current user: public

If you have questions about the server, please let us know.

Query: gi|15923009|ref|NP_370543.1| two-component sensor histidine kinase (SAV0019) [Staphylococcus aureus subsp. aureus Mu50], from S.aureus

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590    .  600    .
# Score Template Links and tools%idFirst MKWLKQLQSLHTKLVIVYVLLIIIGMQIIGLYFTNNLEKELLDNFKKNITQYAKQLEISIEKVYDEKGSVNAQKDIQNLLSEYANRQEIGEIRFIDKDQIIIATTKQSNRSLINQKANDSSVQKALSLGQSNDHLILKDYGGGKDRVWVYNIPVKVDKKVIGNIYIESKINDVYNQLNNINQIFIVGTAISLLITVILGFFIARTITKPITDMRNQTVEMSRGNYTQRVKIYGNDEIGELALAFNNLSKRVQEAQANTESEKRRLDSVITHMSDGIIATDRRGRIRIVNDMALKMLGMAKEDIIGYYMLSVLSLEDEFKLEEIQENNDSFLLDLNEEEGLIARVNFSTIVQETGFVTGYIAVLHDVTEQQQVERERREFVANVSHELRTPLTSMNSYIEALEEGAWKDEELAPQFLSVTREETERMIRLVNDLLQLSKMDNESDQINKEIIDFNMFINKIINRHEMSAKDTTFIRDIPKKTIFTEFDPDKMTQVFDNVITNAMKYSRGDKRVEFHVKQNPLYNRMTIRIKDNGIGIPINKVDKIFDRFYRVDKARTRKMGGTGLGLAISKEIVEAHNGRIWANSVEGQGTSIFITLPCEVIEDGDWDELast
1 -136.000IDP04694 gene: yycG; sensory box histidine kinase YycG [Bacillus anthracis str. `Ames Ancestor`] GBAA5714 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  46  1MKKVGFFQSIHLKFVLIYMLLILIAMQVIGVYFVRELEKSLVQGFRDSLTQQTNLLSYNLKQEFKKSYTKAETESTDETIKTSDRKKDIQEVSVFDANRKLLAISDESKQNKVNR-TSTDIAVQRVLVQ-KKPEVKIEKDGRTGHRVQVMITPIMDDKDALGAIYVVASMEDVYKQMKDINQIFATGTVIALLVTAVLGILLAQTITRPISDMRRQAIEMAKGNYSRKVKVHSHDEIGQLALSFNNLSKKLQQARSSTESERRKLSSVLSHMTDGVIATDRKGDIILLNDPAEKMLNVSRETALDQSVLEVLGIQEEFTLDHLYEEPDSVLLDSTRNEPYILRASFSVIQKETGKANGLIAVLYDVTEQERIERERREFVANVSHELRTPLTTMRSYLEALTDGAWQDPNIAPQFLTVIQEETERMIRLVNALLQLSKLDSTEHRLMKEWVDFTDFFNNIIDRFEMSKEQNSFKRSFSKKSRFIDMDTDKITQVLYNIISNALKYSPEGGTVTYRLRDRG--ELLEISVSDQGMGIPKENVDKIFERFYRVDKARSRQMGGTGLGLAIAKEMIEAHGGSIWAKSEEGKGTTIYFTLPMAADEEDEWE. 613
2 -130.000IDP04673 gene: resE; sensor histidine kinase ResE [Bacillus anthracis str. `Ames Ancestor`] GBAA1498 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  25  1....MLWRSVVGKLWMTILLLVSFVLGFVAILLSQFFRTYYVDMSEARLQKVATSVSELIEEGADVKTIENIAY---------KFSDPLSRIIIVEEGKEISSSPKQEGLELAAVFTDKKEIKNKVRKASN-----SRKNKNTENDIMIVGKPVQSKNE--SAVFVYESLQVPIQGMERTTDFIFLSAGIAIILTTFFAFFLSTRITAPLRKMREVAFEVSRGKFDAKAPMVSQDEIGELATALNQMGKQLKFNMNALQQEKEQLASILSSMADGVITLNQEGEVVVINPPAEHFLQVWQEEKEIE--LSKKLPSELVELFHLVVESEQQQVVGINLQKGNYVVLMTPLYNQ-TKIRGAVAVLRDMTEERRLEKMRQDFIANVSHELRTPMVMLQGYSEAILDDIVQTKEEINEFVQIIYDESVRLGKLVNELLDLARMESGNVELHIGEVDIHPFVEKIGRKFQGIAKDKEVALDFKDSIEQYPFDADRMEQVLTNLIDNAIRHTNAGGHVTLVIDTKN--NGLIFEVQDSGAGIPEEDIPFLFDRFYKADKARTRKKGGTGLGLAIAKNIVQGHGGKISVSSVVGEGTTFSVYLPNR......... 589
3 -130.000IDP04428 gene: phoR; sensory box histidine kinase PhoR [Bacillus anthracis str. `Ames Ancestor`] GBAA4832 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  25  1......MNKFRSRLLFTFVSLIVFILVGLGLLLETVFENYYIDHAKERMVKETEYVAVLAEEQGFDDVLK------NPYVFEKLEEKIQASIAFVDEKKKVQYSGGEQSAFSQGI---MKELSSETKKQRNKV---ITKEADQN-NEFYHAVFVQDVTGKQGYILVKSTIEPLKDVHQKTWGLLIIGFVIACLVVVFLGMKITGQYIRPIESVTKVAIELAKGNYKARAYESHSDETGMLSKAINILARNLQEMTLEQEMQQDRLHTLIENMGSGMILIDSRGYINLVNRSYKETFHVTDEEYLDRLYYESFHHTEIIELVEEIFMTEVKVRKQMLIERKHFEVYGAPIIGTNHEWKGIVLVFHDITELKKLEQMRKDFLANVSHELKTPITSIKGFSETLLDGAMDNKKFCEHFLHIILKESERMQGLIEDLLDLSKIEQQGFKLSMGTVDMKGLLEDIHMVLDNKAGEKEISLQVNLKRVSVIGDPSRLQQIFINLMNNAIVYTPAGGVVSVELAEDK--YNAYIKVSDTGIGISKDEIPRIFERFYRVDKARSRNTGGTGLGLSIVKHLVEAHHGTITVDSEVGEGTTFTVVLPKSATEK..... 587
4 -126.000IDP04258 sensory box histidine kinase [Clostridium perfringens ATCC 13124] CPF_2010 [Clostridium perfringens ATCC 13124]  ali follow..  26  1.........MKKRIIIFTTLIITFFLAIMTSMYLVISNHKYLEESKNVLNEYNKVIALLLENDNGNIKS-------ELERIESNNDMKNIRITYISKDGNVIFDTHKKLINDNESYLKRQEIIEAIESGLGSS---VRYSNDLHQNMIYSALKLKDG----SIVRTSIAVENAKILDSINSNYLLVGVILSLVIALLLTVKITNIILNPLKELEQLTSTIASGNFHKRVKINKDDEIQRLGKSFNYMAEQLEITMERFKDKQNGLEAILKSMGSGVIAFDRDMNVLMINPYAKKIFGIS-GEIIGNKLLDYITDKEVLKAFFDEKDRVEIEVNY-NDDPKILKIRKASIINE-PEIIGTVVVIQDITDIKKLENMRSQFVANISHELKTPLTSIKGFAETL--RYVDDDETRNKFLSIIDEESDRLARLLEDILCLYEIEQKR-STVLEEFNVDEEIEKVYMLLNDQAKKKGVEIFLDNSNCVLMGDKDKFKQMLLNLVSNSVKYTEKGGKVRVESYNRD--MNLVLVIEDNGIGISAEDLPRIFERFYRVDKARSRESGGTGLGLAIVKHIVRLFDGEINVTSELGVGTKIVITIPIN......... 570
5 -104.000IDP91948 histidine kinase PnpS [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100000392 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  21  1..................................................................................................................................................MKRYLQFWLVNLSVSLILIAGMALTWISKGIGLFLLALSLGLGGYWLFCL-------WKWEVAFETLHQ-----PLLTSSEYFLEKGQEDLKSLAQYVSGLKTKVSQQDQQYKDLAETMEVLLSHLTMGTFLVSAQGQMLLSSRSLPHYFPDVDG---DISSLDDLKRMDIRNLVHQAFDQKTREVSGFHEGDLILEVTAVPVFSPTQSVEAVLVLLYDLTTIRTYEKLNLAFVSNASHELRTPVTSIKGFAETIKGMSAEEEALKDDFLDIIYKESLRLEHIVEHLLTLSKAQQMP--IQWTTLSLAEFVQDLTQSLQPQLKKKDLQLKVQPDDVTLVSDSQLLSQILLNLLSNAIRYTEQGGKIEVKTQKVN--EGIKISVSDTGIGISQLEQDRIFERFYRVNKGRSRQTGGTGLGLAIVKELSQLLGGQVTVTSQLGRGSCFTIFLPNQSFAQD.... 443
