLTGPLTSVPMSVVHGLVIEESAIQLSSLSPVTNGEKNMDISVVVEEEEEEQDNSPQEELQKS-LDTDTILCKNEVESLDNIMDTVEATGEFQEAEMVQLVQDQILEEEGVEGIQVPSDHII-TASNIYQTADGIIIIQNQDG. 960
164 8.000e-26UniRef50_A0A2P4SA73 Uncharacterized protein (Fragment) n=1 Tax=Bambusicola thoracicus TaxID=9083 RepID=A0A2P4SA73_BAMTH  ali  44  35IQSKTVMLSQSVGRNSSVPGLGIINPQIIKIQPVTPEQQQQLFLHSSSEPPIQLLMQKPQPS------NKIPTSKVLNGQKTARATVSPARSSNTAAGSTNTLMP--CLEKKQKEDKLKKSLKVKTRSGRISRPPKYKAKDYKFIKMEDLADGHQSDSDDYSELSIEDDEEGKGKDALFNSSSYNLKPKTFKCQTCEKSYIGKGGLARHYKLNPGHGQLEPQKTPLNKPNGSMFVDNLCGIGEEIMSPVHLNSIAVTLNNENALPTDLEETAGSQVEQ......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 309
165 8.000e-26UniRef50_R7VCI6 Uncharacterized protein n=1 Tax=Capitella teleta TaxID=283909 RepID=R7VCI6_CAPTE  ali  25  169..PQPKSNTTQLGTSSNPIRIIQQGNQYTSLQQLTPEQLSQIMQVLQQQQLLKTSEREGSPQTQTRIVYKVIYPSELHGKQSTNKTSSPSAPTDSVMVTSGAFPKRLSRKRPKEEREARKKRKLRTRSGRISRPPKHMVKDYKHIHPVDFNEEPYDDSDGYSDFKVSDSEKQHGEEGDHPYALGATKAKNWKCETCDKAYIGRAGLARHYRIFPDHGKLDLEEELAEGAAGLNGLDSGESRDSLSNSQRLRSPGAVSSVSSICPTE-------GATNGDVSFRDALGSAANHRAEVAPEKVPPKVKEV--------------KDLRANSKSKLQYAQNMAPNRRKQQLKEIVNQCNEEELMEVVMPRLSKATTLYEFLLMKVEESKCRTTQVQSLLKEYEVFNTKVKSYMSSHIRLKNSSTSEASP..................................................................................................................................................................................................................................................................................................................................................................................... 604
166 1.000e-25UniRef50_A0A2G9S0A9 Uncharacterized protein n=1 Tax=Lithobates catesbeiana TaxID=8400 RepID=A0A2G9S0A9_LITCT  ali  33  147.........PPPVRSVRSENASAIPSQVVQVKTIP--QPSQPFVVKAAQPPVQVLIQK--------TATQPAKVNTPDPNGNEDEGSAEEHGCCVAHHRYGSYAPGTTKKRQKRKKQIKIK----TRSGRISRPPKHKSKDYKFLKVGDSIQDSSVDSDDYSELSSEDEEDGGKERVHRDRQPYAVKNSLFQCQKCEKSYMGKGGLFRHYRLYPTHGQMDPSFLLEAKKGGDGGGSGEQK............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 363
167 2.000e-25UniRef50_A9WC61 Autotransporter-associated beta strand repeat protein n=1 Tax=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) TaxID=  ali  781..SATASATPEPTASTTPSPSATASVTPSPSATASTTPSPSATASTTPSPSATASATPSPSATASVTPEPTASTTPSPSATASATPEPTASVTPSPSATASVTPSPSATASVTPSPSATASTTPSPSVTASTTPSPSATASTTPSPSATASTTPSPSATASTTPSPSATASTTPSPSATASTTPSPSATASATPEPTASVTPSPSATASTTPSPSATASVTPSPSATASVTPSPSATASTTPEPTASTTPSPSATASTTPSPSATASTTPSPSATASTTPEPTASVTPSPSATASVTPSPSATASTTPEPTASTTPSPSATASATPEPTASTSPVSTVTTSPVPTVTTSPVPTVTTSPVPTVTTSPVPTVTTSPVPTVTTSPVPTVTTSPVPTVTTSPVPTVTTSPVPTVTTSPVPTVTTSPVPTVTTSPVPTETPSPVPTPGEAPHLELSLPPSIAVGSLVQTQLNASGGSGSYVYQSTGQLPS.......................................................................................................................................................................................................................................................................................................................... 1263
168 2.000e-25UniRef50_A0A091CUV9 Zinc finger protein 839 n=1 Tax=Fukomys damarensis TaxID=885580 RepID=A0A091CUV9_FUKDA  ali  45  3...................................................................AKRVKTAPALSGQGAMLTPLPASAL-----AAPGSVHLSPAGWHTECAKKLKKSLKVKTRSGRVSRPPKYKAKDYKFIKTKDLVDGRPSDSDDYAELSAGDEEEQQDPWALFAAASCALRPRAFQCPACDKAYIGQGGLARHWRLNPGHGQLQPTPS---------------------PEKGHLASLEPPTLPAPGQDRAEAAQGGPQDTQYIEGEEAMVLEPENGSHSALA-----FPRGDTEGPAEPGTTGVLQNGAARPCGGRAVATGPTTCRSRAQLWESLQQCGPEDLVELVLPRLAQVVTVYEFLLAKCHEGGAGQPRFPAVYKEFEELHSRVKTMCQEHLGRA-PATPEPLEIIDPQGLLSHVGTAADQLPVPSSESPRTAFLTLGPPQGALES........................................................................................................................................................................................................................................................................................................................................... 387
169 2.000e-25UniRef50_E9G8G5 Uncharacterized protein n=58 Tax=Daphnia TaxID=6668 RepID=E9G8G5_DAPPU  ali  24  647...............................................................................................................SKEEREGKKKLLPRTRSGRVSKPPRHMVKDYKRLHHLDFAQPDLDDSDGYSDYRIDHEESNADSSEDSKEPVKAVIPTSFNCATCKREYTTPHRLSRHFEQFPDHSNNVTTR------RSSTVSASAIEKKNGQHDREEPDAEEESDSTETEKVVKRTVRTSTAASTIXXXXXXXXXXXXXXXXXXXXXXXXPPLVHSPALLSE---------------------------KRKIRLAEALEVCTDEEVVDVAGPRLSAAMSSWEYLLLRVQQGNSSAPLIPRILNEVTSLFDRVSRMTARHLHPGNGEEHEPYQLTNPETARLLGLQCGTY.................................................................................................................................................................................................................................................................................................................................................................... 967
170 3.000e-25UniRef50_C5DFV2 KLTH0D18194p n=2 Tax=Lachancea thermotolerans (strain ATCC 56472 / CBS 6340 / NRRL Y-8284) TaxID=559295 RepID=C5DFV2_LACTC  ali  264.................PTTETIYYVETPTAATESTTYTPWTGTETSTFSTETTTFTGSDGVPTTETIYYVETPTVGTESTTYTPWTGTETSTFSTETTTFTGSDGVPTTETVETPTAATESTTYTPWTGSETVTFSTGTTTFTGSDGVPTTGTIYYVETPTAPVNTPTSGKPLYPSSSAPVSETYFSVVSSAPSPSSPVSEISSTPVSSVPSSSAPVSETSSTPVSSAPSSSAPVSETSSTPVSSVPSSSALVSEYSSTPVSSAPSSSAPISSVPHSYPYYHNTTTAAGIGSTSYPVSLSSTPATSDSVPATSGSTPATSGTPATSGSVPATSETIPATSGSAPATSETTPATSGTPATSGSVPATSETIPATSETTPATSETTPATSETTPATSGTPATSGSVPATSETTPATSGSVPATSETTPATSGSVPATSETTPATSGSVPATSGSVPATSGSVPATSETTPATSETTPATSETTPATSGTPATSGSVPATSETTPATSGSVPATSETTPATSGSVPATSETTPATSGSVPATSETTLATSETTPATSGSVSATSGSVPATSETTPATSGSVPATSGSVPATSETTPATSGSVPATSGSVPATSGSVPATSGSVPATSETTPATSETTPATSGTPATSGSVPATSETTPATSGSVPATSGSVPATSETTPATSGTPATSETTPATSGTPATSGSVSATSGSIPTTSTCQTIVISAVSGTTTIFTTTCPESTLPTTTGPAQTESVVT------VTESGTVTSYTTTCPITEVEPTTTGPDNAKTVVVSSASG. 1041
171 3.000e-25UniRef50_P15941 Mucin-1 n=10 Tax=Homo sapiens TaxID=9606 RepID=MUC1_HUMAN  ali  11  465.RPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDTRPAPGSTAPPAHGVTSAPDNRPALGSTAPPVHNVTSASGSASGSASTLVHNGTSARATTTPASKSTPFSIPSHHSDTPTTLASHSTKTDASSTHHSSVPPLTSSNHSTSPQLST.......................................................................................................................................................................................................................................... 1038
172 4.000e-25UniRef50_G4Z2P0 Uncharacterized protein n=1 Tax=Phytophthora sojae (strain P6497) TaxID=1094619 RepID=G4Z2P0_PHYSP  ali  278..PIPTPEATTGGSSETPAPTSTPEATTVPDTPIQTTPDTPAPTPAPTTAVETPIPTPEATTGGSSETPAPTSTPEATTVPDTPIQTTPDTPAPTPAPTTAVETPIPTPEATTGGSSETPAPTSTPEATTVPDTPIQTTPDTPAPTPAPTTAVETPIPTPEATTGGSSETPAPTSTPEATTVPDTPIQTTPDTPAPTPAPTTAVETPIPTPEATTGGSSETPAPTSTPEATTVPDTPIQTTPDTPAPTPAPTTAVETPIPTPEATTGGSSETPAPTSTPEATTVPDTPIQTTPDTPAPTPAPTTAVETPIPTPEATTGGSSETPAPTSTPEATTVPDTPIQTTPDTPAPTPAPTTAVETPIPTPEATTGGSSETPAPTSTPEATTVPDTPIQTTPDTPAPTPAPTTAVETPIPTPEATTGGSSETPAPTSTPEATTVPDTPIQTTPDTPAPTPAPTTAVETPIPTPEATTGGSSETPAPTSTPVATIVATQIPASVPMNPSPVSTPIPTPVATTVSPVATPAPTPCATTGSPRPIPTSSPTKASTKSPFPTPCPTTKAPSSKATPAPARAPVKTPSPKPAKTPSLPAKATGPSKIASTPCPSVTKAAPKQASSNQNVGTVPAATGGKPNGVPVQVKGSTTVSSGKQEPIAVSNAGAKGNKSKAQSPTKAATAPTPCPSRTAAGKATASKSRPSR......................................................................................................... 969
173 5.000e-25UniRef50_A0A1W4WK92 uncharacterized protein LOC108733752 n=1 Tax=Agrilus planipennis TaxID=224129 RepID=A0A1W4WK92_AGRPL  ali  19  82...........PKKEIVEKPLGSCENPIEIIQNGGKLQSTQNLSEEHLQQIAEALQQFNPTKKQEEEEEEEDPSQDYVYEYEIVYPDELDIKPATHPKRAKRTKKRPIENTFSELEEPIILKKVRTRSGRITRPPRYIEKDCKAVETDHTGDTKNVEKGQEIESCKEDNNNKHVQRKKIDCQTKKRQPAQYRCPKCKKAYLGHSRMLKHLQQNPSHGKLPDS................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 295
174 6.000e-25UniRef50_UPI000809DB65 zinc finger protein 839-like n=1 Tax=Cebus capucinus imitator TaxID=1737458 RepID=UPI000809DB65  ali  73  10FQPQTARQSQPPQGSSCLMGLHVTRPQLLGVQPLVRTEPQSCLLSDLRQPPAQVFVQGPLPALQAVPAKKVPAPKAPDGQGSMLTPLSASDPLAVTSVSSSSAHRFISNLHTKHTEKLKKSLKVKTRSGRISRPPKYKAKDYKFIKTEDLADGHLSDSDDYSERSVEADEDERKRQVLFHLPSCFLRPKSFKCETCEKSSIER-GLTRHFTLNPGHGHLDPKMVLRKGVGTPSGGHERKDAQPDLPRAVHASSSP................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 263
175 8.000e-25UniRef50_A0A267GI45 Uncharacterized protein n=4 Tax=Macrostomum lignano TaxID=282301 RepID=A0A267GI45_9PLAT  ali  549...............................................................................................................................................................................................................................STTAPTHTPTTTNILTTESTTLVTSESTTQTGPTSSSSVTTSATILADYTTYSKSTPDTTQTESTIEATQSQWTPDTTPTESTIEATQSQSTPDTTPNESTIESTQGQSTPDTTQTESTIEATQSQSTPDTTQTESTIEATQSQSTPDTTPNESTIESTQSQSTPDTTQTESTIEATQSQSTPDTTPTESTIEATQSQSTPDTTPNESTIESTQSQSTPDTTQTESTIEATQSQWTPDTTPNESTIESTQSQSTPDTTPTESTIEATQSQSTPDTTQTESTIEATQSQSTPDTTQTESTIEATQSQSTPDTTPTESTIETTQSQSTPDTTQTESTIETTQSQS---TPDTTPTESTIETTQSQSTQEATQSQSTPDATPTESTIETTQSQSTPDTTPNESTIEATQSQSTPDTTPTESTIETTQSQSTPDTTPNESTIESTQSQSTPDTTPTESTIEATQSHSTPDTILTESTMETTQSQSTPDTTQTESTIEATQSQSTPDTTPTESTIETTQSQSTPDTTPNESTIESTQSQSTPDTTPTESTIEATQSQTTPEATQSQTTPEATQSQTTPE.. 1119
176 1.000e-24UniRef50_B3M4N1 Uncharacterized protein n=1 Tax=Drosophila ananassae TaxID=7217 RepID=B3M4N1_DROAN  ali  443..PDDSTTFAPEETTTEDPDESTTSAPEETTTEDPNESTTSPSEESTTGEPDESTTSAPNDTTTEDPDESTTSAPDETTAEDPDESTTSAPEETTTEDPDESTTSAPDETTAEDPDASTTSAPDGTTAEDPDESTTSAPEETTTEDPDESTTSAPEETTTEDPDESTTSAPDETTAEDPDESTTSAPEETTTEDPDESTTSAPEETTTEDPDESTTSAPNDTTTEDPDDSTTSAPDETTAPDESTTSAPEETTTEDTDESTTSAPDETTAEDPDESTTSAPEETTTEDPDESTTSAPDETTADDPDESTTSAPDGTTAEDPDESTTSAPEETTTEDPDESTTSAPEQTSTEDPEESTTSAPDETTAEDPDESTTSVPDETTAEDPDESTTSVPDETTAEDPDESTTSAPEQTSTEDPEESTTSAPDETTAEDPDESTTSVPDETTAEDPDESTTSVPDETTAEDPDESTTSAPEETTTEDPDERTTSSPDETTAEDPDERTTSAPDETTAQDPDESTTSAPEETTTEDPDERTTSSPDETTAEDPDERTTSAPDETTAEDPDESTTSVPDETTAEDPDESTTSAPEETTTEDPDERTTSSPDETTAEDPDERTTSAPDETTAQDPDESTTSAPEESTTEDPDESTTSAPEETTTAASDSTKPEQSTASAPTETTTLAPYESTSSAPEESSTAGQDSTEPGQTTTLVPEESPTTRSTSSSSGSETTSIPDTSTSSLPPLSCSSGYP...................................................... 1187
177 1.000e-24UniRef50_A0A1Z5JXM5 Uncharacterized protein n=1 Tax=Fistulifera solaris TaxID=1519565 RepID=A0A1Z5JXM5_FISSO  ali  3................................................................................................................................................................................................................................................................................................................................................................................PSSAPSDKPSAKPTSAPTEGPTVSPSSQPTSGPSREPSAAPSSQPTKGPSREPSSAPTTVPSVTPTSRPSAVPTSRPSTNPTENPTVAPSMNPTKEPSSEPTIIPTSAPTIVPSGTPSHLPTNSPSREPSAAPSPGPSASPTSRPSVTPSVRPSVEPTHTPSLVPSILPTPVRSAVPSLDPTVSPSIIPSAPPSRQPTTRPSAAPTSRPSISPTDNPTVTPSARPTSGPTAVPSMTPTTKPSAVPTVQPSRQPTTSPSKEPSSVPTIQPTSTPTVSPSSDPTQQPSVKPSVSPTSRPSVAPTAGPSSAPTDRPTVAPSMKPSSAPSDKPSAKPSSAPTEGPTVSPSSQPTRAPSKRPSSAPSEAPTKSPSEAPTKTPSEAPTKTPSEAPTRSPSEAPTRSPSEAPTKSPSEAPTKSPSEAPTRSPSEAPTR 433