6 -101.000IDP04556 putative two-component sensor histidine kinase [Yersinia pestis CO92] YPO3008 [Yersinia pestis CO92]  ali follow..  18  11........................................................................................TSITFLICAAIAYFGYRSLTHETLLRHYQNQRLAQSHTTQVSTF---ILDLLNQNAVRLGSLVSYIQLDNASLNALIAQESSIDALFVLKKNQ--------LLYPNTQAALTEKEKAWIQAITPIIQDPSLLYSHHYTDEQTRPTSGWYLSRELSDPLLI--YWQARDNQLIGFKVPYVKLLSDVINTMTFDSAPNTLQVLDDGRLLYQSGSEELLTQQVPLNSQRLPYPLGAWQI----DYYAKAVNGAPLYLWGGLLLLLLMVTVGLVMLYLYREYNRQLRLAQQQVSFVGQVSHELKTPLTNITLYAEMLQELQPEQPTAEQRYLEVILNESQRLSRLIQNILSFTKAPK----LHLQTVALRPLLNKIYHTFIPAFSAKNMELVLINTDIHLTTDVDRLTQIISNFLSNAEKYASQGKRVELIGEQAD--DRVLIHVRDYGNGIAAKELKAIFQPFYRVKSHITEGVSGTGIGLTIASQLAASLQGEISVTSNPA-GSCFTLKLPMTIKQDAATDK 510
7 -93.100IDP04481 gene: nmpB; phosphate regulon sensor protein PhoR [Yersinia pestis CO92] YPO3204 [Yersinia pestis CO92]  ali follow..  25  31.................................................................................................................................................................................................LPWLLLVSVVAALTWNFYNQLKLSHWLWLDRS--MTPPSGRWSWEPLFYGLYQMQLRNRRRRRELALLIKRFRSGAESLPDAVVITTVDGNIFWCNGLAQQLLGFRWPEDNGQHILNLLRYPEFSQYLQQQTFSRP--LTLQLNNGYYVEFRVMPYSEG-----QLLMVARDVTQMRQLEGARRNFFANVSHELRTPLTVLQGYLEMMHDQELAGPL-RDKALGTMQEQTKRMDGLVKQLLTLSRIEAAPNVDLNERVDIPLMLKILQHEVQALSNGRHEITFRVNDQLKVFGNEDQLRSAVSNLVYNAVNHTPEGTKIEVCWQQTP--QGAQFQVSDNGPGIPPEHVPRLTERFYRVDKARSRQTGGSGLGLAIVKHALSHHDARLEVMSEIGLGTRFIFTLPNRLIVPTVLVE 433
8 -92.700IDP04331 sensor histidine kinase [Clostridium perfringens ATCC 13124] CPF_2181 [Clostridium perfringens ATCC 13124]  ali follow..  19  1.....MKKSISKRLFIITFGIIIFLTLFTMIFQITFFQEFYYKRKSNDLSNAVLKFRALYSYDIKNTDS-------LYRALSLFELENNAKIGIYSIDSTPKYVPDPANKNSEAVDLLNDIFNELYSDQDNSGVTTEFKSRKYSTKYIVYMVPFSLNSKNDSIIIAITSFQAIEEASALIKDFYKYIILIVIVIGLILSYVFSNLISKPLVKLNKSAKKMSAMDFSEKCDIEREDEIGNLAKTLNFLSKNLSNALDDLKIKNKKLEE-------------------------------------------------------------------------------------------------DIEKERELEKLRKDFIAGASHELKTPIGIISGYAEGIKDGIVDHKD-QGVYLDIIIDEAEKMNKLVMDMLELSKLEAGKIDLHIIDFSLTELTEEVLVKNSVDINKNNLTVVKPTEDLYVQGDDFKIEQVLTNFVTNAIKYSEPNNQIIIDIKPVE-EDKIYFSIENTGAHIPDSDINKIWTQFYRGDTSRNRGSRSTGLGLSIVKNLLQAHESEFGVMNT-ENGVKFYFTLKKSKEIDEVEE. 506
9 -91.900IDP04662 sensor histidine kinase [Bacillus anthracis str. `Ames Ancestor`] GBAA0650 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  25  1......MKRISIQFGFYFLIVTLLIESVLFVLLYYSLVNTRVNEEMTALLKRGNSHRDVLEKYYDEQTISHV---------ALMESEAETTVVITNTNKEVLAKSNKINTTI-KNHISSMQTRTNHDGA-------IIENHWKTSNYICTVSPIIVAGKHEGYVYMFLGTESIEKLVNGLTKQFIIAGAITFLLTVITIFLLSRLLTKPLLHMKHATEKMSKGDLSVSLTTTRNDEIGELSSSIQTLANDLH----------------------------------------------------------------------------------------------------------------------YMKTERSEFLASVAHELRTPLTYVRGYADIALKETT-SPEQRLRYLSIIKDESDYITNLVQDLFSLAQMEQHNFSIQVKEVHLHTFLTRISEKVNAMYKERYITVSFSPPTLLVNLDEQRFEQVVVNILNNAYRHSKEHSQIHISVIEEN--KRISITMEDEGEGIPPEDLPHIFERFYRVDKARSRATGGTGLGLSIVKEIVELHGGNITVTSEVDHGSCFTISLPSIKKHDYHQ.. 463
10 -90.500IDP04667 sensor histidine kinase [Bacillus anthracis str. `Ames Ancestor`] GBAA1313 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  26  1......MFTMVQKLWLTVVCAVFVTVSFLYFVSLYSYEKLYVDNLKDSLVMEGKRLAAQYDKSEGISTFEEKVRAF--------DQISSSDVLFVSNPRDLSACLPFDVHH--HSLISEGDRQALLD---GKTVTKIGYEEHFERNIMGVVIPVLENKKLVGIVYSYIPLKSIKDLIYDMGLILAPLALAITLLTIWIGRKIIIAITRPLSQMERVANHLATGDFSERITISSEDEIGRLGKAFNKMANSLE----------------------------------------------------------------------------------------------------------------------TEDVKRKEFLANVSHELRTPLSYIKGYSEAILDGVA-KGPQQEKVTQLIHKEADRMQRLVHDLLDLAQLEGEHFPLQKQPIVFSQLIEDVLDTYEIKFIEKKIRISTNNPEIIVMIDEDRMQQVLHNVLDNAIRYTNQNGDIMITLRQID--DYCELSIKDTGIGIDTEHLENLGERFYRVDKARSRQHGGTGLGLAIVRQIVHIHDGQWQIESEKGNGTTVSIKLKVQNEES..... 464
11 -89.200IDP95472 sensor histidine kinase [Listeria monocytogenes 10403S] YP_005962624 [Listeria monocytogenes 10403S]  ali follow..  22  1.....MKFKYAYQLFFTQFIILLIACIMIGVLVSHSLKDYFYQSQVDDLTSYGQTISRDIRYSPQDATMQVLNT------YQRILDVKKIHYTIKNANDETIYPTQMNQPLPKDFSISADDKKKLESG----ETVSKKIDNRFNKEMTIVYVPIMNGDKFVGSIVLNSPISGTEQVIGTINRYMFYTILLSITVALILSAILSKLQVNRINKLRAATKDVIQGNYNARLKENNFDEIGALAIDFNKMTQTLETS---------------------------------------------------------------------------------------------------------------QEEIERQEKRRRQFIADVSHEMRTPLTTISGLTEGLVNDII-PKSETDRCIALIDTEARRLTKLVNENLDYEKIRSNKIKLQKTRFNGKEFLELIKEQLDYVASEKGNTITVADKDMAIYADYDRLTQVFINIVKNSVQFTENG---QITLTGTQDYKESVLTITDTGIGMNTEELEQIWERFYKADMSRTNAFGESGIGLSIVKQLIEYHDGSITVTSEPNKGTSFTIRLPFFQDNEQ.... 476