178 2.000e-24UniRef50_H2YFH5 Uncharacterized protein n=1 Tax=Ciona savignyi TaxID=51511 RepID=H2YFH5_CIOSA  ali  2.............................................................................TTGPGQTTFAPGTTGPGQTTLAPGTTGPGQTTFAPGTTGPGQTTFAPGTTRPGQTTFAPGTTGPGQTTLAPGTTGPGQTTFAPGTTGPGQTTFAPGTTGPGQTTFAPGTTGPGQTTFAPGTTGPGQTTFAPGTTGPGQTTFAPGTTGPGQTTFAPGTTGPGQTTFAPGTTGPGQTTFAPGTTGPGQTTFAPGTTGPGQTTFAPGTTGPGQTTFAPGTTGPGQTTFAPGTTGPGQTTFAPGTTGPGQTTFAPGTTGPGQTT-FAPGTTGPGQTTFAPGTTGPGQTTFAPGTTGPGQTTFAPGTTGPGQTTFAPGTTGPGQTTFAPGTTGPGQTTFAPGTTGPGQTTFAPGTTGPGQTTLAPGTTGPGQTTLAPGTTGPGQTTFAPGTTGPGQTTFAPETTGPGQTTLAPGTTGPGQTTFAPGTTGPGQTTFAPGTTGPGQTTFAPGTTGPGQTTLAPGTTGPGQTTFAPGTTGPGQTTLAPGTTGPGQTTFAPGTTGPGQTTFAPGTTGPGQTTLAPGTTGPGQTTFAPGTTGPGQTTFAPGTTGPGQTTFAPGTTGPGQTTLAPETTGPGQTTFAPGTTGPAPGTTGPGQTTFAPGTTGPGQTTFAPGTTGPSQTTFAPGTTGP-GQTTLAPGTTGPGQTTFTPGTTGPGQTTFAPGTTGPGQTTLAPGTTGPGQTTFAPGTTGPGQTTFAPGTTGPGQTFAPGTTGPGQTTLAPGTTGPGQ 721
179 2.000e-24UniRef50_A0A1L8H369 Uncharacterized protein (Fragment) n=1 Tax=Xenopus laevis TaxID=8355 RepID=A0A1L8H369_XENLA  ali  17..............................................................................................................................................................................................................................................................................................................................................................SATPCPSFTDTHTISGPSETPDHGTPGQPATDPPDTPSPSETPDPGTQDQPATDPPDTPSPSETLDPGTPGQPATDPPDTPSPSETPDPGTQDQPATDPLGTPGPSDTPDPGTPGQPATDPLGTPGPSETPDPGTPDQTATDPPDTPGPSETLHPGTPGKPATDPPDTPSLSETPDPGTPSQPATDSPDTPGASETPDPGTPGQPATDSPDTTGPSETLDPGTPGQPATGPPDTPSPSETPTPGQPATDPPDTPGPSETPVPRTPGQPTTYPPDTPSPSETPDPGTPDQPATDPPDTPGASETPDPGTPGQPATDSPDTTGPSETPGTPGQPATDPPDTPSPSETPDHGTPGQPATDPPDTPGPSETPVPRTPSQPTTYPPDTPSPSETTDPGTPSQPASDSPDTPDPSETLDPGTPGQPATDPLGTPGPSDTPDPGTPGQPATDPLG. 469
180 2.000e-24UniRef50_UPI000703D9A5 proline-rich extensin-like protein EPR1 n=1 Tax=Tupaia chinensis TaxID=246437 RepID=UPI000703D9A5  ali  2.................................................................................................................................................................................................................................................................................................................................................................................................................TTTMKPQTLEMTFWENVPPAGGRQTGMPTEPAGSSPRPPQTGVPTEPASSSPRPPQTGVPTEPASSSPRPPQTGVPTEPASSSPRPPQTGVPTEPASSSPRPPQTGVPTEPASSSPRPPQTGVPTEPASSSPRPPQTGVPTEPASSSPRPPQTGVPTEPASSSPRPPQTGVPTEPASSSPRPPQTGVPTEPASSSPRPPQTGVPTEPASSSPRPPQTGVPTEPASSSPRPPQTGVPTEPASSSPRPPQTGVPTEPASSSPRPPQTGVPTEPASSSPRPPQTGVPTEPASSSPRPPQTGVPTEPASSSPRPPPTEPASSSPRPPQTGVPTEPASSSPRPPQTGVPTEPASSSPRPPQTGVPTEPASSSPRPPQTGVPTEPASSSPRPPQTGVPTEP... 400
181 3.000e-24UniRef50_Q98Q44 LIPOPROTEIN VSAC (Fragment) n=2 Tax=Mycoplasma pulmonis TaxID=2107 RepID=Q98Q44_MYCPU  ali  201...SQTPSTTGDANTSQTPSTTGDANTSQTPSTTGDENTSQTPSTTGDENTSQTPSTTGDANTSQTPSTTGDANTSQTPSTTGDANTSQTPSTTGDANTSQTPSTTGAANTSQTPSTTGAANTSQTPSTTGDANTSQTPSTTGDANTSQTPSTTGDANTSQTPSTTGDANTSQTPSTTGDENTSQTPSTTGDENTSQTPSTTGAANTSQTPSTTGDANTSQTPSTTGDANTSQTPSTTGAANTSQTPSTTGDANTSQTPSTTGDANTSQTPSTTGAANTSQTPSTTGDANTSQTPSTTGDANTSQTPSTTGAANTSQTPSTTGAANTSQTPSTTGDANTSQTPSTTGDANTSQTPSTTGDENTSQTPSTTGAENTSQTPSTTGDANTSQTPSTTGDANTSQTPSTTANTSQTPSTTGDENTSQTPSTTGDENTSQTPSTTGDENTSQTPSTTGDENTSQTPSTTGDANTSQTPSTTGDENTSQTPSTTGDENTSQTPSTTGDENTSQTPSTTGDENTSQTPSTTGDANTSQTPSTTGDANTSQTPSTTGDENTSQTPSTTGDENTSQTPSTTGDENTSQTPSTTGDENTSQTPSTTGDANTSQTPSTTGDENTSQTPSTTGDANTSQTPSTTGV..................................................................................................................................................................... 833
182 3.000e-24UniRef50_UPI000B92B46D uncharacterized protein LOC111003579 n=1 Tax=Pieris rapae TaxID=64459 RepID=UPI000B92B46D  ali  184..........................................................................................................................................................................................................................................................................................................................................................................................................................................VSSTPSTPEDTPFTPEDSPSTPEDTPSTPEVTPSTPEDTPSTPEDTPSTPEDTPSTPEDTPSTPEDTPSTPEDTPSTPEDTPSTPEDTPSTPEDTPSTPEDTPSTPEDTPSTPEGTPSTPEDTPSTPEDTPSTPEDTPSTPEDTPSTPEVTPSTPEDTPSTPEDTPSTPEGTPSTPEGTPSTPEDTPSTPEDTPSTPEDTPSTPEDTPSTPEDTPPTPEDTPSTPEDTPSTPEDTPSTPEDTPSTPTTPSTPEDTPSTPEDTPSTPLETPSTPEGTPSTPEGTPSTPEDTPSSPEDTPSTPEDTPSTPEDTPSTPEDTPPTPEDTPSTPENTPSTPEDTPSTPEYTPSTPEDTPSTPEDTPSTPLETPSTP.. 554
183 3.000e-24UniRef50_H0YNU6 Zinc finger protein 839 (Fragment) n=2 Tax=Homininae TaxID=207598 RepID=H0YNU6_HUMAN  ali  92  2..................................................................................................................................................................................................................................................................................................................RACSETLAESRTAVLQQRRAAQLPGGPAAAGEQRASPSKARLKEFLQQCDREDLVELALPQLAQVVTVYEFLLM--------------------------------------------------KVAESLGITEFLRKKEIHPDNLGPKHLSRDMDGEQLEGASSEKREREAAEEGLASVKRPRREALSNDTTESLAANSRGREKPRPLHALAAG---------TIVSQEEDIVTVTDAEGRA.......................................................................................................................................................................................................................................................... 185
184 5.000e-24UniRef50_UPI0003766946 hypothetical protein n=1 Tax=Nocardia sp. BMG111209 TaxID=1160137 RepID=UPI0003766946  ali  12  409.....................................................................................................................................................................................................................................................................................................................................................................................................................................................................PPDTSRSTDPARPTDNARPANSTRPTDSTRPDSTRPSDGARPSDSTR-PDSTRPDPAHPADTARPADGARPADGSHPDTARPDSGARPADGSHPNTAQPDSGAR-PADGPHPPDTTHPADSTQPPPSDPAHPDNVNPGSRPAEPRAGLGTDTAPHEPPVAAGPRAESAPHTVETPTTSHEPISAHPEQPAA----------QPHPPAHPVDAPRPTEPTHAGTEPTAAHPDPAHPTDAPHSTDTAPHTGTEPTATHPDPAHPENPRTPEHEQPT-AHTPADRADADHGAHSDATEAGPESDRDPANTCSDRDPVDIATGEFLL....................... 722
185 5.000e-24UniRef50_A0A1B6EGW9 Uncharacterized protein n=2 Tax=Clastoptera arizonana TaxID=38151 RepID=A0A1B6EGW9_9HEMI  ali  21  466....SAAFNRIPINSKKPLGSNENPIQL--VQQGQTFHSMQTLSAEQLKKVMTVLQQKHIPESKTRIIYRVVCPEELYLRKKNDKNIPSKRRGRPKRIRLDNNQGNGTSEVETDELPRKKTTFSRTRSGRLSRPPKHMVRDYKRIMKLDGEE----SEGAYSDYHSDHEAEPRVSTNLLPGLSMKQKSSQFHCPTCGKIYLGFARMARHFDKYPDHGSSDYLKMLRNTNPEENIE.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 708
186 6.000e-24UniRef50_UPI000BBD917F zinc finger protein 839 n=2 Tax=Characoidei TaxID=1489739 RepID=UPI000BBD917F  ali  26  463............................................PKVTLSPTPVKSPVAKPAVVATPPTLILTPTRPTTAVSSPTTKVLTPPTKITTVVTKVVAPTVEKEKPKVKNRQKKPLKIKTRSGRVSRPPKHKVKDYKFIKNEDLAESHQSDSDDYSEISVEDEEGEDGKKKGADD-GLSLRKKAFKCEMCEKSYIGLAGLNRHYRIKPSHDKNQTRSSTERDSKPSEEQSGKGATKTSLVKTAST-------------------------------QKVQADSTRPIEKRRPGRPKGSGNKGTSLPKRLGRKPKRGRRGRPPKHLTAAATTEQLEQKRRNRLTEFIQQYDDEDLIEIVLPRLAKVMTVWEFVVMKVEKGQQSKQQFPSVYHEFELLHNEVKRMAEEHF-SIAPASRPALDVTNMEVLKSLGISDPPSALTHLNSTVGQPGTARPNQAVKSLRS-------IENTKMLPPAKRFKMENCVEKNSNSETVNQNGIQQEESADCSSELREPQL----VLTRLENINSDPVAGEESTDSDNKAQEERTEEEEPMDTADAPHESEDVRLQEDAQEQVSEVLTSGESVDVSDQMEQLEQALSTDAEHESGAPQETAGDLQDGNCDPPDVGSLSEVETVGEAVESQEIQPGHAEEVFIQTAEGLVRQSAEELASKGIVIVNGPDGTT....................................................................................................... 1070
187 7.000e-24UniRef50_K7EY20 Uncharacterized protein n=1 Tax=Pelodiscus sinensis TaxID=13735 RepID=K7EY20_PELSI  ali  246.QPTHTAPLHAPPPSQPTHTAPLHAPPPSQPTHTAPLHAPPPSQPTHTAPLHAPPPSQPT-HTAPLHAPPPSQPTHTAPLHAPPPSQPTHTAPLHAPPPSQPTHTAPLHAPPPSQPTHTAPLHAPPPSQPTHTAPLHAPPPSQPTHTAPLHAPPPSQPTHTAPLHAPPPSQPTHTAPLHAPPPSQPTHTAPLHAPPPSQPTHTAPLHAPPPSQPTHTAPLHAPPPSQPTHTAPLHAPPPSQPTHTAPLHAPPPSQPTHTAPLHAPPPSQPTHTAPLHAPPPSQPTHTAPLHAPPPSQPTHTAPLHPTPAFTTDPHGAPPSNPRLHNRPT...................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 572
188 8.000e-24UniRef50_L5LZY9 Zinc finger protein 839 n=1 Tax=Myotis davidii TaxID=225400 RepID=L5LZY9_MYODS  ali  48  2...................................................................................................................................................EDLADSHPSDSDDYSELSVEEEEEQGDKQALFGLPSSSLRPRAFRCQTCGKSYIGKGGLARHFKLQPGHGQPXXXXXXXXXXXXXXXXXXXXXXXXXVLSEKAKGSTARGCAEGRPRGPTSPGPSTPAPLSAEGAPSARGGPQNGQPMEGEAALVTEPADGCYSALWESERHPGPERGYAPAPAG-----QSRAARSRAGLQEVLQQCALEDLVELALPRLAQAVTVYEFLLTKVEKGHLAQPLFPAVYKEFEELHQMVKKMCQDYVRGPSPPSQEPLEIKDPEVAESLGITEEFLRKEETHTDDGSRHTCSG------REASPPKREIETAGETLTSAKRPRRAALPQEPPEA-SVCSGGQRTPAASPGGQQGFAPRVNGTACPRREEGHTAPRSVGDSSTGRASS..................................................................................................................................................................................................................................................... 398
189 1.000e-23UniRef50_A0A2A6B2C5 Uncharacterized protein (Fragment) n=1 Tax=Pristionchus pacificus TaxID=54126 RepID=A0A2A6B2C5_PRIPA  ali  8707.QPSTTTLQSTQPSTTTLQSTQPSTTTLQSTQPSTTTLQSTQPSTTTLQSTQPSTTTLQSTQPRRSLDAASTQPSTTTLQSTQPSTTTQSTQPSTTTLQSTQPSTTTLQSTQPSTTTLQPTQPSTTTLQSTQPSTTTLQSTQPSTTQPTQPSTTTLQSTQPSTTTLQSTQPSTTTLQPTQPSTTTLQSTQPSTTTLQSTQPSTTTLQSTQPSTTTLQSTQPSTTTLQSTQPSTTQPTQPSTTTLQSTQPSTHHSSVDAAVDHHSSADAAVDHHSSVDAAVDHHSSVDAAVDHPTLQSTQPSTTQPTQPSTTTLQSTQPSTTHSSVDAAVDHHSSVDAAVDHHSSVDAAVDHHSSVDAAVDTTLQPTQPSTTTLQSTQPSTTTLQSTQPRRSRRPTLQSTQPSTTTLQSTQPSTTTLQSTQPSTTTLQSTQPSTTTLQSTQPSTTTLQSTQPSTTQPTQPSTTTLQSTQPSTTTLQSTQPSTTTLQSTQPSTTTLQSTQPSTTTLQSDAAVDHHSSVDAAPSTTPADAAVDHHSSVDAAVDHHSSVDAAVDHHSSVDAAVDHHSSVDAAVDHPADAAASSTTTLQSTQPSTTTLQSTQPSTTQPTQPSTTTLQSTQPSTTTHSSVDAAVDHHSSVDAASTQPSTTTLQSTQPSTTTLQSTQPSTTTLQSTQPSTTQPTQPSTTTLQSTQPSTTTLQSTQPSTTTLQSTQPSTTTLQSTQPSNHPLFSQPTQPSTTTLQPTQPSTTTLQSTQPSTTTLQSTQAVDH................................... 9489
190 1.000e-23UniRef50_A0A0Q3M4F7 Uncharacterized protein n=3 Tax=Neognathae TaxID=8825 RepID=A0A0Q3M4F7_AMAAE  ali  27  511....................................................................................................................................................................................................................................................................................................................................................................................TVDSKAGXQVEKGYPGKAYFPDVYKEFEDLHNMVKKMAYCHLSNSNLSCQQPVEIRDAKVAESLGITEILAGQGRTQGAASCSQTIXKTVSEQPVEILGQKRLVESSEELLPSAKRTKLEDVTENVNNDNASQDEVKEKSENLCTLSEKDGFNQLNGEIQLSEDGHITCCT--TGSTLLTAEQHNSLADSGVRINAGNSVTFSQSVETRVEYSECVAIQGPDPADDESLXPGLVQAHFVSEDTAGGPSAPQLCSSV-SEDAMGSDSPNLATSEENGHHQKYQKLQEENEHSKQLHNENMTDEMQELEKALSTNIVPVNHPHSAQTELNQSRAQDSSLSAHVNXENSLKNANDFSCGAE---DQHELENTVTVDETVAFEITDESRDFFVSG.................................... 916