12 -88.000IDP04302 sensor histidine kinase [Clostridium perfringens ATCC 13124] CPF_2503 [Clostridium perfringens ATCC 13124]  ali follow..  23  1......MKSIKTRLMKNFLVLLLSTIIIVSAMFLIFISRYYYQNTEEILLSQINISVDFYKRYLSNVSLEENVYEDVDIFWK----QTDAQVQIYNLKGQLIMDSIGLEP---KEYNTPVDVKRALE---GDTAKWVGTVPDYTGKVMAISAPLRSSNEIVGVIRYISSLRNVDNFILNFFLVFLVIGLTVLAIGIILSYFLANSIVNPITELIKVSEQMAKGNLKVRNKIVTNDEIEKLADSLNIMAEEIE----------------------------------------------------------------------------------------------------------------------NREILKNEFISSVSHELRTPLTSIKGWAITLNNDFT-DRETLKMGFDIIEKEADRLSNMVEELLDFSKFVSGKIKLKYEEINLKEFIEYLRLYMNPRAEREHKELILKTEDFIIVGDKDRLKQVFINIIDNAFKFTHENEKITIEFVYAD--EGIYINIIDTGCGISKEELPRVKEKFYKGKNSKS----QNGIGLSICDEIIALHEGTLEIYSELGKGTKVVIYLPKKLIRSVEDD. 469
13 -87.100IDP04012 gene: virJ; sensor histidine kinase [Clostridium perfringens ATCC 13124] CPF_2355 [Clostridium perfringens ATCC 13124]  ali follow..  20  2........KVKHKFSGGFLIIFLIAFIILNCFLGKAFINYHENKIKNEMDSLYKSSYSILRLYFQVNNLEGNKGNFNRYIPKISSEQGKCQIDVFNEDLEKEYSYYLDDFSFDYEKGGYDVLKEANKNKA-----ALNIYRDENAVKAYLAFPVYVDESFLGNILLSKDYSKEYLELRDLMSNIKFIVSITFLLILIFTYFLFERIINPLNYIKNSFKRIGDGDFKINLKVNSKDEIGDLACGVNKMANKIEEQIEKINEEKEKV--------------------------------------------------------------------------------------------------------LTLEKTRTEFFNNITHELKTPLTNISGYAQIMSEEDFHDNDFRKFALERINKESKRMHELIVSLIEISKNKSDIEGGEIENVNLKTLIEDLCEDFKVKGDKQGICISNNLEDIEFMCREDEIRRIIINLLDNAIKYSIKGSEIEISLFKDK--EEKHIEIENLSDEISSEGVEKIFEPFYRENTKKSRELGGNGLGLYICSELVKKYGGDISFNYSNGKVK-VSIIFK........... 482
14 -86.400IDP04352 sensor histidine kinase [Bacillus anthracis str. `Ames Ancestor`] GBAA0584 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  25  1......MSKLSLKIGTYFLILALCIETIAFVSFYKSISKMRIEEETLALLEKGNRYSNKINPNRPIYPDFDIADEAEHLVESESISNSDIAIIITDNNGKIISTSEPVTKAM-QKQLTCKTEPIPKDGL-------IVEKNWKKSKFITTVSPIH-TTEFQGKLYMLLKTSFLENMLLKLMKQFLIISVLTIILTTISVFIFSRVITEPLIKMKRATEKMSKLNKPIQLGIKRNDELGSLAKTIEDLSSELT----------------------------------------------------------------------------------------------------------------------YMKKERGEFLASVAHELLTPLTYMKGYAKVAKRDSL-TKEEREEYLQIIEDETDSVTDLVQDLFMLVQLEQHQFVIKKQKVLLRPFLERMVEKTKTTLTNKQMQLHVYKDDLEVCIDERRMEQVMLNLLHNAYQHSLENTTITIRVLAET--NSFTISVQDEGEGIPEGDIPHIFDRFYRVDKSRTRATGGKGIGLAVAKEIVELHNGSILVTSKLDVGTNFIIELPFE......... 487
15 -86.400IDP04691 sensory box histidine kinase [Bacillus anthracis str. `Ames Ancestor`] GBAA5067 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  23  151.................FIPFSFSLGKQNLNGSNKPLEKAFNEKMSKLDQEKKKAAEEQFGKEKKPVVQEQAAQEPDV-----HIRGRVTKVQLPDVTGPINPIYKNSIFLDNIKEFQTDLLLKESKH--IQYATQTMDYEKNDIKYKLLIKPIKEKDESVTYIYAMASLQPVDEAVQMVQDYYIYIIAFVVVLIFLASFYYSKQIAKPLLKINDTTKKIAHLDFTEQIPITSKDEIGDLSKNINTLSNKLNSHIGQLE--------------------------------------------------------------------------------------------------------QDIEKERKLEKTRKEFISGVSHELKTPLSIMKSCISILKDGVAEHKK--EYYFQAMEREVDKMDTLILDMLELAKFESGTYKMKKDPFYIDTVMEAICEHLSVEIEKKELRVHKHIGPFEVVANQGRIEQVIVNFITNAIRYTPNKEDIIISTIDEK--DHIKVCIENKGTHIEEEQLDKIWDRFYRVDAARQRSQGGTGLGLAISKNILELHDAEYGAENT-EDGVLFYFYLPKKA........ 617
16 -85.600IDP04661 sensor histidine kinase [Bacillus anthracis str. `Ames Ancestor`] GBAA0572 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  21  36......................................................................................................................................................................................................................................YTYKRIYSGVNESIEKAVQHRKNADDKKLPKKIRGYPPIGDPRIMELTWLGNTVEIDIENGKRRFIFEDNLEKFSPKKLGTLQDIEVQGRYFRIFAFQKDAKIVQIARDFLILVIGCSIGSLCAIGIGFFLAGRALVPIQNSWEKQQQFVSDASHELRTPLAVIQSKTDILFQSPSATIEEKAMDISTISKECRRLSKLVANLLLLARSDSNQIEMDKKIFELDKLLEEIVEPYKEIASYQEKEMILKEYDISFMGDRERIHQMMVILLDNAMKYTNEGGHIQIDCTQTN--SSIRIRVKDDGIGVKGEDIPKLFDRFYQGDKARSAS-EGAGLGLSIANWIVEKHYGKISVESQWGEGTCFEVILPKNQR....... 415
17 -85.100IDP04243 sensor histidine kinase [Clostridium perfringens ATCC 13124] CPF_1140 [Clostridium perfringens ATCC 13124]  ali follow..  20  43.........................................................................................................................................................................................................................................VNVDNSLLQEKEKVQKVLIPNPQDRQFFEIGKNVLPPTPPNIIAILYRGDRVLSMNPNPYFDEDNL-PDLGEESKSKVEQITFKGYKFRGVTISSRDIRVQLDSEVQSINQLIKTIIMALVILIGIALVLSYILSIKKAYDKQVFFVQDASHEMKTPLAVIKGKLELLANSWDDKIEDHFEHISKMMSEVRDLEKLNSDLLLLSKEDIDN-SVNIVSFELEEFIEDLSEFYVDLAEVQEKNFNRPLTPVIVKWDYSKVKRMLIILLENAFKYTEEGGKISLSFEEVN--KNIKIIVCDNGIGIKEEDIGRIFDRFFRSADVRGKNIKGSGIGLSLLKSIGKTLGTDIKLYSKYGIGTKFEITIPKILN....... 418