191 2.000e-23UniRef50_UPI00094E9B0C zinc finger protein 839 n=1 Tax=Hippocampus comes TaxID=109280 RepID=UPI00094E9B0C  ali  25  375................APIQLLLQSPAPVVGSLLPLVHKLPAAAKTPPASTAVPTVKLANVSLLKTPANGAAPSPGKTLLKQTAAPAVQASPSAAGPPAAVAPLAAKKEKARKQKKKEKKAVKVQTRSGRVSRPPKYKAKDYKFIKTEDLAESHQSDSDDYSDMSMEDEERKDGARDADASLAYSHKSRSHPCQTCDKAYIGPGGLNRHYKLNPSHGEPEPMGEAAPQTGADDGEAQTDAPEMTDETPPDAAKEEETEAKDAAMAVDKESGPAASSGGFRGVHHXXXXXXXXXXXXXXXXXXGAPAKFVQVSGSLSLMGRRGRPGRPPKLGGGMASAELQAARRRERLQELADQCEDEELMDVVLPRLTKVLSVWELLLAKVERSGPARTHFPEVYREFESLQAQVRQAAQDYIIAPQ-GGAAPLEIRNIEVARSLGILDEVNRMKVVPGASPASGVGNKSSRYMENSKMLPPSKRFKMENSVPLQNGIERAALSVGEGGGPSPASNLDLGSSAARVVSSASPVVTSASPVVTSVAPVTPTSTPCAAASSMAMPLLPSEAKPSTSPVQAPPAATAMEVTTAEPQAAEAPPPTPTPTEGPAPVPAPSEQAQEPEKLPEPEKLPETC.............................................................................................................................................................................. 995
192 3.000e-23UniRef50_UPI0004D05711 basic proline-rich protein-like n=1 Tax=Galeopterus variegatus TaxID=482537 RepID=UPI0004D05711  ali  49......................................................................................................................................................................................................................................................................................................................................................RKAPNPRPAPIPLTSIHPPDQHPSPRPAPIPLTSIHPPDQHPSPRPAPIPLTSIHPPDQHPSPRPAPIPLTSIHPPDQHPSPRPAPIPLTSIHPPDQHPSPRPAPIPLTSIHPPDQHPSPRPAPIPLTSIHPPDQHPSPRPAPIPLTSIHPPDQHPSPRPAPIPLTSIHPPDQHPSPRPAPIPLTSIHPPDQHPSPRPAPIPLTSIHPPDQHPSPRPAPIPLTSIHPPDQHPSPRPAPIPLTSIHPPDQHPSPRPAPIPLTSIHPPDQHPSPRPAPIPLTSIHPPDQHPSPRPAPIPLTSIHPPDQHPSPRPAPIPLTSIHPPDQHPSPRPAPIPLTSIHPPDQHPSPRPAPIPLTSIHPPDQHPSPRPAPIPLTSIHPPDQHPSPRPAPIPLTSIHPPDQHPSPRPAPIPLTSIHPPDQHPSPRPAPIPLTSIHPPDQHPSPRPAPIPLTS..... 500
193 4.000e-23UniRef50_A0A0L7R9P6 Uncharacterized protein (Fragment) n=1 Tax=Habropoda laboriosa TaxID=597456 RepID=A0A0L7R9P6_9HYME  ali  383...................................SSTSKATRTPSTGTSREHTQSSGSRPTTWSSKQTPTATESRGPGTRPTKPVTEASSTSKATRTPSTGTSREHTQSSGSRPTTWSSKQTPTATESRGPGTRPTKPVTEIYNSRIKLAVVNTSNNASSTSKATRTPSTGTSREHTQSSGSRPTTWSSKQTPTATESRGPGTRPTKPVTEIYNSRIKLAVVNTSNNASSTSKATRTPSTGTSREHTQSSGSRPTTWSSKQTPTATESRRPGTPPTKPVTETSTSKSKTHSASTRENTSSTSKATRTPSTGTSSEHTQSSGSRPTTWSSKQTPTSTESRGSGTPATKPVTETSTSKSKTHSVSTRENTSSTSKATRTPSTGTSREHTQSSGSRPTTWSSKQTPSATESRGPGTRPTKPVTETSTSKSKTHSTSTRENTSSTSKATRTPSTGTSREHTQSSGSRPTTWSSKQTPSATESRGPGTRPTKPVTETSTSKSKTHSTSTRENTSSTSKATRTPSTGTSREHTQSSGSRPTTWSSKQTPSATESRGPGTRPTKPVTETSTSKSKTHSTSTRENTSSTSKATRTPSTGTSREHTQSSGSRPTTWSSKQTPSATESRGPGTRPTKPVTETSTSKSKTHSTSTRENTSSTSKATRTPSTGTSREHTQSSGSRPTTWSSKQTPSATESRGPGTRPTKPVTETSTSKSKTHSTSTRENTSSTSKATRTPSTGTSREHTQSSGSRPTTWSSKQTPSATESRGPGTRPTKPVTETSTSKSKTHSTSTRENTSST....... 1155
194 5.000e-23UniRef50_A0A0Q9XMB3 Uncharacterized protein, isoform B n=2 Tax=Drosophila mojavensis TaxID=7230 RepID=A0A0Q9XMB3_DROMO  ali  140....................................................................................................................................................................................................................................................................................................................................................................................................................................................GTFCSPRDTSSPSCVSSTTPEPTTVSTTGKPTGSTTVLPPASTITQSPESSTESTTLSPPDSSTAQSPELTTTVSPPESSTAQSPEPSTTVSPPEPSTAQSPEPSTTVSPPESSTAQSPEPSTTVSPPESSTAQSPEPSTTVSPPESSTAQSPEPSTTVSPPESSTAQSPEPSTTVSPPKSSTAQSPEPTTTVSPPESSTDQSPEPSTTVSPPESSTAQSPEPTTTVSPPESSTDQSPELSTTVSPPEASTAQSPEPSTTVSPPESSTTTTVSPPESSTDQSPEPSTTVSPPESSTAQSPEPSTTVSPPESSTAQSPEPSTTVSPPESSTAQSPEPTTTVSPPESSTDQSLEPSTTVSPPE.. 506
195 5.000e-23UniRef50_A0A212CRY3 Uncharacterized protein n=5 Tax=Boreoeutheria TaxID=1437010 RepID=A0A212CRY3_CEREH  ali  54  33IQPKSARPGPPPSGRCSAVGLRSQ-----------LLGTPPGVLSHPPPPPVHVFIQRPLPALRPVPVKTVLAAEPLSGQSTAAVPPSASDLPAITSVSSSSANLFISSSQTKHAEKLKKSLKVKTRSGRISRPPKYKAKDYKFIKTEDLADGHPSDSDDYAELSVEEDEDQRGRQALFDLASCSLRPKTFKCQTCEKSYIGKGGLARHFKLHPGHGQLEPEASPSGKANGSMITGPTEGETSSLASRGPPTPALPVEEGAAPAQRGRQVTFLSVVVSPFLHAVFGFTSCVCTAAGWSERRPGPRRSGYSVVPAEPSMAVLERSGAAHPPGGAGAARSRARLQEVRR.................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 370
196 6.000e-23UniRef50_A0A1Y1KPH0 Uncharacterized protein n=1 Tax=Photinus pyralis TaxID=7054 RepID=A0A1Y1KPH0_PHOPY  ali  20  114.................................ITTDGQLLNSTQNLSPEHLQQIAQALQFTVKREEQKDILENAPPNIFYRIMYPDELNKPFPVKPVKRGRKKKQPVTEEKVDPKEVEEPPKVRTRSGRVTRPPQHIKNDFKKIDTGDSMDTDELKTFDFESPTITETPVSFQEDRLESHKRKRSISSQFRCPKCKKAYLGNNKMLQHFEKHPDHKPA.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 306
197 7.000e-23UniRef50_A0A1N7PD72 Ca2+-binding protein, RTX toxin-related n=1 Tax=Insolitispirillum peregrinum TaxID=80876 RepID=A0A1N7PD72_9PROT  ali  103...................................................................................................................................................................................................................................................................................................................................................................................VTVSQSGSAVSDASTGASAAVGETSVVEPDAAGTAAAAETPAQLASTEDPVTEAPVVELAASDATTVETAAATVLAADAVTSTEAPTTTEAPTSTEAPTTTEAPTSTEAPTSTEAPTSTEAPTSTEAPTTTEAPTSTEAPTSTEAPTTTEVPTSTEAPTSTEAPTSTEAPASTEAPTSTEAPTSTEAPTSTEAPTSTEAPTSTEAPTLTEAPTSTEAPTTTEAPTSTEAPTSTEAPTTTEAPTSTEAPTSTAPTSTEAPTTTEAPTSTEAPTSTEAPTSTEAPTTTEAPTSTEAPTSTEAPTTTEAPTSTEAPTSTEAPTSTEAPTSTEAPTTTEAPTSTEAPTSTEAPTSTEAPTTTEAPTSTEAPTTTEAPTSTEAPTSTEAPTSTEAPTSTEAPTSTEAPTSTEAPTTTEAPTSTEAPTTT.... 527
198 9.000e-23UniRef50_Q06852 Cell surface glycoprotein 1 n=1 Tax=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536  ali  10 1366..........................................................................................................................................................................................................................................................................................................................................................................................................................................IQPAPIKAASDEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPEEPIPTDTPSDEPTPSDEPTPSDEPTPSDEPTPSDEPTPSETPE.. 1744
199 1.000e-22UniRef50_D6WKM0 Uncharacterized protein n=1 Tax=Tribolium castaneum TaxID=7070 RepID=D6WKM0_TRICA  ali  20  4....NIPTTPYVVQISEPLETIHLAEQVDSQLQIAQTVSNPHILVESMDKPLEIIEEPCTSVPQEEPLGQIMYPEEQPCVVKIVYPQELSLIRAPNLVKRGRPKPQTDANTESKTDNVEASKASRTRSGRLVKLPKHIEKDFK--KFQPSVNDREVQVTDFER--VEEKENSKIEFAQLQTRKRVVK-AQFKCPKCFKAYLGKNKMIQHLKKNPDHGPLPEGYQQYNFDVWNYLFDITQK............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 241
200 1.000e-22UniRef50_A0A1A8GKX1 Zinc finger protein 839 (Fragment) n=4 Tax=Nothobranchiidae TaxID=405002 RepID=A0A1A8GKX1_9TELE  ali  19  17...................................................................................................................................................................................................................................................................................................................GLPPKVAVGHVGRPGQRGRPPKIAVIPVTTXXXXXXXXXXXXXXXXXXXXXELMDVVLPRLTKVLSLWELLLAKVESKSPTCTSFPDIYHEFESLQAQVRQAAQEYITGPQ-SGARPVEVRNIEVARSLGILDEVNKMKVVPGASPVPSLTNKNTRYMENS------------KMLPPSKRFKMENSITDE----------QKGSAPLTTVSVTSATPGNAPLKPCLVSVSPLVIPGGSKLLTTSADLSSSLSGAPSAPAPATSNPVPVPVVPTEVHKDTGHDVPVQMTGLETSPCSSSKTNTAESSLGQTAGSVEQQQSDSPESGSNTTEPSEAKELQEGQEIYIETEQLTVQLAEPGSDGIVIVNGP........................................................................................................................... 366
201 2.000e-22UniRef50_UPI000B90D458 uncharacterized protein LOC110979277 n=1 Tax=Acanthaster planci TaxID=133434 RepID=UPI000B90D458  ali  16  380..PMTLTIRTPPGAPAVNQALINSIVNNAEVQALLKRNPQPITIVRVPEDPSEKRQHLPGMVTAKVLTNRSPGGGVPHRQIGRPRKEPGTDEDAKGFPVRRRGRQPGTKIRRKEEDYVPPPVKSRTRSGRLSRPPGYRTENFKMLYPLERPDNPSSDAEGGSDMEADS--------GSSVAFTPSGRVKNFKCRSCSKAYIGRGGLARHFLVEPTHGNIDDYALSEGSGAKLDGSTAGDVQNTSNELADSEINNKDVAEESAESPQSLAKDEGEHSRLLKEDVMDLDEEPVTDKATGEPAEEPPPEQPSRGRRGRPPNANKDDPDFRPGTSANKGSVKSKD-KRKETMRQALKFLNQEDYMDVCLPRMARHLSPWDFLVSKAEILKEDTPQVLKVLQLFEELLSDVREMAVNCLEKVEDEDEEMGGLEDDDLARVLEFDKGWYKVSAPPAGAAELPFSVSSLLKRTAEAISKDDFTDEDATPVKLRKPEEPDMTNNTVQNQVSSQVKSTPKPGPTSDPKSITVHVHNGKVTTEQGSPSIAALRAPLRETVPLSSTDRRLASAENTTDQQ------QTDSEKLPSSTTLVPNQTSNSVIRRDPPPLALLALEQQPLAPVVLEQQPLNPTDPRKQSAVATEDSPAKEQIAGNGGLPQAQTRSPMA---LGSPVDAEASPPQDTSAGSAGEQSLAWEGEGQPTSSDGGTQFVHVAEELESLASTVNQSDMKVDPTDTVHQQETSVVVPESTIMQMQDGTFLVQKPDGTAMQIHTPEGMTIETVQELLSMEAG.......... 1163
202 2.000e-22UniRef50_H0ZRE9 Uncharacterized protein n=2 Tax=Neognathae TaxID=8825 RepID=H0ZRE9_TAEGU  ali  53  87IQSKTITLSQPVGRKSSIPGAGIINPQLIRIQPVSGTEQQQLLLHSSSESPLQLLMQRPLPSHGSVSVDKIPPSKMVNGQRAACATASASRSPNPTMAAASSAS-TPCLEKKQKDDKLKKSLKVKTRSGRISRPPKYKAKDYKFIKMEDLADGHQSDSDDYSELSIEDDEEGKGKDALFSSSNYNLKPKTFKCQTCEKSYIGKGGLARHYKLNPDHGQLEP.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 308
203 2.000e-22UniRef50_E0VM30 uncharacterized protein n=1 Tax=Pediculus humanus subsp. corporis TaxID=121224 RepID=E0VM30_PEDHC  ali  22  701.............................................GSSENPIQLVQTGHTPKTNTRIVYRVVYPEDVELKGAVKPASEGISKKEEEPRGPGRPKKSVTSSDEEMDDSLPKKKIPRTRSGRLSRPPRYMVKDYKQLPNSDTVEKGNCDVKSEDIYSFNDKPDNVQDLQLENNLLPGLRPRQYRCPTCQKIYLGHTRMMWHLNKFPDHCNVE................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 918
204 3.000e-22UniRef50_A0A195D738 Collagen alpha-2(IV) chain n=15 Tax=Formicidae TaxID=36668 RepID=A0A195D738_9HYME  ali  141.......PPNEGSHPGIPGHLGTPGTPGTPSYPGHPGIPGHSGTPGTPGKPGTPSYPGHSSIPGHPGTPGKPGTPSYPGYPGIPGHXXXXXXXXXXXXXSYPGHPGIPGHPGTPGTPGTPSYPGHPGPGHPGTPGTPGKPGTPSYPGHPGIPGHPGTPGRPGTPSHPGYPSIPGHXXXXXXXXXXXXXSHPGHPGIPGHPGTPGTPGTPSHPGHPGIPGHPGTPDTPGTPGTPSHPGHPGIPGHPGTPGTPGTPSHPGHSGIPGHPGTPGTPGTPSHPGHPGIPGHPGTPGTPGTPSYPEHPGIPGHPGIPGHPGTPGTPETPSYPGHPGIPEHPGTPGTPGKPGRPSYPGHPGIPGHPGTPGTPGKPGRPSYPGHPGIPGHPGIPGTPGRPGTPSYPGHSGIPGHPGIPGTPGRPGTPSYPGHPGIPGHPGTPGTPGTPSHPGHPGIPGHPGIPGTPGRPGTPSYPGHPGIPGHPGTPGTPGTPSHPGHPGIPGHPGIPGTPGRPGTPSYPGHPGIPGHPGTPGTPGRPGTPSYPGYPEISGHPGTPGTPGTPSYPEYPGIPEHPGTPGTPGKPDTPSHPGHPGIPGHPGTPGTPGKPGAPSYPGHPGVPGHPGTPGTPGTPSHSGHPGIPGHPGIPGTPVRPETPSYPGHPGIPGHPGIPGTPEIPSYPGHPGTPGYPGIPGTPGTPSYPGHPGTPGTPTPSYPGYPEISGHPETPGKPGRPGTPSYPGHQGIPGHPGTPGTPGKPGTPSYPGHPGIPGHPGTPGRPGTPSPSIPGHPGTPGTP............. 928
205 3.000e-22UniRef50_UPI0007F86B39 zinc finger protein 839 n=1 Tax=Kryptolebias marmoratus TaxID=37003 RepID=UPI0007F86B39  ali  23  288...KLTGQATLAGATSSPAPKPASSSIRVPAASPVKVSNNKTPPPAASKTISVPLISLPCNGMDTSPSKSPVKPPAVPVQPSSAAATPQ----AVKVSTPSAVRERDREKERKVKKKEKKAVKVQTRSGRVSRPPKYKAKDYKFIKTEDLADSHQSDSDDYSDMSEEEEQKNNPGSSGTSTLTYSHKSRCHHCQTCDKSYIGPGGLNRHYKLNPTHAEPPLSGSAPTALKDEDRLEATAAGQEADETDKLPVAATNTAERVPAASGLRGLRNXXXXXXXXXXXXXXXXX-----------------XXFLGPGTAGFGSRPAHRGRHQRSGGVPLTADQQGKRRRDRLQELVEQCEAEELTDVVLPRLTKVLSLWELLLAKVDCRSPTCASFPDIYQEFESLQAHVRQAAQEYITGPQ-SGDKPVEVRNIEVARSLGILDEVNRMKVVPGASPASNLTNKNVRYM------------GNSKMLPPSKRFKMENSITDEQTGGGVTVSSVSPLKPCS-------------------------VSVSPLVISGGSKLQTTSADSTWSPSGADSAQTASSQASPLATPMEVQEEGSISSDRDADAADQTTGL---QSALGSGSESTAKTSESSLNQAAASSEPRQGDAPQSEPCEAKELQEGQEIYIQAEQLTVQLAEPGSDGIVIVNGPDGTTMHIQTPEGVPLEAVQALLGIEASDGDKASP.............................................................................. 948
206 3.000e-22UniRef50_UPI0003F06E4C zinc finger protein 839 n=2 Tax=Afrotheria TaxID=311790 RepID=UPI0003F06E4C  ali  25  229IQPRTSQPCSLSTRSPSLLGPGITGPQPLRIQPL----PLQSHLSGPPQPPAQVFVRGPQPTLSPGSAKGAAACQARSGRRTSPAPSPVSDPPALTSVSPSSANGLLSVLNTQHPEKLRRSLEVKTRSGRISRPPKYKAKDYRFIKTEDLADGHLSDSDDYSELSVEEDEDERGKRALFDSTSCPLRPKTFKCETCEKSYIGKGGLARHFRLNPGHGHGPLEPAALMSERASGHVPQGCTGDRTASPGSPEPSVAILREEGVLAPCASEAETTEGRLQQSDQEDRVAPALSQLTPVVTVYEFLLMKVEQNHLAKPLFPAVYKEFEELHKMVKKMCQEYLSSSGPCSLEPLEISNSKVAESLGITEEFLRKRDTDTSGLSGRRACREADGVQPAEEAGGQKRGREAPEEALASEKRTRREPVPQDDTEPPTAPSRAQEEPRTACDPIDTGGRGPQVTRLPSQHRNEGHPAAGPLGGHSGLPAGQQPRTFAEGDAFGGDVGSSLALPSHSAQDTGEHSDLCSGLVSTGGPASLLPGGAGNAAVRAQGGACASHTDGW-QPVPSTVTLTGVAAPKLETTLFPEAVLVDCTPRTASEPGPQPGPHGSQTTARDLTSHTGAPSEPSRAEEWAEQTELETT.................................................................................................................................................................... 858
207 3.000e-22UniRef50_T1HT38 Uncharacterized protein (Fragment) (Fragment) n=1 Tax=Rhodnius prolixus TaxID=13249 RepID=T1HT38_RHOPR  ali  22  343VQPKKVQLLTVPQGSQDAKKI-VSVPNDKSGKKLTPSQLMQIVLQKNRLNRQSSLSNASTLETNTRIICRVLYPED-------FKPEVEKTPVVTNVKKRGRPNKKEQVEVGAKEEKSEKRVPARTRSGRVTRPPRHMVEDYKRLKGDD-------SDGTYSDYQSGTDENIENSPAVNLLPGLNLHQKRFRCPTCNKIYLGRVRMALHFTKYPDHCDSKQLELLKESAATREDFESGEG............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 585
208 5.000e-22UniRef50_UPI00084BB338 proline-rich extensin-like protein EPR1 n=1 Tax=Hyalella azteca TaxID=294128 RepID=UPI00084BB338  ali  293....TPPIHPTSSLAQFTPPVHPTNSPHQFTPPVHPTSSSHTPPVHPTSSPHQFISPVHPTSSPHQFTPPIHPTSSLAQFTPPVHPTNSPHQFTPPVHPTSSSHQFTPPVHPTSSPHQFISPVHPTSSPHQFTPPIHPTTPPVHPTNSPHQFTPPVHPTSSSHQFTPPVHPTSSPHQFISPVHPTSSPHQFTPPIHPTSSLAQFTPPVHPTNSPHQFTPPVHPTSSSHQFTPPVHPTSSPHQFISPVHPTSSPHQFTPPIHPTSSLAQFTPPVHPTNSPHQFTPPVHPTSSSHQFTPPVHPTSSPHQFISPVHPTSSPHQFTPPIHPTSSLAQFTPPVHPTNSPHQFTPPVHPTSSSHQFTPPVHPTSSPHQFISPVHPTSSPHQFTPPIHPTSSLAQFTPPVHPTNSPHQFTPPVHPTSSSHQFTPPVHPTSSPDXHMHHPIALLQCPNPLTCS........................................................................................................................................................................................................................................................................................................................................................ 751
209 5.000e-22UniRef50_UPI000BA7EC93 uncharacterized protein LOC106461199 n=1 Tax=Limulus polyphemus TaxID=6850 RepID=UPI000BA7EC93  ali  17  518.............................................GSSENPIQIIQQGNTYHSTQVLTQEQLQQIAHVLQQQQISKASESGGSSVNPATNTRIIYRVIYPSEFQEKSNSNSKDVSIRGGRVGI--KRGRGRPRKIWNIKKTQDEPDDETQSQEISREEKE-LKKKHRPRTRSGRISKPPSYMVQDYKRIH--------HLDFNEDPHDDTDGGYSDFQMSDEDPENINHGPKYLSPGANTV---RPRNHKCTSCDKAYIGQGGLARH--------YRQYPSHGSLPDTEEN----------SVYDDEYSNTSAISNSTTPSGQTTSVTDTTISEK--LDPVLRHCTDEDLLEIVLPRLIRVISLWEFLLKKFQNEDNGELDIVEMFDQLTVLITYVRTLAQDCLKPSTENSNSSVKVHSEELAQLLGVSVGVYQTKPWKNP-----HQTETSLENPSFTSDQQCTKHFDDAS---------SSVLHNSSDAVLSDSRDFVNSKQDSALSSCLLLPES-----NSNNSITVCASELNTSVSLTGCQSANTPVSEQSTTDIFQLVESNASRPPHKKPRLGELTGLSKSVTGVCS..................................................................................................................................................................................................... 1029
210 6.000e-22UniRef50_UPI0009B3E327 proteoglycan 4-like n=1 Tax=Monopterus albus TaxID=43700 RepID=UPI0009B3E327  ali  632..PKSPAPTSTDLKSPASTAPKSPAPTSTDLKSPASTAPKSPAPTSTDLKSPASTAPKSPAPTSTDLKSPASTAPKSPAPTSTDLKSPASTAPKSPAPTSTDLKSPASTAPKSPAPTSTDLKSPASTAPKSPAPTSTDLKSPASTAPKSPAPTSTDLKSPASTAPKSPAPTSTDLKSPASTAPKSPAPTSTDLKSPASTAPKSPAPTSTDLKSPASTAPKSPAPTSTDLKSPASTAPKSPAPTSTDLKSPASTAQKSPTPTSTDLKSAAPVTPASTATVPKSAALTATDPKSPALVTLASTIADPKSPAPTTTDPKSPAPVTPASTTADPKSAAPTATARKSAAPTATARKSAAPTATDPKSPALVTLASTIADPKSPAPTTTDPKSPAPVTPASTTPKSPASTPQKSPAPTSTDLKSPAPVTPALTAADPKSPAFTSAAQKSPAPTATAPKSAAPVTPDLTSTVPKSTTPLTPTPASTVSKSTDPVTPALSSSVPKSPNLVTPATLSTDLNSPAPVSGLTATT................................................................................................................................................................................................................................................................................... 1155
211 6.000e-22UniRef50_UPI000B45A64D adhesive plaque matrix protein-like n=1 Tax=Mizuhopecten yessoensis TaxID=6573 RepID=UPI000B45A64D  ali  4......................................................................................................................................................................................................................................................................................................................................................................................................................KSVCSQHKISPPPYQSPTSQPSSYQSYTSQPFPYQSPTSQPSSYQSHTSQPSPYQSHTSQPSPYQSHTSQPSPYQSHTSQPSPYQSHTSQPSPYQSHTSQPSPYQSHTSQPSPYQSHTSQPSPYQSHTSQPSPYQSHTSQPSPYQSHTSQPSPYQSHTSQPSPYQSHTSQPSPYQSHTSQPSPYQSHTSQPSPYQSHTSQPSPYQSHTSQPSPYQSHTSQPSPYQSHTSQPSPYQSHTSQPSPYQSHTSQPSPYQSHTSQPSPYQSHTSQPSPYQSHTSQPSPYQSHTSQPSPYQSHTSQPSPYQSHTSQPSPYQSHTSQPSPYQSHTSQPSPYQSHTSQPSPYQSHTSQPSPYQSHTSQPSPYQSHTSQPSPYQSHTSQPSP.......... 386
212 6.000e-22UniRef50_W5KZW0 Rearranged L-myc fusion n=4 Tax=Otomorpha TaxID=186634 RepID=W5KZW0_ASTMX  ali  15  800IQHKS--PCEPPSQDSCQEKVLLSSADSLRCESASSAKSDLGALTEIVLGLSQLSLNSAIPHSSGSKVSQVTSPTASNVRSPAKATSSKSEVGSQQPPPDSKAPLWTAELPHKAESSTRQKLALTTRDGNFDKTPTES-----NLGFPDISKPYICDVDGYQSVTSNTKHGFSKKDVKQKEIFNPLKFRPFKCQLCTKGYKERKELKAHYRLKHNEHIADIKQVNSSLKRKIDDVPPPAVETTTKLAIKQSSASSKAREVPEEKKKDVSTWKDGPLNKERKIVWVGKMEKSEKISMEEKRKNGPEGESTEDGATQERRASQRLVTKGSKC..................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 1140
213 8.000e-22UniRef50_UPI000623CBDA extensin n=1 Tax=Bombus impatiens TaxID=132113 RepID=UPI000623CBDA  ali  72.............................................................................................................................................................................................................................................................................................................................................................................................................................WPSEHAECKHHHSRPPHSSTARSTVTSRPSRPTGSGEYSPSQRSLSTDEPFRPTHPTKQTHPSRPTTEPSRPPKPPHPTRPSHPPRPPHPTKPSHPSRPTDSTEPSRPPRPPHPTRPSHPPRPTPSVSPRPSRRPNPDFPPHRPGNKPHDRPLPPHHPPPSRSTAPPTQSTTPPSRSTAPPSRSTAPPTQSTTPPSRSTAPPSRSTAPPTQSTTPPSRSTAPPSRSTAPPTQSTTPPSRSTAPPSRSTAPPTQSTTPPSRSTAPPSRSTAPPTQSTTPPSRSTAPPSRSTAPPTQSTTPPSRSTAPPSRSTAPPTQSTTPPSRSTAPPSRSTAPPTQSTTPPSRSTAPPSSTAPPTQSTTPPSRSTAPPSRSTAPPTQSTTPP... 455
214 1.000e-21UniRef50_S8A0L6 Uncharacterized protein n=1 Tax=Dactylellina haptotyla (strain CBS 200.50) TaxID=1284197 RepID=S8A0L6_DACHA  ali  42.......................................................................................................................................................................................................................................................................................................................................................SDDGYYGEDGYGDDGYGGDSSSTPPMDSTSVPPDSPSSTAPPDTTTTPTDGASSTSTGDMSTTSEPPTDTNSSVPPGDSSVVTPTDETSTTSPGVDTTPVPPGDSSTVPPSDVTTTSPTDGISSTDVPTTSPTDVPPGDTSTAPPEDSSTEPPSDSSTVPPDGPSTTSPTSSTAPPDDSSTAPPPDDSSTMPPSDSSTVPPSDSSTAPPDDMSSTTTPAYDSSSTAPPGDSSTMPPDGSSTEPPSDSSTVPPDGVSSTTTPPDESTSTAPPGDSSTAPPEDSSTSPPDGSSTEPPSDSSTAPPDGPSTTSPGDDTSSTTPPDSSAVTPSSTTPYGTSTTPPDDTSSTTESAYGSSSTEPPSDSSTAPPPEDSTTAPPPDESSTAPPSDSTTAPPPDESSTAPPSDSTTAPPPDESSTAPPSDSTTAPPPEDSSTAPPPDESSTAPPSDSSTAPP.. 501
215 1.000e-21UniRef50_UPI000C204797 pollen-specific leucine-rich repeat extensin-like protein 1 n=1 Tax=Cucurbita moschata TaxID=3662 RepID=UPI000C204797  ali  365...............................................................................................................................................................................................................................................................................................................PERPKQKAAEACAPVTSKSVDCSKAMCGGGAPSPSSMPWPWKSHSPHTPQTPVRVHHPLSPPSLHSQPPTPSSPQPPVHSHTPSASSPVDSHTPSASSPEAPVDSHTPSASSPEAPVDSHTPAAPSPGATVESETPAAPSPEATVESETPAAPSPGATVESETPAAPSPGATVESETPAAPSPGATVESETPAAPSPGATVESHSPAAPSPGATVESETPAAPSPGATVESETPAAPSPGPSPEATVESETPAAPSPEATVESETPAAPSPEATVDSETPAAPSPEAPVTPSPEAPVAPSPEAPATPSPEATVDSETPAAPSPEAPLTQSPEAPLTQSPEAPVAPSPEAPVAPSPEAPATPSPEATATPSPEATVDSETPAAPSPEAPLTPSPEAPATPSPEAPIDSEAPVAASPEAPVVASPEAPIDSEAPVAASPESSVAASPESSVAASPESPVAASPESPVAASPESPVAASPESPVAASPESPVAASPE.. 858
216 2.000e-21UniRef50_UPI000A1CF93C mucin-19 isoform X3 n=1 Tax=Drosophila serrata TaxID=7274 RepID=UPI000A1CF93C  ali  517..QETTTIEDSTTADDETTTPGEDPSTAAPDTSTAIPDESTTATPETTTIEDSTTADGETTTPGEDPSTAAPETTTASPDESSAAPDTTTAIPDESTTAPSETTTIEDSTTADGETTTPGENPSTAAPDTSTAIPDESTTAPSETTTTEDSTTADGETTTPGEDPSTAAPETTTASPDESSAAPDTTTAIPDESTTAPSETTTIEDSTTADGETTTPGEDPSTSAPETTTAIPDESTTAPSDTTTIEDSTTADDETTTPGPSTSAPDTTTAIPDESSAAPDTSTAIPDESTTATPETTTIEDSTTADGETTTPGEDPSTAAPETTTVIPDESTTASQDSTTAAPETTTVEDSTTADDETTTPGEDPSTAAPETTTASPDESSAAPDTTTAIPDESTTAPSETTTIEDSTTADGETTTPGENPSTAAPDTSTAIPDESTTAPSETTTTEDSTTADGETTTPGEDPSTAAPETTTASPDESSAAPDTTTAIPDESTTAPSETTTVEDSTTAHDETTTPGEDPSTAAPETTTASPDESSAAPDTTTAIPDESTTAAPETTTVEDSTTAHDETTTPGEDPSTAAPETTTASPDESSAAPDTTTAIPDESTTAAPETTTVEDSTTAHDETTTPGEDPSTAAPETTTASPDEXXXXXXXXXXXXVPEETTTTSQDPSTEPSKTTDSTTTEITSTVPEKSTTADQDSTTNGSDETVPVTSTSVLPESSTEASSSSEWSSSPAVSTSTAXXXXXXXXXXXXXXXXATTDSTLPPLSCNSGYPYLPHPT................... 1296
217 2.000e-21UniRef50_A0A0W8D5Y2 Uncharacterized protein n=4 Tax=Phytophthora TaxID=4783 RepID=A0A0W8D5Y2_PHYNI  ali  155..............................................................................................................................................................................................................................................................................................................................................................................................ERPTAAPTEAATVAPTPAPEPSTAPPTAAPTTQAPVPETTAPITPEPTTEAPVPETTAPPIQQPTTSAPTTPEPTTPCXXXXXXXXXXXXXXXCPTTTEPDTPEPTPPLPTTPCPSTTEPATPCPSTTEPATPCPSTTEPATPCPSTTEPATPCPSTTEPATPCPSTTEPATPCPSTTEPATPCPSTTEPATPCPSTTEPATPCPSTTEPATPCPSTTEPATPCPSTTEPATPCPSTTEPATPCPSTTEPATPCPSTTEPATPCPSTTEPATPCPSTTEPATPCPSTTEPATPCPSTTEPATPCPSTTEPATPCPSTTEPATPCPSTTEPATPCPSTTEPATPCPSTTEPATPCPSTTEPATPCPSTTEPATPCPSTTEPATPCPSTTEPATPCPSTTEPATPCPSTTEPVT..... 593
218 2.000e-21UniRef50_UPI000BBDEE6B extensin-like n=1 Tax=Astyanax mexicanus TaxID=7994 RepID=UPI000BBDEE6B  ali  24................................................................................................................................................................................................................HTVILTSTQPTPQLPGPPHFSSAFSTPPQAYPAIPPPSHFCPAFSTPPYTLPALSIRPHSNSSHPAFSTPPRAYPAFSTPPHIYPAFSTLLPTPNLPVPQFPTPTQPFL--LLPSPTQLSPHYSPLLPKPSPHLQSPTQLFSTPPHIYPAFLHTSPGLPSLLHNSPAYPAISTPPRAYPAYSTTPRAYPAFSTPPKSYPAFSTPPQAYPAISPPPHFSSAFSTPPKSYPAFSTPPHSSRAFSTPPHSYPAISTPPQAYPAFSTPPNFSPHLPGPTQPTPQLPGPTQPTPQLPGPTQPTPQLPGPTQPTPQLPGPPHFSSAFSTPPKSYPAFSTPPHSSRAFSTIPHSNPALSTPPQSHPSPSPSQLSPHLPTFTQLSPHLPGPTQPTPQLPGPTQPTPQLPGPTQPTPQLPGPTQPTPQLPGPPHFSSAFSTPPKSYPAFSTPPHSSSTPPHSSPAFSTPPKSYPAFSTPPHIYPAFSTPSRAYPAYSTTPRAYPAYSTTPRAYPAFSTPPHSSRAFSTPPHSSPLLLSLLHTSKSHSAFSTPPHSYPAILHTSPRLPSHLHTSPLLPSHLHTSPL............... 602