18 -84.400IDP01779 gene: phoR; sensor histidine kinase PhoR protein, putative [Coxiella burnetii RSA 493] CBU_0366 [Coxiella burnetii RSA 493]  ali follow..  28  3...............................................................................................................................................................................................................................................................................................................................................................QRTHKLNLKKLPKAVEHINQLERIRSDFVANVSHELRTPLTVIRGYLETLLKKEVRDSKSYQKIFQQMYQHSARMETIIDDLLLLSRLESDDHPTEEKNVAVPEILKTLCADAERISGEKQHFIQLKEPNLYISGSEEELKSLFSNIIINSVKYTPSKGRINVKWYRDD--DHAVFSVVDTGIGIAKVHIPRITERFYRVDKARSRESGGTGLGLAIVKHVLMRHDGELHIESEPGKGSIFTCRFPLVS........ 252
19 -83.800IDP01736 sensor histidine kinase [Bacillus anthracis str. `Ames Ancestor`] GBAA5503 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  19  2........SLKRNMVFGIVGLLIPIFVLLYAVVYITLEKNMYHNAANSLEKLSVEAQIYTMNYLEKEAEVETLGPNSLLIASYLAKRMDVRVQMIGKNGDVVADTQKG-----ALLHRNIDIESSLKGKK-----SYVFEEGDPAPILLFSSPVYYGNDVIGSVRFINELTGEKEVLTNVGWTFLMTSLCLVAAGIFFAIRLAKSLHKPIDQLRQMAHRLANGDYKSKIELNEYVEIAQLSASFNAMADGIELH---------------------------------------------------------------------------------------------------------------IKQLKEEKEKQKDFLDRITHELKTPLTAIIGYVDLIPKLKA--KEDVKESLRYVAVESERLLSLVEELLKSSKYGTSTFEISPTVVNIKELAEEAVSIVKPRLQKFEIEVINELTDVHVVADFDKTKQIFLNVLDNAIKYSDAT---QIRMNVIVNEREAKVFVHDDGIGIDEGVLAEWNESPE---GKILPSSYGHGYGLYICQEIMDKQGGSMRIESSEEIGTTIFITFLLPRRMEDIKNL 472
20 -83.700IDP04433 sensor histidine kinase [Bacillus anthracis str. `Ames Ancestor`] GBAA5276 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  15  51.........................................................................................................................................................NGPSTTEQADSDKQNAQSKTNQNKAVSQGDMFNFQSSIIDYNALSTAINHLLQPSQTAKAKEHTQNISGKNSASAPSTETEKQVATNDALHKQNAASKTNDAQDDPKLTDALQQLAPHIGATMLALSLLGSLIYAKIIAKPFQYMS----------DALKDIMNLDFSDKKLLNKNTDQTDFNLQVAASQVPNI----VKNLHASNQDLRNELKKEQQLEQSRKEFMSMVSHELKTPIAAVMGQLDGMIHGIGAYKD-RDKYLKRSYEMMQDINILTEKMSELSKIQNPQFKPDLKVISLTNIIEDVMKKVDYFVSVKQLNVQSNKQDVQVLADPKFIQTAIFNIISNAIHYTIDHQHVYIKLYEKP--NGYALEVLNTGSQIDEDKLAHLFEPFYRANPDKHGLVQGSGLGLYIVKQILDKHQFPYGIQNT-PQGVKCSIVFPKA......... 479
21 -82.800IDP04189 sensor histidine kinase [Clostridium perfringens ATCC 13124] CPF_0225 [Clostridium perfringens ATCC 13124]  ali follow..  22  3NNKIQINLNLKQKIILTNLLILAPIIIFIFIITYNALSKNLINNSIEYLLDKSRTTESYILNLLSSNDSGDKEDIIRDNAPSTLSEKYNVRIQIISNSAQIIYDSSSDEVSL-----FGSDINESLDGQT-----AYIVEKIDNVPTLFLSSPIFYKGKEYGAIRLILINTEAYEILRNTLTIFIISGLIAIVIAIFLINTFAKELVSPLMILKQKSKNISEGKFKEELHITSGDEVEDLANTFNIMSENLDKY---------------------------------------------------------------------------------------------------------------INEIKSAKLHQKKFFDNVSHEFKTPLTAIIGFSEIIPKL--NDKEKIVQSSALIEKEGKRLLNLVEEILLLAKSNKNTFEIEYTYIDVKSLIEDCLKILKIKLDNYDIKVYRNYESFFIYGDHDKTKQVFINIIDNAIKYSGCE---TLSISTKRSPNKMEVIIEDDGTGFIIKD--------------EYVNPKGNGLGIKICKDIMQSQNYGFNIESELDVGTKVTLSFSIGKNNEIKEED 473
22 -82.600IDP04672 sensor histidine kinase [Bacillus anthracis str. `Ames Ancestor`] GBAA1482 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  17  1....MKNRSIVFKLFLLTSTLFTIIFLLFFLGQSLFLEKFYINKKVKTVQTAFEKFVANYEKSEKNPEE-------VRKLKQEFHDKTNADMQFLNTNGIIKSDNNYYIEVFNPKNFAELIRNGTAN---SQQLNTYIIDSGENIKNSIFVKPIIKNGEITEYAFAIASLQPVNEAMLVLKDYYVYALIIVFLVIILLSFYYSKIIVKPLIKINRVTKKMANFDFSEKLPVTADDEIGGLSGSINTLSVNLKDRIDRLNVANTKLQ-------------------------------------------------------------------------------------------------QDIERERQLEKTRKEFISGVSHELKTPLSVIRSFAEGIKDGVSKDTT---YYTDVILEETENMNRLIVEMLELAKLESGTYKLDMTTFSIGELIQQVYTKLLFSMEEKHLQVNIDNSSIFVKANRSRIEQVVVNLLSNAIRYTPEGEKIQVSVITME--DTVKIEIENTGNPIPEESLEKIWDRFYRLDASRSRHTGGTGLGLSIVKNILDLHHAEYGVYNTTN-SVVFYFNLQKVKEVK..... 603
23 -80.900IDP04419 sensor histidine kinase SrrB, putative [Bacillus anthracis str. `Ames Ancestor`] GBAA2861 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  20  1......MNKLGKKLFLSISLTVILIFTISLLLINYLLPKYNIYKTRESLEGITAQIQSIPREQLDE-------------AITSIENEGNVTIAYTSIKDSEDHINDELRMQLTKKRVALNK-IWITKEEIMKVKKFGHSNKIYDQEKIKSSFFVKYMAKDDMLILVGVSIAHSNEIIKTLNSFYLFILVITIFLIIVLVWILSKTITTPLKELSDVAEDISRLQFK-KTKVKTNDEIGDLATSINIMSEKLQEA---------------------------------------------------------------------------------------------------------------HQDLTDRNEHLKRFMGDVTHELKTPIALVKAYSMGIKDGLDDG-----TYIDTIIKQSDHISNLIEELLRFSKLERDV--LQKEEFSIKSLVQSILDKHKIELESKEINLQVNVGDAIVYADVNKMRMVFQNLISNAIKYTSNQ---NIKITLEDRNESVYFQIQNGMNAEHMKDIDKIWEPFYVLESSRSKDRSGTGLGLAIVKSIVERHGFDYGVVTI-GGEIRFYIHMKND......... 458
24 -80.700IDP04076 sensor histidine kinase [Bacillus anthracis str. `Ames Ancestor`] GBAA2213 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  22  2........KIKNKIYLFSTVWLLLILLIINSSIYFLFYKVTTNGELERLKREAIHIIDGMNADSAKKVDAISLLQPY--------LPSNGMIRIINENSKVMIRQEVDSTKPIPALNTKFE-----------RKESAGIYEKNEGKFAYIKIPIIWNDGKIVSLEMTERLDSLQENLNMLKNVLVIASLLVLIPSFFAGRMLSKFILKPVNSLIQTMEHIQVRGIFKKIPLKSKDELHKMGSTFNKMIDLLHQNFEK----------------------------------------------------------------------------------------------------------------------QQQFVSDASHELRTPLTVIESYAKLLKRWGMKKQDVLEESVEAIYSEAVRMKGMTNQMLLLANSSAD-WSLETNESDLVRLCQVTAEQLEKTY-ARNFRVITDEEKIVVNIDEQKIKQVLVVLLDNAMKYSKDSIDIIVGIQ----KEKVFFSIQDYGMGIPKEDIQKVFDRFFRVDKARSRETGGTGLGLSIAKQIIDAHEGDIQLESEEGKWTKVTVNLPH.......... 450