219 2.000e-21UniRef50_L9JA16 Zinc finger protein 839 n=1 Tax=Tupaia chinensis TaxID=246437 RepID=L9JA16_TUPCH  ali  34  7VQPQTARPCLPP-RASSLEGLGVASPQLLRVQPLVRAGQQ---------PPAQVFVQRPLPALQPVPGKRVPGPPAQNGQGAGLMPSSASDPSAMAPVSASPPNVVTSNLLTKHTEKLKKSLKVKTRSGRISRPPKYKAKDYKFIKTEDLADGHPSDSDDYSELSVEEEEEQREKQAPFDFPSGLLRPKAFGCAACGKAYIGKGGLARHFKLNPGHGQLDASASVGPASQAPSLPATTPEEGDLPCRAPGTEPAPGSLQFLQQCHPEDLVELALPQLAQAVTMYEFLLMKVAESLGITEKLLRAKGIHTKCTPPPEGTSPEEXXXXXXXXXXXXXXXXXXXXXRRGALPKDTSGSLAADSRGREKPRPSSAPAASDGLSMNASPHSEESHALLVSDGDSHTLYAGQQLKAFADLEARSGSAGPVPSTRSGAPSRLSPAQRAGFPRENALEHSSDQDSVDSVSLGDCGALSPGGGAESLLHGVSAKEAGDPCRMHGSHLDHLQPSPCNTPRTEIVASPLQEVVSVDIVPTDYAHRTVSQPGPQPGPEGLATELGLRSQVGA............................................................................................................................................................................................................................................... 562
220 3.000e-21UniRef50_E0VCT4 uncharacterized protein n=5 Tax=Neoptera TaxID=33340 RepID=E0VCT4_PEDHC  ali  266...............................................................................................................................................................................................................................................................STQITDKTCFPGSTDPKCQKQPRPTQPPAPQCFPGSTDPRCPKQPRPTQPPAPQCFPGSTDPRCPKQPRPTQPPAPQCFPGSTDPRCPSQPRPTQPPAPQCFPGSTDPRCPSQPRPTQPPAPHTKGPEYLPPATTKPSTDPRCPQTTTRPFPIVTVKPVTPTRPPAPQCFPGSTDPRCPSQPKPTQPPAPQCFPGSTDPRCPSQPRPTQPPAPQCYSGSTDPRCPKQPRPTQPPAPQCFPGSTDPRCPSQPRPTQPPAPQCFPGSTDPRCPKQPRPTQPPAPPGSTDPRCPKIGSTKGPEYLPPATTKPQCYPGSTDPRCPQTTTRPFPIVTVKPVTPTRPPPPQCFQGSTDPRCPSQPRPTQPPAPQCFPGSTDPRCPSQPRPTQPPAPPGSTDPRCPKQPRPTQPPAPQCFPGSTDPRCPSQPRPTQPPAPQCFPGSTDTRCPKQPRPTQPPAPQCFPGSTDPRCPSQPRPTQPPAPQCFPGSTDPRCPKQPRPTQPPAPQCFPGSTDPRCPSQPRPTQPPAPQ.................. 802
221 3.000e-21UniRef50_V5GJK6 Zinc finger protein (Fragment) n=1 Tax=Anoplophora glabripennis TaxID=217634 RepID=V5GJK6_ANOGL  ali  33  3........................................................................................................................KPVPRTRSGRVVKFPKYIEKDFKKMETEDYSEEHDVKTTEFERF--EEDNKQVKKTNEIQLEFHQRKRKQYRCPKCKKAYLGKSKMIQHIKKYPDHGPIP................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 106
222 3.000e-21UniRef50_UPI00083C68DA uncharacterized protein LOC108568953 isoform X1 n=2 Tax=Nicrophorus vespilloides TaxID=110193 RepID=UPI00083C68DA  ali  22  95...............................................................................QPEDLNLKPNIAVPPLVSLPRGRPRKKVEENVEPKPLTVPKIVKTRTRSGRITRPPMHMEKDYEKIIVSDLGEHKDLSTVEFDTCPPPTKENTTNPKTSKEAKRKRLIPAQYRCTYCHKAYLGRNRIMQHLNRHPEHETL.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 244
223 4.000e-21UniRef50_UPI000CEAB1CC proline-rich protein 36-like n=1 Tax=Salvelinus alpinus TaxID=8036 RepID=UPI000CEAB1CC  ali  10  1..................................................................................................................................................................................PSLSPQRRPARAQASVPSPCRARPQSPPCQEPRPQSLTLQSPGLSPSPCRAPGLSPSPCQSPGLSPSPARVQASVLTLPEPRPQSLTLPESRPQSLTARARPQSPPARVQASVPHPARVQASVPHPAESQASVPHPARVQASVPTLPESRPQSSPCQSQAQSPTLPESRPQSLTCQSPGLSPPPCQSPGLSPHPARAQASVPHPARVPGLSPPPAESRPQSLTCQSPGLSPHPARVQASVPHPARVQASVPQPESRSQSLTLPDQASVPHLPESRPQSITLPESRPQSPPARVQASVPHSARVQAFSPPPCQSPGLSPSLCRDQASVPHPAKSPSLSPSPPESKPQSITLQSPGLSPPPCQSPGLSPPPCQSQASVPHPADPGL-SPSPCQSPGLSPSPARVQASVPHPARVQASVPTLPESRPQSLTLPESRPQSLTLPESRPQSLTLPESRPQSLTLPESRPQSPTLPEPRPQSPTLPESRPQSLTLPESRPQSLHPARVQASVPSLPESGLSPSLCQSPASVPHLPESRPQSPLCQRPGLSPSPCQSPASVPHPARAQASVPPPCQSPGLSPSPCQSPGLSPHPARAQASVLTLPESRPQSHHLPESRPQSPTLPESR 620
224 4.000e-21UniRef50_A0A096MEC5 Uncharacterized protein n=1 Tax=Poecilia formosa TaxID=48698 RepID=A0A096MEC5_POEFO  ali  38  83LQQKTVAISHPQVKLSASSGLG--NAQIIHLQSVVGQQGQQILLQNPGEPQIQLVLQNATPVVGSLLP---LVHKVTGPATIATASSSLGQKPAPPTVRLAAATP--VKDPPPPSSKPPAALKVQTRSGRVSRPPKYKAKDYKFIKTEDLAESHQSDSDDYSDMSVEEEENAKRDSSSPSSLSYSLKSRCHRCQTCDKAYIGPGGLNRHYKLNPTHGEP.................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 298
225 4.000e-21UniRef50_A0A096M206 Uncharacterized protein n=1 Tax=Poecilia formosa TaxID=48698 RepID=A0A096M206_POEFO  ali  58  1........................................................................................................................ALKVQTRSGRVSRPPKYKAKDYKFIKTEDLAESHQSDSDDYSDMSVEEEENAKRDSSSPSSLSYSLKSRCHRCQTCDKAYIGPGGLNRHYKLNPTHGEPDLTGVTASGAPEP....................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 115
226 5.000e-21UniRef50_A0A0V0J1M2 Uncharacterized protein n=1 Tax=Schistocephalus solidus TaxID=70667 RepID=A0A0V0J1M2_SCHSO  ali  18  311.................................................................................................................................................................................................................................................................................................................KKSFSSRAGLARHKSLKHNPNGIKPAGPWSNPYFAAVRRRKKLKEALEKATNEDLIEFAAPRVAKVMSLWDYMLIRTEDGDPPLPYVPKLLIEFMSLVERVRSFLADQLEPC-------------------------RSTKRSSTPSSPAVVTERGKDTPIDDHEEFLSGRPA--PASVKRRRQEQRRLRDQQLQRVSPLEEAPQRLAEDLANAPDSLLPASISASPQPALTDSSALNTTECKVPQSDQEERAASKFGQFEQGALGSLSTTTAPNPTLSSSQGSSDTLIPAPLAITGTRMTVENVNMNQTPSSPSASTINQSLPQREGLSSYAPS............................................................................................................................................................... 620
227 6.000e-21UniRef50_UPI000CDF62BB proline-rich extensin-like protein EPR1 n=1 Tax=Salvelinus alpinus TaxID=8036 RepID=UPI000CDF62BB  ali  463.RSPTLQLPYIPAPLTPSSPTLQLPYSPAPLVSSPQLPASLLSSSPTSRSPVTQLPNSPDPLLSSSPSFQSPTLSTAPPTLLTPPSPAPPLSGSPTPRLPPTLRLPHFPHSPAPPLSAAPPLLPRLPLISSSPYPQLSNSQLPPLQLPSSPYTQPSAPLLPSSPVPQLPLHSSSPYPQLPYSPAPLFPSSPILSSPTLQIPYSPGSPTFQLPLPPVPSTLPAPLLSSSPSFQSQPPASYSSSSPTLPLPCYPAPPTLLTPYSPAPLVSSPQPPSVPTLQLPYSPAPLLPSSPTLLTPHSPSPLSAPTPSLPASPPLSGSPHSPASPTLPAVPHSPVLPLSGSPTPAPHSPAPPLPGSPYLQLPLSSALQLPSSPAPLLPSSPYTQPSDGQPPYSPAPLFSSSPYPKLPNSPDPLLSSSSSLHSPTLQIPLLSSIPLSPSTLIIPSFPYSQPPSIPRPPPTLRSPTLQSPTLRLPILSCAPATSPAPLTLRLPYSPAPLLPSSLLLPAPLMPQLPYIPAHLILKLPNSPDPLLSSSPTFSSPYPQSPTLQLPYSPAPLVSSPQSQRPYSPAPLLSRSPVTQLPNSPDPSSSPSFQSPGLPAPQLSLTPHSRLPHSPGSPLPAPPLSGSPILSPTLRLPLHSPAPPLSRFPLSPAPLILSSPTLQLPTLQLPSSPYTQPSGPHS..................................................................................................................... 1145
228 6.000e-21UniRef50_UPI00099FDE55 extensin-like n=1 Tax=Oncorhynchus kisutch TaxID=8019 RepID=UPI00099FDE55  ali  1..................................................................................................................................................................................................................................................................................................................................................................................................................PNTATAPPHSHSPSTQTTAQHTVPAHSPSTQPTSHSTQSQPTAHSTRPSPQPQHTPQPTAPPHSPQAHHIATAHSPTTQPTAQPHSPQPTAQRHSPQPHHQPHAHRPTTAHSPQAHHTAHSRQPHHTAHSPTTQPQPKAPPHSPAPPYSPQPHHTAHSPQPPPHSPQPTTQPQPTAHSPTTQPTAPHNSPQPTAPPTAHSPTTHTAHSPQPTAPPHSPSRQPHHTAHSHSHSPQPRAPRHSPHPTTQPKSTVPAHSPPTAPPHSPQPTAPTTQPTATAHSPTTQHHAPPTTQPTAPPHTPTAHSPQPTTTQPTAHHTAHSPQSQPTAPPHSPTTQPTADSPTTSPQPTPPAH-SPQPHSTAHSPPHSHSPQPHHTATAPHTQPTAHSPTT....... 389
229 6.000e-21UniRef50_A0A1B8Y6U1 Uncharacterized protein n=1 Tax=Xenopus tropicalis TaxID=8364 RepID=A0A1B8Y6U1_XENTR  ali  205.KPEPTDKPEPTEKPEPTEKPEPTEKPEPTEKPEPTEKPEPTEKPEPTEKPEPTEKPEPTDKPEPTDKPEPTEKPEPTEKPEPTEKPEPTEKPEPTDKPEPTEKPEPTEKPEPTEKPEPTEKPEPTEKPEQTEKPEPTDKPEPTHKPEPTDKPEPTDKPEPTD-KPEPTDKPEPTDKPEPTEKPEPTEKPEPTDKPEPTDKPEPTDKPEPTDKPEPTEKPEPSDKPEPTDKPESTEKPEPTEKPEPTDKPEPTDKPEPTEKPEPTDKPEPTEKPEPTEKPEPTDKPEPTEKPEPTDKPDPTEKPEPTEKPEPTEKPEPTDKPEPTDKPEPTEKPEPTDKPDPTEKPEPTDKPEPTDKPEPTEKPEPTDKPEPTDKPEATDKPEATDKPEPTDKPEPTDKPENLQTSPVTEQTAHPPTTTKKPNVPQIKCENGGTPTGDTCLCTSH.................................................................................................................................................................................................................................................................................................................................................................. 647
230 8.000e-21UniRef50_UPI00063C6CEB uncharacterized protein LOC105759296 n=1 Tax=Taeniopygia guttata TaxID=59729 RepID=UPI00063C6CEB  ali  39  1......................................................................................................................................................................................................................................................................................................................MGGRSRGSGRPSRPGQSPSKSLSSVSAEHNVFRRKARLKELIQQCDNEDLMELALPRLTKLVTVYEFLLMKVEKGHPAKAYFPDVYREFEDLHNMVKKMAYDHLSNSSVNCQQPVEIKDAKPPGTHGAPPGAAAGREEGGGSGAELLAVTEE................................................................................................................................................................................................................................................................................................................................................. 153
231 9.000e-21UniRef50_A0A2D4BVF8 Elicitor-like mating protein M81 n=1 Tax=Pythium insidiosum TaxID=114742 RepID=A0A2D4BVF8_PYTIN  ali  153VTQVPETPSPETQTPSTPIPVTPAPETPAPETPAPVTPSPETQAPETLAPETPAPGTPVPATSSPETPTPETVAPETSALETPAPVTSSPETQAPETPTPGTEAPGTTPLPDTPVPETQSPETQVPATPTPETSAPATPAPDTLAPETQVPGTPAPETPTPVTSEPVTQVPETPSPETQTPTTPIVGTEAPQTPAPDTPVPETPEPVSQSPETPSPATPSPETQAPETPAPETPAPVTSTPEKQAPQTPTPATPAPDTPAPETSSPETQAPETPAPTTQEPVTTPPVTAAPETQAPETPAPVTEAPSTPVPETATLSSMSNSRAS.......................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 477
232 1.000e-20UniRef50_A0A1I8HSS8 Uncharacterized protein n=1 Tax=Macrostomum lignano TaxID=282301 RepID=A0A1I8HSS8_9PLAT  ali  10 1715..PSVSVPEATGPTLSTESTQTVESSTVSGATPSSEAETASTASASTVSTAEPEATSAASVETPSVSVPEATGPTLSTESTQTVESSTVSGATPSSEAETASTASASTVSTAEPEATSAASVETPSVSVPEATGPTLSTESTQTVESSTWRDAQQRGRDCEHCVCVYCFHCGTGSHKRRQCRDAERECTRSDRPDIEQRQDSESRASTDSCESTWWPTPSSEAETASTASASTVSTAEPEATSAASVETPSVSVPEATGPTLSTESTQTVESSTVSGATPSSEAETASTASASTVSTAEPEATSAASVETPSVSVPEATGPTLSTESTQTVESSTVSGATPSSEAETASTASASTVSTAEPEATSAASVETPSVSVPEATGPTLSTESTQTVESSTVSGATPSSEAETASTASASTVSTAEPEATSAASVETPSVSVPEATGPTLSTESTQTVESSTWRDAQQRGRDCEHCVCVYCFHSETPSVSVPEATGRHETPSDASRRQTVTVSRVAERPTLSTESTQTVESSTVSGATPSSEAETASTASASTVSTAEPEATSAASVETPSVSVPEATGPTLSTESTQTVESSTVSGATPSSEAETASTASASTVSTAEPEATSAASVETPSVSVPEATGPTLSTESTQTVESSTVSGATPSSEAETASTASASTVSTAEPEATSAASVETPSVSVPEATGPTLSTESTQTVESSTVSGATPSSEAETASTASASTVSTAEPEATSAASVETPSVSVPEATGPTLSTESTQTVESSTVSGATPSSEAETASTASASTVSTAE.. 2546