25 -79.500IDP04304 sensor histidine kinase [Clostridium perfringens ATCC 13124] CPF_2640 [Clostridium perfringens ATCC 13124]  ali follow..  34  1.........................................................................................................................................................................MQNELVFLDIVNKIILGIGVLLILASTIMGFIISRSITRPINKLMTKAKYISKGEYDKKIEINTDIEINDLINSINNLSQSIK----------------------------------------------------------------------------------------------------------------------EQENIRKRLTGDISHELKTPLTNIQSHLEAMIDGIWEPTE---ERLLSVKEEAERLSSLVSDMQKLNKYDESSIKLKKDNVNISDIICFVIFQFSNLAKSKNIKIEYEKKNINLYCDKDKITQALVNILSNAIRYSNEGSTIFIEEKLKD--NKVIISIEDQGIGISEEDLKYVFERFYRADKSRTRATGGTGIGLTIVKSIVSSHGGEVKLESKLGEGSKFTIILPKED........ 309
26 -78.200IDP04660 sensor histidine kinase, putative [Bacillus anthracis str. `Ames Ancestor`] GBAA0286 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  21  1...................................................................................................................................................................................MDPKVKISLFITLILITMYLFFSRIQFIQNHKSIDTKLSRALKGNLQTRLFTSNDQSLHNIVFSINELITELEKV---------------------------------------------------------------------------------------------------------------RIKAKRSEESRKQLLSSISHDIRTPLTSIIGYIDALKDGVAASEIEKQEYLKILYMKSNNLKHLVDEIFNMAKLDANEFPLKEEKLDFSEVTREVLIDFLPEISKHNIKLQVPESTCPIIADHLSLMRIIGNLMKNAIYYGKDGKTIGVELLETD--AAYELLIWDKGPGIPKHDLQNVFERMYRSEQSRNSSFGGSGLGLSISKALVEKNGGHIWVESIPWERTTFGFSIPKHNTFKK.... 314
27 -78.100IDP04247 sensor histidine kinase [Clostridium perfringens ATCC 13124] CPF_1402 [Clostridium perfringens ATCC 13124]  ali follow..  24  9.NRYKVSNILLRNYLKVFLLITIITATIFLISFIIGVSIYLKSEPIENESSKILAGEIE-------------NKDYNSIGNQDYVTEHGGWIEIIDKDLNIIETIGDQKVKRDN--YSSEEFSKILVDEMHGVNI--DEDYLSYTGYSKEGRFFVITRIPEENFGKMFTRNPKIGFKIFVYIMISLYIFIFTMSLILYSKLTSKTFTKPLDKLMNGVRKLSLGDYSTRINIEKNNEFEELGEAFNNMASKIEEE---------------------------------------------------------------------------------------------------------------KKLKEKSEKLRKEFVRNIAHDLKTPLSSIIGYSNIIKNNPDIEKESLHKYISVIENNGERANEMIMELFEFYTLQSSEFILHKKYQDLSEFLRNLIADYIYLLEEKDFDFEISEDDLYLEFDNKRLERAIGNLIINSVKYNKKGTKFLISLKKEG--DKVKIIVSDDGIGLSEEIKKHIFNPFVREEKSRNSKKGGSGLGLTISKEIVEKHGGTIYLSDGPLKGCNFVIELPIK......... 478
28 -78.000IDP04430 sensor histidine kinase [Bacillus anthracis str. `Ames Ancestor`] GBAA4921 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  24  2........SIKTRFLFSYIAVILVSITLILIAGFLIVNFYKSSYIQKPLTSEEENAYIELKTAAKKHQSQLLDESFVSSLEK------EGVKIVVRKGETISYATKVF---------ESVALKEALPKFESANINSRGTTELGDTFYRYVKFDFYFPQEEEGSIFVLKKQSSFVDLTQKLFPIFVSLLLLAILLIGLLSYLVSRSVIKPIFVLKDATGKIKEGNLDFHIPVTSHDEIGQLNQGFEEMRKKLKES---------------------------------------------------------------------------------------------------------------IEMQTQYEENRKELISNISHDLKTPITSIIGYVEGIKDGVANTPEKMDKYLTTIHTKARHMDTLIDELFLFSKLDLNRVPFQFETVELNMFMQELIEEMQMDLSKEGIEVNLHASPLYVTADCEKINRVISNLIHNSVKYMKEEKKITVTVSSDN--NKVIVKVMDNGSGIESDTLPYIFERFYRAEQSRNSSTGGSGLGLAIAKQIIEEHGGNIWAESELGEGTSIFFSLEKVEKCGE.... 484
29 -77.600IDP92003 sensor histidine kinase [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100002775 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  22  4................................................................................................................................................KSYILVGYIISTLLTILVVFWAVQKMLIAKGEI----YFLLGMTIVASLVGAGISLFLLLPVFTSLGKLKEHAKRVAAKDFPSNLEVQGPVEFQQLGQTFNEMSHDLQV---------------------------------------------------------------------------------------------------------------SFDSLEESEREKGLMIAQLSHDIKTPITSIQATVEGILDGIIKESE-QAHYLATIGRQTERLNKLVEELLTLNTARNQVETTSKDSIFLDKLLIECMSEFQFLIEQERRDVHLIPESARIEGDYAKLSRILVNLVDNAFKYSAPGTKLEVVAKLEK--DQLSISVTDEGQGIAPEDLENIFKRLYRVETSRNMKTGGHGLGLAIARELAHQLGGEITVSSQYGLGSTFTLVLNLSGSENK.... 349
30 -77.600IDP04674 sensor histidine kinase [Bacillus anthracis str. `Ames Ancestor`] GBAA1956 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  24  13..........................................................................................................................................IIALFSFLTIIWSTAFYVSSSILDALAIHLS------PFVTYLISDILSFIFMILVWILIAVLMRPKREAMIWTIIEPIQKIAKGDFSVKIRNKYDGEIGVLVKSINDMTDEL----------------------------------------------------------------------------------------------------------------------NAMEKMRQEFVSNVSHEIQSPLTSIKGFARALQDTNL-PEEKRKHYLTIIETETTRLSKLSQNLLKLTLLESEEYTPERVTYRLDQQLKQIVLNSEPLWAEKEIELDLDLEKVHITADQESMSQVWINLIHNSIKFTPSSGTISIKLKEYE--TLVEVRIRDTGSGISEEQKQHIFERFYKADSSRNRAYGGSGLGLAIVKKVLDLHQGEIKVESEEGNGTECIVCIPNYEEK...... 351
31 -77.600IDP95462 sensor histidine kinase [Staphylococcus aureus subsp. aureus USA300_FPR3757] YP_494944 [Staphylococcus aureus subsp. aureus USA300_FPR3757]  ali follow..  21  1.....MFKTLYARIAIYSITVILFSALISFVLTNVYYHYNLKASNDAKIMKTLKEARQYEQSAKPTHIQQYFK----------HLGQMNYQIMTIDQKGHKTFYGE----PFREDTLSQNAINNVLNNQDDKPFALFVTGFFDNVTDNTVGINFKTKDGSIAVF----MRPDIGETFSEFRTFLAVLLMLLLFISISLVIASTYSIIRPVKKLKLATERLIDGDFETPIKQTRKDEIGTLQYHFNKMRESLG----------------------------------------------------------------------------------------------------------------------QVDQMRQHFVQNVSHEIKTPLTHIHHLLSELQQTS--DKTLRQQYINDIYTITTQLSGLTTELLLLSELDNHQHLLFDDKIQVNQLIKDIIRHEQFAADEKSLIILADLESINFLGNQRLLHQALSNLLINAIKYTDVGGAIDIALQHSH--NNIIFTISNDGSPISPQAEARLFERFYKVSKHD----NSNGLGLAITKSIIELHHGTIQFTQSNEYVTTFTITLPNNS........ 456
32 -77.200IDP04358 gene: creC; putative histidine kinase sensor [Yersinia pestis CO92] YPO0895 [Yersinia pestis CO92]  ali follow..  19  2........KIGVRLLLGYFLIVAIAGYFVIRIFLQEVKPGVRRATEGTLVDTATLLAQFARQDILQNKVADGQRPIGANIEGIRKDRNEYRVYLTDTDGQVIFDS--SGRALGQDYSRWNDVWLTLRGEYGARSSRT-DPDDAESSVMYVAAPVIVENRIVGVLSIGKPNLSMVPVIKRSERKILFAGGLLLGIALLIGLGFVWWINRAIGKLVDYAERVAEGQAV-ALPAMGSSELNDLALALESMRLKLDG-----------------------------------------------------------------------------------------------------------------------KAYIEQYVHTLTHELKSPLAAISGAAELLRESP--PPETAQRFLINIEQQSARIQQLVDKMLVQARLESR-VDLQLSPLEISHILKQSFSAKEAQAVSRGVTLRLKVDNAMLIGDGLLLSQALNNLIDNALDFTPAGGEISVSGERQD--DTYLITVEDSGSGIPGYAQEKIFDRFYSLPRANSV--KSTGLGLNFVREVAAIHQGSICLENRLPQGVSARLTLPL.......... 472
33 -76.300IDP04397 sensor histidine kinase [Bacillus anthracis str. `Ames Ancestor`] GBAA3230 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  23  1MKRL----SIKMRVTLWYTGLIVIIMALVLAFILTSSDKVLLFNMKNQLKSTVKESVEDIEYKHGQLKMDDDFETFED----------GVNIIIYNKQSELLAGNSP----------------TSFNKKISLKSDEIQIIKDGNKEWIVYDFLHNADGGEQVWVRGIMTMSRLSSTMNTLIVLTLISFPLLILIAAVGGYFITQRAFRPVQQMSDSASKIGDGDLSKRINLKPKDEMYHLAQTFDKMFERLETSFES----------------------------------------------------------------------------------------------------------------------EKQFTSDASHELRTPTSVIISQCEYALSQR-NNPKEMEESLEVILKQSRKMSALISQLLLLARADQGNDTFQFECINMSELTEIVVEELSLMVQEASIDITTHEEDLFIKADQTLMMRLLMNLLTNAIAYSKANGTVHMQLFRDE--TNIIGKVSDNGIGISEQHITKIWDRFYRVDAARTSNIGNTGLGLSMVKWIVELHGGEITVESGLGEGSTFTFKLPIEKQA...... 457
34 -76.000IDP04371 sensor histidine kinase [Bacillus anthracis str. `Ames Ancestor`] GBAA4776 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  23  4.......................................................................................................................................................................................LLISIIFILLCVIYIQYKMRKNSSENLRYTYEKLESIVNEKTGEKLLVMTDDELQKLLVAINQLLDAKQK---------------------------------------------------------------------------------------------------------------TNADHAKVEISMRKMLSNISHDLKTPLTVILGYTEMLNKDKTMSKEEQQILLEKVHVKTLEVMELIHKFFDLAKLESGDKAIEMTKVNMNEVCREKILSFYDLVTSKGFHVDIPERNIYALGNVEVLGRVLNNFISNAITYGDDGKTLGMTLRDDE--TNVYIDVWDTGKGIDESHIDKVFERMYTLEDSRNRLYQGSGLGLTITKRLVEAMDGKIHLSSKPYEKTIFTVALKKMQ........ 310
35 -75.800IDP04182 sensor histidine kinase [Vibrio cholerae O1 biovar eltor str. N16961] VCA0238 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  16  12......MTMFRYRLAFVLALLLTLILAQVGVAYWSNQVANQHLLRGQQLSTEKQQLKVWLAEYLLIKDGSTLKRDMRFSKIEALLHKLNLLTEQAQQHSLTVQDFSEINQQIKVISLFETNFASEIAKITDDDERWLLLSQSFDRVDDTDLRQLLTQAISLQQQRTSRYEEAALDALSNVRSVITSLAVFGMVSGALLGVWLLRTLSKPLAELVKSTTALEQGRLDHRISISGPDELKTLARHFNYMAQSLEQAQQKERMSRQLIEREVADRTQELAQA--------------------------------------------------------------------------------------LQTLEKAKHQQKEFFANVSHELRSPATAILGEAQITLRSRHNSDDEYRQTLLRISESAEQLAFRIEDLLMLIRHDERLFHPALTELLLGEIWQAVVRQASLLTHAQQVELTVEWQTQLCYTDCDKLLMVIRILVDNALRYDPTQQPIGLNLELDE--EAWRVQLVDQGIGIAEADLSVIFERYFRAENGKRYRPDGLGIGLTLAQSIVKQLDGEIRIESVLEQGTTVTLTFPRGEEQDANLID 549
36 -75.100IDP04659 sensor histidine kinase [Bacillus anthracis str. `Ames Ancestor`] GBAA0272 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  21  24....GVRKSIRIQLITTFAACALLGVFFAKGAAPNRQATIDYRAGMEQINHEAQRAANSSVH---ENKLEAISNMIEMENQNLERGSRALKILVTDESGKVLYKTKQAQEEQIDLHNTIRNAASF-----AINYSNGRDVFENTRKEFIAFSPITIEDKNLYMFVSGIPDGVV----MYDTQEGPFPFLIGVLVFIFSFFYITKRKMKQIEAMAEGVKEIEKGNLAYRIEKKGEDEIASLTENINNMAEELMNN---------------------------------------------------------------------------------------------------------------IEKERKLEKQKNELITNVSHDLRTPLTSIMGYLRLLRDSKYENKEQHDEYTRIAFAKSEQLKNLIEDLFEYTKLTNEQVVLEKQEVCVNELLEQLIEELVPQAEEHGLTFKFPEERAYAAIDSEKMVRVFDNLLMNAIKYSKDDGEIKVSLQRQR--WEIQIVIANHSEEFTREELASLFERFYKKDQSRSRVTEGSGLGLAIAKSIVELQGGSIRAEYK-DGIIQFIVSLPIIER....... 501