233 1.000e-20UniRef50_UPI0008131613 proteoglycan 4 n=6 Tax=Boreoeutheria TaxID=1437010 RepID=UPI0008131613  ali  103...................................................................................................................................................................................................CEEVHNPTPPPSSKTAPPPPRASQTRKATTKRSPKSKKKTKKVIESEEITEEHSVSEIQESSSSSSSSSTIRKVTSSKNSAANKELKKKPKVKDNKKERTPKKKPILEPPVVDEAGSGLDNGDMKLTPTPNIPTPRHGKVTASPKIATVKPKDLKPSLPPNSVTSKETSSTTSKETTVETKETSVTNKQTSTRAKEKTTSAKETRNAEKTSAEDFAPTKPTAVPTKPTTKAKTTTKSPTPTTPKEPAPTIAEGPAPSTPKKPAPTIPKEPAPRTPKDPVPRTPKEPSTSTPKKPAPKTPKEPAPRTPKDPSASTTKEPASSTPKGSALNTPKEPAPSTPKEPAPSTPKEPAPSTPKEPAPSTPKEPAPSTPKEPAPSTPKEHALSTPKEPAPRDPKDPAPTTPAPSTPKEPAPSTPKEPAPSTPKEPAPTTPKEPAPSTPKEPAPSTPKEPAPTTPKEPAPSTPKEPTPKEPAPSTPKEPAPSTPKEPALSTPKEPAPTPKEPALSTPKEPAPRDPKDPAPTTPKEPAPSTPKEPALSTPKEPAPSTPKEPALSTPKEPAPRDPKDPAPTTPKEPAPSTPKEPXPTTFKEPLPTTTTTKGP... 709
234 1.000e-20UniRef50_UPI0008407B18 proteoglycan 4-like n=1 Tax=Ceratina calcarata TaxID=156304 RepID=UPI0008407B18  ali  478IEPDSEPNSQEPEASDSESPNSEPDNSPSDPDDESSPPEPNTPAPTPRKPTRPKSSKPRSTPSRKPTTTTEPIEPDSEPNSQEPEASDSESPNSEPDNSPSDPDDESSPPEPNTPAPTPRKPTRPKSSKPRSTPSRKPTTTTEPIEPDSEPNSQEPEASDSESPNSEPDNSPSDPDDESSPPEPNTPAPTPRKPTRPKSSKPRSTPSRKPTTTTEPIEPDSEPNSQEPEASDSESPNSEPDNSPSDPDDESSPPEPNSPAPTPRKPTRPKSSRPRSTPSRKPTTTTEPTVPDSAEPEDSDPESPDSEPDNSPSDPDDESSPPKSNTPAPSPKKPTKPKPNRPRFTPRSK-----PTDPDDEPTSQEPEASDPESSDSEPDNSPSDPDDESSPPKPNKPAPTPKKPTKPKSNRPRFTPRAKPTTTTEPTEPDFDSDTEPNSAEPEATDPDSEPENSNPADETSPPKPKTPASSPRKPTRPQLNRPRSTPRTKPTTTTEPTEPDFDPDNEPNSAEPEATDSESPDSEPDNSPSDPDDESSPPKPNKPAPTPKKPTKPKSNRPRFTPRAKPTTTTEPTEPDFDSDTEPNSAEPEATDPDSEPENSNPADETSPPKPKTPASSPRKPTRPQSNRPRFAPRRKPTTTTEPPEPDYDVDYDYSEPEEQTEPETTLSNPPVRSPNPPKSNNRPTKPTKPKPVSTTPNAKPGKSNPAATSPKTESTPKKPSSQKPSSGEPTNPFAIPSLDARFSPEEDETAGPSKKPKTESNEPDNNQWANPS........................ 1247
235 1.000e-20UniRef50_A0A1E1XL05 Putative immunoglobulin a1 protease autotransporter (Fragment) n=9 Tax=Ixodidae TaxID=6939 RepID=A0A1E1XL05_9ACAR  ali  14  105.....ATAGPSSANEDSSDAPVTIQPTASSVQHITLPQKQSTAPLGSSENPIQIIQQGNTYHSTQVLSPEQLQQIAHVLQQQQVNKAIQNGGSAVVFNPQTNTRIIYRVIYPSELGSK---------QGGTARPTTTRGRGSYSGRGRGRPRGRGLAGRVVEEDDPRGDGPELSREEKEEKKKHRPRTRS------GRISKPPSYMVKDYKRIHHLDFDDEPYDDSDGGYSDYQVSDDEDRGRRSFQGFGGRPRN---FKCPTCSKSYIGRGGLCRHLRLYPDHGNPSDVDDMVAQAGEATSTTDTPPPSGTNNPAMYMAAPQRGR---------YADMASMRRKARLKEVTKTCREEELMEVVLPRLSESVSLWEFLLTKCEKGDPPQLQIPDMLIQLEEVLREMRALSQETLVAVEPGGSQLVKIEDENVAQAMGIATGLYAIREEESVAKVAPPTRKRVRVESESSQSQPASSMADSSGATAAVGGNSVEFVTPEEMVAALHGEPLPPNKRIRLDDEDAFVVLTGSGVESSEAAEATLNSDSLSENMLENLEFAGLPVSDEAVTNGNDDEATTAATTQPVTTAPAPVTAAATVVAPATTVAAVPTHTETFQFIQQSGKSQLHKVQILPGQSLLSRNFVRVVTSSESSPPHPPLAEASMATAPVSISQQESATPPEATEAAEAMLPAEPREEPQAEATSQRQPEVQVVESHGNEDSQHEITQVVC-----AEDGEAVNGTAVTAAAAQPIIR--QYMLPDGQIVNAYEDAEGSLLETPEEEQTTAGNVVIVQNPDG. 878
236 1.000e-20UniRef50_A0A0V0JB23 Zinc finger protein 839 n=2 Tax=Schistocephalus solidus TaxID=70667 RepID=A0A0V0JB23_SCHSO  ali  17  311.................................................................................................................................................................................................................................................................................................................KKSFSSRAGLARHKSLKHNPNGIKPAGPWSNPYFAAVRRRKKLKEALEKATNEDLIEFAAPRVAKVMSLWDYMLIRTEDGDPPLPYVPKLLIEFMSLVERVRSFLADQLEPC-------------------------RSTKRSSTPSSPAVVTERGKDTPIDDHEEFLSGRPAPASVKRRR--QEQRRLRDQQLQRVSPLEEAPQRLAEDLANAPDSLLPASISASPQPALTDSSALNTTECKVPQSDQEERAASKFGQFEQGALGSLSTTTAPNPTLSSSQGSSDTLIPAPLAITGTRMTVENVNMNQTPSSPSASTINQSLPQREGLSSYAPS............................................................................................................................................................... 620
237 1.000e-20UniRef50_A0A0S7GAF7 ZN839 (Fragment) n=1 Tax=Poeciliopsis prolifica TaxID=188132 RepID=A0A0S7GAF7_9TELE  ali  22  1........................................................................................................................................................................................................................................................................................................................................................................MDAVLPRLTKMLNLWELLLAKLDCKGSACSCFPDIYHEFESLHAQVRQTAQEYIVSPQGGAM-PVEVRNIEVARSLGILDEVNKMKVLPGALPVSSGNNKNVRYM------------GNSKMLPPSKRFKMENSIADHQNGTEAPKTAA-APVASATQAASLVKSCSVSVSPLESASAEPTSSSSTIASPDPTPSLAGLPAGPSQEQKEGPSASKQDTNMADGAVQDVNRAEATVQDVNGS--DTTVQDVNDATVQMTQPDSALSSCATST........................................................................................................................................................................ 263
238 1.000e-20UniRef50_UPI0008FAB75B uncharacterized protein LOC109107349 n=2 Tax=Cyprinus carpio TaxID=7962 RepID=UPI0008FAB75B  ali  22  1........................................................................................................................................................................................................................................................................................................................................................................MEIVLPRLARVMTVWEFVLMKVEKGYPSKQQFPSVYHEFEQLHSQVKKMALEYLH-TSPASRPAIEVNNMGVLQSLGITD-PNALKLLTSSEGQQSQKTNQSEPRANQATKSLRSIENA-KMLPPAKRFKIENCNEETNGYQVNQNGIQKDESVDGSMLRKPQVVLTRLEDLTSVDLTSDDATQSTENTVPERTEEESSSDSDATKTVEDPEISKVLNSSVVVDIQMEQLEQALNTDSEFKNSQEAAQQEVQDSQTDALEDPEASQVVQQE........................................................................................................................................................................ 276
239 2.000e-20UniRef50_K7F0E1 Uncharacterized protein n=1 Tax=Pelodiscus sinensis TaxID=13735 RepID=K7F0E1_PELSI  ali  10  43..............................................................................................................................................................................................................SRVFPLPSQRGTEPRSPGSPSFPSALTTRPTPLAQRGTEPRSPGSPSFPSALTTRPTPLAQRGTEPRSPGSPSFPSALTTRPTPLAQRGTEPRSPGSPSFPSALTTRPTPLAQRGTEPRSPGSPSFPSALTTRPTPLAQRGTEPRSPGSPSFPSALTTRPTPLAQRGTEPRSPGSPSFPSALTTRPTPLAQRGTEPRSPGSPSFPSALTTRPTPLAQRGTEPRSPGSPSFPSALTTRPTPLAQRGTEPRSPGSPSFPSALTTRPTPLAQRGTEPRSPGSPSFPSALTTRPTPLAQRGTEPRSPGSPSFPSALTTRPTPLAQRGTEPRSPGSPSFPSALTTRPTPLAQRGTEPRSPGSPSFPSALTTRPTPLAQRGTEPRSPGSPSFPSALTTRPTPLAQRGTEPRSPGSPSFPSALTTRPTPLAQRGTEPRSPGSPSFPSALTTRPTPLAQRGTEPRSPGSPSFPSALTTRPTPLAQRGTEPRSPGSPSFPSALTTRPTPLAQRGTEPRSPGSPSFPSALTTRPTPLAQRGTEPRSPGSPSFPSALTTRPTPLAQRGTEPRSPGSPSFPSALTTRPTP............... 620
240 2.000e-20UniRef50_W4GPM1 Uncharacterized protein n=1 Tax=Aphanomyces astaci TaxID=112090 RepID=W4GPM1_9STRA  ali  456.......SPTQPPVTASPTEPPATQSPSTTTSTPTEPPATSLPRTEPPTAATPLPPTEPPMTATPTEPPTTQSPSTEYPTTATPPAPPLPPTEPPMTATPATPSPPTEFPTTATPTESPATPLPPTEPPVTATPTEPLTTKSPTIEPPMTATPTEPPATALPPTEPPATDAPATPFPPTEPTEAPISQPPQSQVPPQTEAPPTSTPTLSTEVPPSEGPITPPTAAPDVPSSQVPSPFTQAPSTEVPLPEAPTSPAPSTDAPTTKLPATQAPLTDVPITLSPPTQQVTLAPVSEAPITQAPPTQAPTTGPSSPPKPTAGPVTSITPTELPATQPPITTSTSVTNGPATSTLXXXXXXXXXXXXXXVSTASTSNSPMTSQSPLVPTTASVTPLTSIPPTTMTSPSTQSLSSPTPTSAATTDVLATIPPISTSSPLLNSTPRSTVESASSIIPQPWSTPPSQASSNSPFPSSTLLSATILTTSTPLTSNPSPTSATSNPPTTSRVESTSIPQVDIIMSNVSVSSPDDLAPNATSAAVVLEDGGPASHILSQLQYLASQSTSFVVGTAVATSLLTVLTAATSTSAAVTSTSSFVGAASTAVVAAAATSSSSVLSMPPP......................................................................................................................................................................................... 1065
241 2.000e-20UniRef50_UPI000C2528DE uncharacterized protein LOC111517139 n=1 Tax=Leptinotarsa decemlineata TaxID=7539 RepID=UPI000C2528DE  ali  20  33......................................AQICFLPNATKDGQQLYVQSVVPVLNTLSVSESPANYVFEVVQTQPNVEAIQPTPPVLNFKRGRPKKKVTSKETNHKDQAKPKLAHRTRSGRVVKIPKHIVNDFEKLETNDNKNTDVKTTEFPKFLEPPTESKPSRVQGLEFHQQRRTIAAQYRCPKCRKAYLGKTKMMQHIQKHPDHGPMPQNEKKANFDVWNFLVDITQK............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................... 255
242 2.000e-20UniRef50_UPI0006D4FB9B uncharacterized protein LOC106677346 isoform X1 n=2 Tax=Halyomorpha halys TaxID=286706 RepID=UPI0006D4FB9B  ali  24  417..............................................................TNTRIVCRVVYPEDLVKDGEKQVTKRGKKRTRSVEVVKKSAP-------EDDKTKKPPPPSARTRSGRLSRPPRYMVKDFKKL--------TEDSEASYSDYMSDSDENSENSPLLPLPTPQQRKPPKFHCPTCGKVYLGKRRMFKHFTEYPSHRDPKTVFELEDESQENGKQQDNERN.............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 581
243 3.000e-20UniRef50_UPI000C6E42C8 histone-lysine N-methyltransferase 2C-like isoform X1 n=9 Tax=Xiphophorus maculatus TaxID=8083 RepID=UPI000C6E42C8  ali  703.........................................................................................................................................................................................................................................................................................................................................................SSCSPFEQQLAPPSDTSLALSPPAAPDTGQLFCLELPPSPLQSPNLELQPSPTPSSGDHPISSVASESILGTSQKDLQLTPPRSKSYRKTGVAASLEVLERSPSPPTGYQRHTSTPEQTDLPPPVISPSTFCQSLEHAAAEPQQSHASPPAGPQRSPASPPAEPQRSPASPPAQPDWGPASPPAEPRRSPASPPAEPRRSPASPPAQPDWGPASPPAEPRRSPASPPAQPQRGPASPPAQPQRSPASPPAQPQRSPASPPAEPRRSPASPPAQPRRSPASPPAEPRRSPASPPAEPRRSP---ASPPAQPDWGPASPPAQPQRGPASPPAEPQRSPASPPAQPQRSPASPPAEPQRSPASPPAQPQRSPASPPAEPQRSPASPPAQPQRSPASPPAEPQRSPASPPAQPQRSPASPPAEPRRSPASPPAEPRRSPASPPAEPRQSPASPPAEPR 1162
244 3.000e-20UniRef50_A0A2U9CIT2 Putative zinc finger protein 839 n=1 Tax=Scophthalmus maximus TaxID=52904 RepID=A0A2U9CIT2_SCOMX  ali  23  304..PVVGSLLPLVHKLTGPTTSKASGPGQKPAAPPSTFKTVATSIIKTLPTSTPASVPLIEPINGMTTAARKSPAKALPV--ITPAQSTAVTRPPAASPPPRTPAAKDREEKKKLRKREKKMAKVQTRSGRVSRPPKYKAKDYKFIKTEDLADSHQSDSDDYSDMSEEEEGVRKDGPAPGSSSTYSHKSRSHRCQTCDKAYIGPGGLNRHYKLNPTHG-------------DPDPPGNRPDNTPRPLGDVSHSQETTVTEEKPAAMATNRVGDSSTNQQSFNDVRVTVGLVSRRGRR----------------------------GRPPKISVTTVTSEQQVDRRRDRLRELVEQCEDEELMDIVLPRLTKVLSLWELLLAKVECGGTARTRFPDIYREYESLQVQVKQAAQDYIISPQ-GGATPLEVRNIEVARSLGIMDEVNRMKVVPGACPSSSMTNKNVRYMENS------------KMLPPSKRFKMENSVPVHQNGIEMLRTGGTKVTPVTSSLKSCSVSVSHLVIPEGSDLLTTTTDSASSSTSAKTPSTEALPPDTPMEVCPCEGPLQTEAQVEPLPADQDQVLSTPDIAAQTKEPQEALGSSPKTATDTKAPDSVSAQTPGATETSTVQTLSSQSESSTTDACEAKELQEGQEIYIQTEGLTVQLAEPGSDRIVIVNGPDGTTMHIQTPDGVPLEAVQALLGIEASDGNKVP............................................................................... 975
245 4.000e-20UniRef50_UPI000C2FAC69 mucin-2 n=1 Tax=Felis catus TaxID=9685 RepID=UPI000C2FAC69  ali  50...............................................................................................PRLPPPYGPGRIPPPPPQFFGPGRIPPPPPQFFGPGRIPPPPPLFPNGPGYPYPAFQQPFIPRFSLMYPFVLTPQIQTTTTTGSATTTTDPTTTQTDSATPMTASPPQETKTTSTPQETTIASTPQETMTASPPQETKTTSPPQETTASTPQETTIASTPQETTIASTPQETTTASPPLETTTTSPPQETTASPPQDTTIASIPQETTTASTPQETTT----TSPPQETTTASTPQETTIASTPQETTTASPPQETTTASTPQETTTASPPLETTTTSPPQETTASPPQDTTIASIPQETTTASTPQETTTTSPPQETTTASTPQETTIASTPQETTTASPPQETTTASTPQETTTASPPQETTTASTPQETTTASTPQETTTTSPPQETTASPPQETTTASPPQETTTTSPPQETTTASTPQETTIASTPQETTTASTPQETTTASPPQETTTASTPQETTTVSPPQETTTTSTPQETTTAPLPQETTT...................................................................................................................................................................................................................... 542