37 -74.800IDP04239 sensor histidine kinase [Clostridium perfringens ATCC 13124] CPF_1057 [Clostridium perfringens ATCC 13124]  ali follow..  23  27...........................................................................................FRFLAIDICLIIILIILWC-------------IQAEKDFYGELVKNAQRSFNFFPIENSTYTVVWSNG----KTMVKEAGAFLYYVRKIVIILGIVEGVFLLEEIIFGTAKIRKTLKPLNEIAETASRLSNMDFDEEKFQIGDSELKGLEDAINKLLDRMRDSYRQ----------------------------------------------------------------------------------------------------------------------QARFVSDASHELRTPISVIQGYANMLDRWGKNDESVLEESIIAIKSESENMKNLVEQLLFLARGINGKTKLTIKEFSLNNMIDEVFEESKMIDKNHVYNYIESEH-ITVQGDMALLKQTARILVENATKYTEEGEIITLKVGENS-KGEAYFSIQDNGIGMDENDVPHIFERFFRADTARVRKNGGTGLGLSIAKWIIDNHKGYFSVLSRKGIGTRITVYLPQNIK....... 418
38 -74.300IDP04678 sensor histidine kinase [Bacillus anthracis str. `Ames Ancestor`] GBAA2560 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  25  33.........................................................................................................................................LIIYRLVTSVIESSLTLSELGKEFIRIFGYEKYKGIKESLWMIVSYLFLFSIFSSYLYIFYRHERKLYYETCIKKMIEEIRYIANGNFNHKVSIVNHNYLEELASGVNQIVEQLKVS---------------------------------------------------------------------------------------------------------------IDEERQAEQAKSELITNVSHDLRTPLTSIVGYVNLIHHDNYRDEVELRHYIQVIYDKVTRLNALMNDLFEYTRVQNKELSLYSVPIDIVELLGQLTVQFRIQLQEANIDCFFPSKKLMVLADGDKLVRVFENLIINAIAYGNDGDYIDITAYENN--NMIAIDITNYGQPIPSTDLPHIFERFYRVEKSRSTNTGGSGLGLAIAKSIVELHKGTIEVYSD-DKKTTFTVKLQPYKC....... 385
39 -73.700IDP04665 sensor histidine kinase [Bacillus anthracis str. `Ames Ancestor`] GBAA1118 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  19  147........................................................NALLKTIQKAHPSVSTDSFTLTEEEQQLLSKEKATLQIFNSKGDEVFSYPNG----KKKTFSVIQAALNEREPWNHKENTSSFYDTNSNHLLVVTAKNEH---------YYPDDEIDDVFTKKFLIGCGLILLIVFVYLVILSIWYGNKFGKPLLHAMRWLKNIAGGKYEEPVSKKGKPLFSDVTNSLEHLSITLKK---------------------------------------------------------------------------------------------------------------NDAMRQVLQQTREEWITGLTHDLKTPLSSIYGYALLLESKQYNTDRDIQQFGSVMKEKSQYMTTLIDDLSLTYQLKNNSLPAQHVNIEMNQFVQKVLLQFINNPTLQNQNIEFSSNKIQYFIEEKWFQRIIENLLVNAVKHNNETTNVIVKLSQNA--TSFTLSISDNGKGMDDKTKELLFERYYRGTNTEESN-IGTGLGLAITKQLVHAHNGAISIDSELGKGTTIILVFPFCS........ 580
40 -71.800IDP04043 sensor histidine kinase [Vibrio cholerae O1 biovar eltor str. N16961] VCA0565 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  13  110..............................................................................................................................................................................................LITEPLVFTRSLCKGSSLSPRWFARGLIHPGGGTYAFRYAEKYPAQFANLLPYMHIQERPNAAEGTLLYHLQNMGEDAINALVSGASMFGSGSDLWLRKGDIYYLFNEETWLTNANKAGLSYSLLSADNTCFI----QRGNICWDVEDHSDLLRTSMIILVIANIFLVLGWSGYRWNSKRQEMRSRMLILQILTHELRTPIASLSLTVEGFRREFEHLPESLYDEFRRLCEDSRRLRQLAEASKDYLQSDSKPLA-----SDWVPSVEEWLQYKVEEEFSGNVTLKLNQD-IAAKLNVYWLGTCVDNLLRNAVKYGVAPVTLEVIT----QTNLVTFKVTDQG-SLTHRDWRHLRKPFVSK--------SGLGLGLTIVESMVGRMGGKMSLE---GPPTTFILEIPCETDTASR... 499
41 -71.200IDP04343 two-component system sensor kinase [Yersinia pestis CO92] YPO2916 [Yersinia pestis CO92]  ali follow..  16  17.......RSLRQLVLMAFLLVLLPLLVLAY---------QAYQSLDHLSTQAADINRTTLADARRSEAMTSVALEMERSYRQYCVLDDATLATLYQHQRKQYTQMLVAHAPILPDARYYQTL-QGLLNQLTDIKCKNSGPDKEASILLEQFSRSNAEMVQATRDVIFSRGQQLQKDIAERGQFFGWQSLLLFLVSVLLVVLFTRMIIGPVKGIERMINRLGEGSLGNTALFKGPRELRSLAQRIIWLSERLA----------------------------------------------------------------------------------------------------------------------WLESQRHEFLRHISHELKTPLASMREGTELLADEVAGPTQDQQEVVAILDHSSRHLQQLIEQLLDYNRKLADG-PGEPEHVDLAEMVGNVISAHSLPARAKMIRTETELDARICWAEPTLLMRVLDNLYSNAVHYGEESGTIWICSRQVN--DRVQIDVANTGAPIPTSEEIMIFEPFFQGSHQRKGAVKGSGLGLSIAQDCIRRMQGDLQLVTVDYAAVCFRIELPLTAENE..... 483
42 -70.200IDP04692 sensor histidine kinase [Bacillus anthracis str. `Ames Ancestor`] GBAA5105 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  25  40..................................................................................................................................................................TMVRYEEPLAQFRSIVREFGDINFFLIFFIPLSIIFFFFLTKPYLKYFSEISNGIHHLANGNFTNRVQVSSNDEFGDIAREINVASEKLKEA---------------------------------------------------------------------------------------------------------------VERGDFAESSKDQLVVNLAHDLRTPLTSVLGYLDLILKDENLTKEQIKHFSTIAYTKSQRLESLIDELFEITRMNYGMLQLNKKPIDISELLIQLDEELYPLLEKHHLEARLNDPHLPINGDGKLLARVFENLLTNAVRYGYDGQFVDLNGYIDN--EEVVVQVMNYGDSIPEEDLPYLFDMFYTGDKSRTENRGGTGLGLFIAKNIVEQHNGTISAESNVV-RTIFEVRLPKDKKLT..... 367