246 4.000e-20UniRef50_A0A267ER55 Uncharacterized protein n=1 Tax=Macrostomum lignano TaxID=282301 RepID=A0A267ER55_9PLAT  ali  565..PTTGPPLPAETTVDPTTGPPSPAETTVDPTTGPPSPAETTVDPTTGPPSPAETTVNPLTTGPSTPTDTTVNPTTGPPSPAETTVDPTTGPPTPAETTVDPTTGPPSPAETTVNPTTGPPSPAETTVNPTTGPPSPAETTVDPTTGPPSPAETTVNPTTGPPSPAETTDPTTGPPSPAETTVNPTTGPPSPAETTVDPTTGPPSPAETTVDPTTGPPSPAETTVNPTTGPPSPAETTVNPTTGPPSPAETTVDPTTGPPSPAETTVDPTTGPPSLAETTVDPTTGPPSPAETTVNQTTGPPSPAETTVNPTTGPPPPSDTTVNPLTTGPSTPTDTTVNPTTGPHHRLK.................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 912
247 4.000e-20UniRef50_A0A1E1XH42 Uncharacterized protein (Fragment) n=1 Tax=Amblyomma aureolatum TaxID=187763 RepID=A0A1E1XH42_9ACAR  ali  15  205.....VTAAPSSANEDSSDAPVTIQPSASNVQHVTLPQKQSTAPLGSSENPIQIIQQGNTYHSTQVLSPEQLQQIAHVLQQQQVNRAIQNGGSAVVFNPQTNTRIIYRVIYPSELGSK---------QGGTTRPATTRGRGSYSGRGRGRPRGRGLARRVVEEDDPRSDGPELSREEKEEKKKHRPRTRS------GRISKPPSYMVKDYKRIHHLDFDDEPYDDSDGGYSDYQVSDDEDRGRRSFQGFGGRPRN---FKCPTCSKSYIGRGGLCRHLRLYPDHGNPSDVDDMVAQG-EATSTTDTPPPSGTNNPAMYMAAPQRGR---------YADMASMRRKARLKEVTKSCREEELMEVVLPRLSESVSLWEFLLTKCEKGAPPQLQIPDMLIQLEEVLREMRALSQETLIAVEPGGSQLVKIEDENVAQAMGIATGLYAIREEESMAKVMPPTRKRVRAESESSQSQPASSMADSAAGAAAAAGGNVEFVTPEEMVAALHGEPLPPNKRIRLDDEDAFVVLTGSGVESSEAAKIIEATLNSDSLSENMLENLEFAGLPVSDEAVTNGNDEEAATATTTQQVTITPAPVTQAATMVAPATTVAAMTTQPET........................................................................................................................................................................................ 796
248 6.000e-20UniRef50_UPI0009E1C454 zona pellucida sperm-binding protein 1 isoform X1 n=2 Tax=Pogona vitticeps TaxID=103695 RepID=UPI0009E1C454  ali  599.....PQVPRPGVVQPQPSQLRPQLPQPGVVQPQPGHQPQVPRPGVVQPQPSQLRPQLPQPGVVQPQPGHLQPQVPRPGVVQPQPSQLRPQLPQPGVVQPQPGHLQPQVPRPGVVQPQPSQLRPQLPQPGVVQPQPGHLQPQVPRPGVVQPQPSQLRPQLPQPGVVQPQPGHLQPQVPRPGVVQPQPSQLRPQLPQPGVVQPQPGHLQPQVPRPGVVQPQPSQLRPQLPQPGVVQPQPGHLQPQVPRPGVVQPQPSQLRPQLPQPGVVQPQPGHLQPQVPRPGVVQPQPSQLRPQLPQPGVVQPQPGHLQPQVPRPGVVQPQPSQLRPQLPQPGVVQPQPGHLQPQVPRPGVVQPQPSQLR-PQLPQPGVVQPQPGHLQPQVPRPGVVQPQPSQLRPQLPQPGVVQPQPGHLQPQVPRPGVVQPQPSQLRPQLPQPGVVQPQPGHLQPQVPRPGVVQPQPSQLRPQLPQPGVVQPQPGHLQPQVPRPGVVQPQPSQLRPQLPQPGVVQPQPGQLPPQLPQPGVVQPQPGQMRPQLPQPGVVQPQPGHLRPQLPQPGVVQLQPGQMRPQQPGLVFPQPQWPGIVEPQPGQIYPLPQPPGLVFPQLPQPGIVSQQQQHSMGSPPTLEQCRVSSGKIP.................................................................................................................................................................... 1228
249 6.000e-20UniRef50_A0A1Y1VPD9 Uncharacterized protein (Fragment) n=1 Tax=Anaeromyces robustus TaxID=1754192 RepID=A0A1Y1VPD9_9FUNG  ali  798....TDPVETDPIETDPVETDPIETNPVETDPVETDQVETDPIETDPIETDPVETDPVETDSVETNPIETDPVETNPIETDTVETDPVETDTVETDPIETESIKTDQVETDSTKIDSITTEWFETESTITNPTTDEETATESTIIDITTSYKDFSSIESSEISVETTTTEPIITEQTTTEVDTTEITTEEPTTTEVDTTEITTEEPTTTEANTNESTTSEETTTEPISESTTELTSKESSTTELNTTELTTLTTPDITTTEPASTETSTTEQVSTEISSTELVSTETSTTELNTSDKDFSSTETISTTTYLCTSETITTETTNEPITTETSTTEPVSTETSSTEPVSTETSSTEPANTETSTTEPVSTETSTTEPISTETSTTEPVSTETSSTEPVDTETSTTESVITETSTTEPLSTETSTTEPVSTETSTTELVSTETSTTEPVSTETSTTEQASTETSTTEPVSCSDCFSTETSSTEPVSTETSTTEPVSTETSTTEPASTETSSTEPVSTETSTTEPVSTETSTTELVSTETSTTEPVSTETSTTEQASTETSTTEPVSCSDCFSTETSSTEPVSTETSTTEPVSTETSTTEPVSTETSTTEPVSTETSTTEPASTETSSTEPVSTETSTTEPVXXXXXXXXXXXXXPVSTETSSTEPVSTETSTTEPVSTETSTTELTTSISTTTELTTSETVTTETTNESITTETSTTEQATTETSTTEPISTETSSTEPISTETSTTEPASTETSTTEPVSTETSTTEPVSTETSSTEPISTETSSTEPASTETSTTES... 1598
250 6.000e-20UniRef50_A0A2H4SCU8 Carbohydrate-binding WSC n=1 Tax=Cordyceps militaris TaxID=73501 RepID=A0A2H4SCU8_CORMI  ali  628...TTATEPSSSGPATTATEPSSSGPATTATEPSSSGPATTATEPSSSGPATSTTPAPSTSGVPTTTPCNPGSASCTDVPGGPSTCPPGTSNSCTPTVPASSTGPASSTGPASSTSTTPAPTTSGVPTTTPCNPGSASCTDVPGGPSTCPPGTSNSCTPTVPASSTGPASSTGPASSTGPASSTGPASSTGPASSTGPATSTTPAPTTSGVPTTTPCNPGSASCTDVPGGPSTCPPGTSNSCTPTVPATSSTPASTATEPSSSGPASSTTPASTATEPSSSGPASSTTPASTATEPSSSGPASSTTPASTATEPSSSGPASSTTPASTATEPSSSGPASSTTPASTATEPSSSGPATTTPASSTTAVPTTTPCNPGSASCTDVPGGPSTCPPGTSNTCTPTVPPSSTGPSSTGVPSSTGPSSTGVPSSTGPSSTGVPSSTGPSSTGVPSSTSVPPTTTPLPSTTLPASSTTKPSTFTTSTLCPVVITPTPSGCANPIGDWCPKPEPEWTE................................................................................................................................................................................................................................................................................................. 1138
251 6.000e-20UniRef50_W4XGX2 Uncharacterized protein n=4 Tax=Strongylocentrotus purpuratus TaxID=7668 RepID=W4XGX2_STRPU  ali  16  391................TPSQTQGSTIPLMKVVTNVTNKLQTPVRTFPPGTVLSNRLSNNGNPTTAITRTTSSPSSALVRASPSPKPAKKKFGRGGGKAAVKGMAPAVPSSRDLHLLRQKRPANCKTRSGRVSRPPLYRIKEYKTMSNEELGDQPGSSDGEYSDYDETET--------GSSALSMYNLKRKYKCQNCEKRYIGKGGLARHYRENPTHGDPDSVFAKTEDEDQQFDERQSDEKDKQEEKTPSEADEKSNGDQSPKAEAEDEKPCSSEQTSKEDEQTSPVRPKPAIITYHYTPRTGPYKXXXXXXXXXXXXXSGRKVIDQSEDSPTVSSNSKDVEKEDTSTLKFPKSPLDEDLIKVTLPMLCKVIKPWEYTVARAQQTTTKDAIFPTILKSLKEMHTEARKMATSCLERISGSETQELLIEDDTMAKVLGVETGRYRKNPSEDALPKTVRLLSRKQEAVLIKDKEQKQPRVAESVGEALQRKRRMGSPARSEPPSKKTPGTISILSPSRSASTRLTTPXXXXXXXXXXXXXXRVHTIGNIASIADVPLTSTTTVKPAAKRPIPPLGPISSKASKGLESNSAAFESSPTAKTTSATTTLPPLKPIKTKPTITQPAS----------------SSSKQVXXXXXXXXXXXXPSSSMSSDPQLMTGGLDTMATTSQAVSSDVAD---------------------PVKAGASSSETGTSLMETGAETPSEDLVEQTTVLPEGTTIMQLEDGTFLLQKPDGTAMQIQTPDGMTIETVQALLSMEGGAI........ 1130
252 7.000e-20UniRef50_UPI0008540C7B DNA-directed RNA polymerase II subunit RPB1-like n=1 Tax=Nanorana parkeri TaxID=125878 RepID=UPI0008540C7B  ali  193..SPESRPTSPESRPTSPESRPTSPESRPTSPESRPTSPESRPTSPESRPTSPESRPTSPESRPTSPESRPTSPESRPTSPESRPTSPESRPTSPESRPTSPESRPTSPESRPTSPESRPTSPESRPTSPESRPTSPESRPTSPESRPTSPESRPTSPESRPTSPESRPTSPESRPTSPESRPTSPESRPTSPESRPTSPESRPTSPESRPTSPESRPTSPESRPTSPESRPTSPESRPTSPESRPTSPESRPTSPESRPTSPESRPTSPKSRPTSPKSRPTSPKSRPTSPKSRPTSPKSRPTSPKSRPPSPKSRPPSPKSRPPSPKSRPPSPKSRPPSPKSRPPSPKSRPPSPKSRPPSPKSRPPSPKSRPLYPEPPGMCSKQSSGRRRKIGRRDRIVIPILQIQPGETLPTLH................................................................................................................................................................................................................................................................................................................................................................................................ 605
253 7.000e-20UniRef50_J9JRB1 Uncharacterized protein n=2 Tax=Acyrthosiphon pisum TaxID=7029 RepID=J9JRB1_ACYPI  ali  76..............................................................................................................................................................................................................................................................................................................................AETPTESSPMSSSTVGETKESTSTPATTDPSSVPSSTISEAQESTSTPVTTDPSSVPSSTIEETKDSTSTPVTTDPSSVPSSTISEAQESTFTPVTTDPSSVPSSTIEETKESTSTPVTTDPSSVPSSTISEAQESTSTPVTTDPLSVPSSTISEAQESTSTPITTDPSSVPSSTIEETKESTSTPATTDPSSVPSSTIEETKESTSTPATTDPSSVPSSTIEETKESTSTPATTDPSSVPSSTISEAQETTDPSSVPSSTIEETKESTSTPATTDPSSVPSSTISEAQESTSTPVTTDPSSVPSSTIEETKESTSTPATTDPSSMPSSTIEETKESTSTPATTDPSSMPSSTIEETKESTSTPATTDPSSVPSSTISEAQESTSTPVTTDPSSVPSSTIEETKESTSTPATTDPSSVPSSTIEETKESTSTPATTDPSSVPSSTIEKTKESTSTPATTDPSSVPSSTIEETKESTSTP.. 554
254 7.000e-20UniRef50_UPI0007C9290B mucin-2 isoform X1 n=9 Tax=Acyrthosiphon pisum TaxID=7029 RepID=UPI0007C9290B  ali  281..............................................................................................................................................................................................................................................................................................................................AETPTESSPMSSSTVGETKESTSTPATTDPSSVPSSTISEAQESTSTPVTTDPSSVPSSTIEETKDSTSTPVTTDPSSVPSSTISEAQESTFTPVTTDPSSVPSSTIEETKESTSTPVTTDPSSVPSSTISEAQESTSTPVTTDPLSVPSSTISEAQESTSTPITTDPSSVPSSTIEETKESTSTPATTDPSSVPSSTIEETKESTSTPATTDPSSVPSSTIEETKESTSTPATTDPSSVPSSTISEAQETTDPSSVPSSTIEETKESTSTPATTDPSSVPSSTISEAQESTSTPVTTDPSSVPSSTIEETKESTSTPATTDPSSMPSSTIEETKESTSTPATTDPSSMPSSTIEETKESTSTPATTDPSSVPSSTISEAQESTSTPVTTDPSSVPSSTIEETKESTSTPATTDPSSVPSSTIEETKESTSTPATTDPSSVPSSTIEKTKESTSTPATTDPSSVPSSTIEETKESTSTP.. 759
255 8.000e-20UniRef50_A0A2P6TDH6 Serine-rich adhesin for platelets-like isoform X1 n=1 Tax=Chlorella sorokiniana TaxID=3076 RepID=A0A2P6TDH6_CHLSO  ali  12  957.QPQPTATLAA-TQPQPTATLTASQPQPTATLTASQPQPTATLAASQPQPTATLAASQPQPTATLTATQPQPTATLTASQPQPTATLAATQPQPTATLTASQPQPTATLAATQPQPTATLTASQPQPTATLTASQPQPTATLTASQPQPTATLAATQPQPTATLTASQPQPTATLTASQPQPTATLAASQPQPTATLAATQPQPTATLTASQPQPTATLAATQPQPTATLTASQPQPTATLTASQPQPTATLTASQPQPTATLAATQPQPTATLTATQPQPTATLTASQPQPTATTASQPQPTATLTASQPQPTATLAATQPQPTATLTASQPQPTATLAASQPQPTATLTASQPQPTATLAASQPQPTATLAASQPQPTATLAISQPTITFS...................................................................................................................................................................................................................................................................................................................................................................................................................... 1348
256 9.000e-20UniRef50_UPI000870AAE1 uncharacterized protein LOC100900174 n=1 Tax=Galendromus occidentalis TaxID=34638 RepID=UPI000870AAE1  ali  24  246........TPPLGSCDNPIQIIQQGNTYHSTQTLSQEQLQQIAHVLQQQQVAKAIKNGGSPATNTRIIYRVIYPNGAERKDKAATPNRITKTTKIVKQHPGRGRPAKRSSMSKEEREALKKQVPRTRSGRISRPPSYMVRDYKRIHHLDFHEEPPPDNSDYSDIEVEEDGVKRKRRKLVLGTDLSLKPKRYRCPQCDHAYISSIRLSKHFR---DRQHGDPDNIPPP............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 490
257 9.000e-20UniRef50_G3NK93 Uncharacterized protein n=1 Tax=Gasterosteus aculeatus TaxID=69293 RepID=G3NK93_GASAC  ali  45  3......................................................................................TAETPTPAVTQPTTVAPLPAVKDREKEKKSKKREAVKVQTRSGRVSRPPKYKAKDYKFIKTEDLADGHQSDSDDYSDMSVEDEDGGRKDPAPGVSLTYSHKSRSHRCQTCDKAYIGPGGLNRHYKLNPTHGEPDLPDNAPHPLRDDSQSQELETRG............................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................. 161
258 1.000e-19UniRef50_UPI000B7963AE mucin-2-like isoform X1 n=3 Tax=Aedes aegypti TaxID=7159 RepID=UPI000B7963AE  ali  2942VTQEITTEEQPTTVTDSPSTVTQEVTTEEQSTTATDSQSTVTQEITTEQQPTTVTDSPSTVTQEITTEQQPTTVTDSPSTVTQEITTEEKPTTVTDSPSTVTQEITTEEQSTTATDSQSTVTQEITTEEQPTTVTDSLSTVTQEITTEEHPTTVTDSPSTVTQEITTEEQSTTATDSQSTVTQEITTEEQPTTVTDSPSTVTQEITTEEKPTTVTDSPSTVTQEITTEEQPTTVTDSPSTVTQEITTEEQPTTVTDSPSTVTQEVTTEEKPTTVTDSPSTVTQEITTEEQPTTITDSPSTVTQEITTEEQSTTATDSQSTVTQEITTEEQSTTVTDSPSTVTQEITTEEQPTTVTDSPSTVTQEITTEQQSTTVTDSPSTVTQEDTTEEQPTTVTDSSSTVTQEITTEEQPTTVTDSPSTVTQEVTTEEQPTTVTDSSSTVTQEITTEEQPTTVTDSPSTVTQEITTEEQPTTVTDSPSTVTQEITTEEQPTTVTDSPSTVTQEITTEEHPTTVTDSPSTVTQEVTTEEQPTTITQSLSTTTTDVSTVTESSSTHTATESSTYSSVYSTTTNAITSTTAATPQPS...................................................................................................................................................................................................................... 3526
259 2.000e-19UniRef50_A0A2N6NB54 Endo-1,4-beta-xylanase B n=5 Tax=Cordycipitaceae TaxID=474943 RepID=A0A2N6NB54_BEABA  ali  11  235......................................................................................................................................................................................................................................................................................................................................................................DLASSEPCTVGPNPSSSGVPSTTGVPTGSSTGVPPGSSTGVPSTSSVVPTESSTGIPPGSSTGVPPGSSTGVPSTSSVVPTESSTGVPPGSSTGVPPGSSTGVPPGSSTGVPPGSSTGVPSTSSVVPTESSTGVPPGSSTGVPPGSSTGVPPGSSTGVPPGSSTGVPPGSSTGVPPGSSTGVPPGSSTGVPPGSSTGVPPGSSTGVPPGSSTGVPPGSSTGVPPGSSTGVPPGSSTGVPPGSSTGVPSTSSPTESSTGVPPGSSTGVPPGSSTGVPPGSSTGVPPGSSTGVPPGSSTGVPPGSSTGVPPGSSTGVPPGSSTGVPPGSSTGVPPGSSTGVPPGSSTGVPPGSSTGVPPGSSTGVPPGSSTGVPPGSSTGVPPSSTGVPPGSSTGVPPGSSTGVPPGSSTGVPPGSSTGVPPGSSTGVPPGSST......... 669
260 2.000e-19UniRef50_UPI000359F4FF uncharacterized protein LOC101849909 n=1 Tax=Aplysia californica TaxID=6500 RepID=UPI000359F4FF  ali  20  432................................................................TTSTQEQQTSIPHQKRQYRKRKLDIQAVPAVPGEEDGTDKGNPDTPESKEEKEERKKHRPRTRSGRVSKPPKHMVQDYKHIHVLDWDEDYDDSDGGYSDFKHSDEEGKVKPSPDFFPALGAGKPKNHKCQTCDKSYIGQAGLARHYRLNPDHCSTPLENGSSSSLHNGSLDGEDSKDASLQEGSLSLMSDTPTEGPKAGGLDNFSEDSNTQDSL--------------------------------NSTGASSPVVXXXXXXXXXXXXXAHFRYNAQIRRKSKLKELMKKCSDEELMEVVLPRLVTGVSLWEFLLMKSEKGG-SKPQVDVVYREFEALKRRVKQVCSDYMKPLSAEELEMIKVTDASMALCLGLERVTYRVEEMPQDDPNTFSSPQPAPGVPVKIVIKAENGDPEETKAGSQVATPTSATLKRTFDDFTTPDKNENPSKRVKLSSFSPWRPIEGAVSTSSSVSPGTTNSSLFTIAAHLPATSDEKMPLDRSDSSLSSMSSHSASSTASPKSQPVSTXXXXXXXXXXXXXXXXXXXXXXXXXXPAYKPLRAVSVVKSEPSTSTVQISIPASKQAVSYILKSNAKQNGQANGQTTVVGHRASQPQTVPVVINTGQGGASTGSTNGAGGSQKVVIAAPAGHGNQQHEPLPILLAPSGNHPQNSTVLLSSGTGVG...................................................... 1117
261 2.000e-19UniRef50_N6T5E5 Uncharacterized protein (Fragment) n=2 Tax=Dendroctonus ponderosae TaxID=77166 RepID=N6T5E5_DENPD  ali  22  9.................................LVSSAADPNTLIDVYDPETGTLVKSSPQSLKQSFYKPQQKPPM-NVVYQVVYPDDLNLKPGVGYQKSKSGRPKKAKIPQQPSQKSKVQVVAKTRSGREVKFPKHIQNDFKKIVTDDNTNDSEIETADFVKYTEADKSKEEKPTVLDSVQKKRRIASQYRCPKCQKAYMGRSKILEHLKKNPTHGPMNESE................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 213
262 2.000e-19UniRef50_UPI0009052A7D zinc finger protein 839 isoform X1 n=3 Tax=Percomorphaceae TaxID=1489872 RepID=UPI0009052A7D  ali  28  335....AQKPTATPIRVSMAPTVKTPIPSIIKTPPTTAAKTVNFPL-----------IKTPANGTMAAARKSLIKPPVTVTAVPVQTAAPAAQPVTVATPSAAPPRSEQKEKEKKAKKREKKAMKVQTRSGRVSRPPKYKAKDYKFIKTEDLAESHQSDSDDYSDMSVEEEDGEGTRKDGATPGSYSHKSRSHRCQTCDKAYIGAGGLNRHYKLNPTHGEPEPPGDPPGNTPHPLPDNSQSEETATAVNEEEEEKNKDDKPAATATNKVEGGPAAAVGLRGLHHRGPGRPEDEGEAGVGDEGGDGHWDRLLSSLTSPCVCFRGPRQRVH........................................................................................................................................................................................................................................................................................................................................................................................................................................................................................ 654
263 2.000e-19UniRef50_H2YZJ6 Uncharacterized protein n=1 Tax=Ciona savignyi TaxID=51511 RepID=H2YZJ6_CIOSA  ali  21  44................................................................................................................................................................................................................................................................................................................................LTNARLAITPQKPVLTTVEQAIRRKNRLRELLGACSEDEIMEVALPHLARAFSLWEFLIMKVEQNKQSRVYFADIYKEYEALHRYVSRLTAKYKGEIQTEKKNVIKVRCKKLAECLGLEDELEDTFINLLDATSVAPCLPAKPEMIISSIGEQAQTQVANAAPQKEKEAEQTEASKPVTNAVASAQGDMPPLAPLSSTPIAENGEKEAAVEASTESVDAAEGMQIDESASGTGSEDGAGGTQIIQIGTGDDKQFIEVPEGYTL-IQTPEGLVMSQPGTTLSQAEDGTIYVTQEDGTTAPLDSQKAIPLETMQSAES................................................................................................................................................................... 388
264 3.000e-19UniRef50_A0A1I8IMX4 Uncharacterized protein n=1 Tax=Macrostomum lignano TaxID=282301 RepID=A0A1I8IMX4_9PLAT  ali  126...................................PEATGPTLSTESTQTVESSTVSGATPSSEAETASTASASTVSTAEPEATSAASVETPSVSVPEATGPTLSTESTQTVESSTVSGATPSSEAETASTASASTVSTAEPEATSAASVETPSVSVPEATPTLSTESTQTVESSTVSGATPSSEAETASTASASTVSTAEPEATSAASVETPSVSVPEATGPTLSTESTQTVESSTVSGATPSSEAETASTASASTVSTAEPEATSAASVETPSVSVPEATGPTLSTESTQTVESSTVSGATPSSEAETASTASASTVSTAEPEATSAASVETPSVSVPEATGPTLSTESTVESQTRGETPAARPRLRALRLRLVSSGTGSHKRRQSTRDAQQLSEESETAVETASTASASTVSTAEPEATSAASVETPSLDREWRDAQQRGRDCEHCVCVYCFHCGTGSHKRRQCRDAEHRSTVSGSEATPSSEAETASTASASTVSTAEPEATSAASVETPSVSVPEATGPTLSTESTQTVESSTSGATPSSEAETASTASASTVSTAEPEATSAASVETPSVSVPEATGPTLSTESTQTVESSTVSGATPSSEAETASTASASTVSTAEPEATSAASVETPSVSVPEATGPTLSTESTQTVESSTVSGATPSSEAETASTASASTVSTAEPEATSAASVETPSVSVPEATGPTLSTTQSRHRQQRGPTLSTESTQTVESSTVSGATPSSEAETASTASASTVSTAEPEATSAASVETPSVSVPEATGPTLSTEST.......... 910
265 4.000e-19UniRef50_A0A061EJ54 Uncharacterized protein n=2 Tax=Theobroma cacao TaxID=3641 RepID=A0A061EJ54_THECC  ali  32..........................................................................................................................KTPSPAPSVLSVSAPQSSLPPRSSKSSFTAPAEPPLAGSQPSVSSSMPSSSESTTPSSASDKPSLPNSTPSLTQPAAAPKASTQPSLSKTIPSSTQPTPSQQASPNSIPGSREPTMAPMGSSHPSLSNTEPSLTQPAMSPLANAPPSSSTNNPSLSNSTNNLAQPAVAPMASTHPSSPDKVPSLAVPATSPSATTQPSLPTNNSPSSNSMPGLAQPAMAPMDSTHPSAPGKEPSLTLPATSPSETTQPSLPNPSSSNSTSGLTQHGMAPMASSLPSSPDKMPSLTLPATSPSATSQPSLPTNSPMASSQPSLSNSTPSLGLPSMSPSATSQPSLPANIPSFSNSTPSLAQPGMAPMASSQPSLSNSTPSLGLPSVSPSPTSQPSLPINNPSFSNSTPSLTQPGMAPMASSQPSLSNSTPSLGLPSMSPSATSQPSLPTNIPSFSNSIPSLAQPGMAPMASSQPSLSNSTPSLGLPSMSPSATSQPSLPTNIPSFSNSTPSLAQPGMPPMSSSQPSLPNSTPSLTQPGMAPMASSQPSLSNSTPSLGLPSMSPSATSQPSLPTNSPSFSNSTSSLTQPGMAPIASSQPSSPDKIPSLALPSNSPSNTTQPSLPPSLSNSTPSLTQPAISPSAHQASPQSSMTPTASPNHTSPSNIAPKASSQPSLPNTTPSSTQS... 725
266 4.000e-19UniRef50_X6N2I7 Uncharacterized protein (Fragment) n=2 Tax=Reticulomyxa filosa TaxID=46433 RepID=X6N2I7_RETFI  ali  360LTPSHEPTLSPTKRPSSSPTESPTPLPTQRPTLSPSNEPTKRPTLAPSDQPTSSPTKRPSFSPTDSPTSTPTQRPTLSPSNEPTLSPTRRPTLSPTSSPTKRPTLSPTDSPTSLPTQKPTLSPSNEPTLLPTQRPTLSPTERPTLAPSDQPTSTPTQRPTSTPSNEPTKRPTLAPLDQPTSFPTKRPSFSPTESPTSLPTQRPTLSPSNEPTKRPTLVPSNQPTSFPTKRPSSSPTESPTSLPTQRPTLTPSHGPTLSPTQRPTLTPSEQPTFSPTERPSSLPTDSPTSTPTQRPTLTPSHGPTLSPTKRPTLAPSDQPTLSPTDQPTSSPTKRPTLSPTDSPTSLPTQKPTLSPTERPTLAPSDQPTSTPTQRPTLTPSNDQHYHQPK.......................................................................................................................................................................................................................................................................................................................................................................................................................... 748
267 5.000e-19UniRef50_A0A2T7PE42 Uncharacterized protein n=1 Tax=Pomacea canaliculata TaxID=400727 RepID=A0A2T7PE42_POMCA  ali  424................................................................................................................................................................YRTPTATANSQQPTANSQQPTANNSQQQPNSQQPTANNSNNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTAKQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTTANNSQQQPTT........ 1058
268 6.000e-19UniRef50_D7L1K8 Predicted protein n=1 Tax=Arabidopsis lyrata subsp. lyrata TaxID=81972 RepID=D7L1K8_ARALL  ali  115VTPPIATPPIATPPIAIPPIATPPVSKPPVATPPVATPPTAMPPVATPPIAKPPVVTPPVATPPIAKPPVATPPIATPPVSKPPVATPPVATPPTTMPPVATPPIAKPPVATPPVATPPIAKPPVATPPIATPPVSKPPVATPPVATPPTIMPPVATPPIAKPPVATPPVATPPIAKPPIATPPVATPPIAKPPIATPPIAKPPIATPPVATPPIAKPPIATPPIAKPPTATPPTSIPPVATPPITTPPVATPPIATPPVAKPPVATPPVASPPVAKPPIATPPIAKPPVATPPIAKPPVATPPVATPPVATPPISTPPIANPPIAKPPAASPPVAKPPLATPPIAMPPVATPPTSMPKPKTCPIDTLKLGSCVDVLGGLVHIGIGQSAKQKCCPVLEGLVDLDAAVCLCTTIKAKLLNIDLVFPIALEVLLGCGKKPPPGFKCPTEISPVATPPVAKPPMATPPMAKPPVATPPVAKPPVTMPPIATPPVAKPPVATPPVAKSPVAAPPIATPPTSMPKPKTCP.................................................................................................................................................................................................................................................................................. 639
269 6.000e-19UniRef50_U4LG65 Uncharacterized protein n=1 Tax=Pyronema omphalodes (strain CBS 100304) TaxID=1076935 RepID=U4LG65_PYROM  ali  576.KPEPTSSEEPVPTSTGEPEPTSTEEPVPTSTGEPEPTSTEEPVPTSTGEPEPTSTEEPIPTSTGEPVPTSTGEPEPTSTKPVPTSTGEPKPTSTEEPVPTSTGEPEPTSTEEPVPTSTGEPEATSTGEPVPTSTGDPEPTSTGEPEPTSTEEPIPTSTEEPFPTSTGEPEPTSTREPEPTSTGEPEPTSTEEHVPTSTEEPIPTSTGEPGPTSTGEPEPTSSEEPVPTSTGEPEPTPTDVPIPTSTGEPEPTSTEEPVPTSTGEPVPTSTAEPEPSSTDGPVPTLTGEPEPTSGEPVPTSTEAPIPTSTGEPQSTITVEPTLTVEPTSTAGPSXXXXXXXXXXXXIPTECP............................................................................................................................................................................................................................................................................................................................................................................................................................................................... 926
270 6.000e-19UniRef50_UPI0007DCB6CA zinc finger protein 839 isoform X2 n=4 Tax=Pleuronectoidei TaxID=30942 RepID=UPI0007DCB6CA  ali  25  544............................................................................................................................QTRSGRVSRPPKYKAKDYMFIKTEDLAESHQSDSDDYSDMSVEEEEGEKDGKKKDGSSPYSHKSRCHRCQTCDKAYIGPGGLNRHYKLNPSHG--DPVPLDDQPSNTQKDTSQSQETTVTEEDKPAAMATNRVEAGPAAPLGLRALHHXXXXXXXXXXXXXXXXXXXXXXFVPPPKMTGLVSRRGRRGRPPKLT----------------VTLXXXXXXXXXXXXXXXXXXXXXELMDITLPRLTKVLSLWELLLAKVEGGGPARTRFPDIYREYESLQAQVKQAAQDYIVSPH-AGATPLEVTNIEVARSLGILDEVNKMKVVPGASPAPSLPTKNVRYMENS------------KMLPPSKRFKMENSVSVQQNGFESNGTGTQTL-----TSVTPGTSVTTPLKSCSVSVSPLIIPEGSKEVVSTNTSSSSSSVKTPAPDTAMEVSPAEEPVKQVAMEVPSQSGAQLESVPANQDQDTVQALSSSNVDAQTKEPKDIKTPDPESGPVHTHGLIQKNESSKTDISEAKELQEGQEIYIQTEGLTVQLAEPGTEQIVIVNGPDGTTMHIQNPEGVPLEAVQALLGIESSDRTRDSQ.............................................................................. 1107
271 6.000e-19UniRef50_UPI000719B15F uncharacterized protein LOC106814269 n=1 Tax=Priapulus caudatus TaxID=37621 RepID=UPI000719B15F  ali  17  136.QPDTSTAEVGDLESSAVVISNNSTWQTEEVGP--PKESDPTAIVGSAKNPIQIIQHGNTYTSTQVLSAEQLQQIAQVLQQQHLVQSATKAGSSSILYNPQTNTRIVYKVIYPSEMHTNTKEKIGVKTGDDSS--TQMPVPGKRKRGRPPKQPKKTDDEDDGDKSEGVELTKAEKDEKKRKCPRTRSGRISRPPL---------HMVKDFKRIHTVDL--DSEVYDDSDQGFSDFDLSDEEVQKRRKEGSKEPYFPSGLTTNKSRRHQCQTCDKAYIGRGGLGRHYRLNPDHGTLPPEENENE-EAQPNSSVLDHSEASNLSVDSSFQPAKRGRPSKDIASIRRKNRLKEMVQPCSDEEVMEVVLPRLTKAVTLYEFLLMKAESGDVEQPSVAVIFREFETLQKQLKKLAEKSLEEASPGTEVDLKIEDKDLGKSLSLEGDAYVVK--KDAPLFEYKMATDTNEEPWQAPSP--EKQPVEVLLPEKERPKDMPLLTLNGTGDATEVALVETPAQPPEVIGVISNKRPNVVVQRPQMSLLKPISLLKPNVAPAAKLVTAASPAIPAGASSTTALATTTVTLSNNLMNISEFPQADMSGVADSEMSVAVANDADVAPPAVADEPAAIAVPSGELAAPAAPTQR.............................................................................................................................................................. 761