43 -69.400IDP04542 putative two-component system sensor protein [Yersinia pestis CO92] YPO2000 [Yersinia pestis CO92]  ali follow..  20  1..MIMIKRSISGRLALMFALASILIVSALGIVLRSSLHNSLQKQMHNELQFTESLMAPWILSRTTLDGWQTLATKFTDLAA---AEGGRVQYWVLSDDPQLQVGGPAPRG-------------VTWASLSKGFSKVPGATDESCSLFLLMSEIPAQGERPALRYVVAIDSTPYMGTLNEFTRTLIVITAIGVLFVALLGFVIARIGMRPVNKLSEQAQHLAPGNHGQRLDTLTPDELQKLAVAFNGVLERQEIAWRQL----------------------------------------------------------------------------------------------------------------------ESFNADVAHELRTPLTNLMGQTQLGLSRK-RETHELEDLLESNLEELERMTSIVNDMLFLSHAQAGEHATQLTDVSLREETYKTTEYVEPSFAEKNLSIHVEGD-ITARIDRRLFHRSLANLLENSARHAVTGTTVKVTISREN--NLASIAVANIGAPIAAEHLNRLFERFYRVDSSRARSDTHHGLGLSIVRAVAIMHRGDVFASSQNGINT-FGLTLAITDPY...... 462
44 -66.800IDP04327 sensory box histidine kinase [Clostridium perfringens ATCC 13124] CPF_1243 [Clostridium perfringens ATCC 13124]  ali follow..  22  210........................................................................................................................................................................................................................................ENNEVKGIIGLTRDISYK-KAIEYRLKKNDKMFFEVFNYLDDVVIIKE-GEKTIYVNHAFEKLYGLNCKELYKEKSMIVKLDRIFSNIDFGNFFMEKARIVRADNEVRNVLFRANSIKNENGESIRRIIVINDITDTIEMEKLRVEFFANISHEFKTPVNLIYSALQLLKNNIDRNEESYINYIKMAKQNVFRLLKLINNLIDSTKLEAGFFNVNIKNHDIVSCVEDITMSICGFAEKNKISIDTEEEEKIIAFDLNHLERILLNILSNAIKFNRENGNIDVYMSFDE--RYANISIKDTGIGIQKDKIDLLFHRFKKINNRLTKVNEGSGIGLFIAKELVKINGGEMRVNSELGEGTEFIIKLPIKKIESEVLDE 598
45 -66.800IDP04183 sensor histidine kinase [Vibrio cholerae O1 biovar eltor str. N16961] VCA0257 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  14  111.................................................................................................................................................................................................................CRQTPLGAEWFQRVAWQHPAGGSADRYIEHLPDSEQASFASTHPTRFTLASRYHPLHTLWQRPGAAGVDALLNGFRLYLAPNDELWLSSEAGWHVLSSVQWRALTAPLPFTLEPYQAHKPCDERYSN-NQRVSSHALLYSGLVIGVLLAFGAALRSLWLRYQEGRERRFILQLLTHELRTPITSLGFTVESLRSQFDELSPKAQESLWRLMADHQRLAQLSETSRHYLSPSHDT--MARHPAQLSDFIEHCIEGFEVELH---------KHDSILALPYYWLGLCVTNLLSNAKQHGVPPIRLTVSV----VAQTLRIEVEDCGEFP--SFYQRLCKRLSRHQDTHSRNTDNMGVGLQLVRKLITQMGGKLVIRRH---PTRCILELPL.......... 484
46 -66.400IDP04007 sensor histidine kinase [Vibrio cholerae O1 biovar eltor str. N16961] VC1319 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  17  1......MRRIYIESLVSLIVLFFGSLVSYSFIVYELDTDYDYVLEDYQAEALQTLLSQIRQLDSPES---------AKTALRGYAEHIHKTVDLLPLTELPPEVQQHFSSEAAHSPIFHDDDRNLWLQLDSNEQI------------------------------YLLKPDSHSPVYQAIDRADNLLFVFMLGGFALYCMFLIWFLSRRLRELERVTHDFANGNLQARASTKSSKSVGKLNHSFNMMADKIS----------------------------------------------------------------------------------------------------------------------HLILSNKALTNAIAHDLRTPIFRIQWQAEVLAESQLNAKQ--QQQVASIIEDTEEMETMVDELLYYAKLEHPESDIQSQYLEVNQWLADFIDE-QSHKSSLQIQYLPSLQPLMLDADPQLLTRALVNLIRNAEKYA--GDRLLIEASTVD--AKLCIAIHDNGPGIEEQHWPHIFDAFYSTDSSRNKAQSGFGLGLAIVKQIMARHQGEVTLTKSPLGGACFSLWLPLYPNKLEL... 435
47 -65.100IDP04438 gene: cpxA; two component sensor kinase [Yersinia pestis CO92] YPO0073 [Yersinia pestis CO92]  ali follow..  19  1.....MINSLTTRIFAIFWFTLALVLMLVLMVPKLDSRQ--LTVLLDSEQRQGTMLEQHIEAELANDPANDLMWWRRLHRAIEKWAPPGQHLILVTSEGRIIGVQRQEVQMVRNFIGQSDNADQPK-------------KKKYGRVEMVGPFSIRDGEDNYQLYLIRPANSPQSDFINLMFDRPLLLLIATMLISAPLLLWLAWSLAKPARKLKNAADDVARGNLKQHPELSGPQEFLATGASFNQMISSLDRMVVA----------------------------------------------------------------------------------------------------------------------QQRLISDISHELRTPLTRLQLATALMRRRHGEGKE-----LERIEMEAQRLDSMINDLLVLSRSQHKN-ELHREPIKADELWSDVLENAQFEAEQMGKTLVVPPGPWPLFCNPAALDSALENIVRNALRYSHHHIAVAFSI----DNQGVTIIVDDDGPGVSPEDREQIFRPFYRTDEARDRASGGTGLGLAIVETAVSQHRGWVKAEDSPLGGLRLIVWLPLHPLKS..... 458
48 -64.800IDP04341 putative aerobic respiration control sensor protein arcB [Coxiella burnetii RSA 493] CBU_0634 [Coxiella burnetii RSA 493]  ali follow..  21  115...............................................................................................................................................................................................................................................................KSVNASQIFLENILYNIPQYILWKDRNFVYLGCNHNFAKLVGFEPESIIGKTDFDLWRSQGANSIRPTDVEDVEQSLSLPNGKEGVFLISKVPLRDERNEIIGILVVGTDITERKQNERAKSEFIANISHDLRTPINGILGIAQIFNMHEHTKKQ--EPLINDLSASANLLLGLVEDILDFARLEVGKLELKYSTFNLRQLVTFLVKTFSFQTQQKQIKINVYYDA-SIVSEPNYIRRIFLNLIGNAVKFTEK-GQIDVTVNLEGNKPMLKILVKDTGIGIPKDKLNTIFDRFSRATPVYSSRYEGLGLGLSIIKRLLDNLGGEVHVSSIENEGSTFTLTIPCEIASLQSPRE 491
49 -63.900IDP95120 two-component sensor kinase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] YP_001333744 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]  ali follow..  15  1.....MKLSFQYKLFISLVAFFSVLFIALGIYYYFDASRQLYQEMSARAKIQAEEIAL--MPNLRQQVSRHDPQAIQAFMQQIAAHSDASFIVIGDRQGVHLFHSVHP--EWVGTRLVGGDNQAVLEG----KSITTIRKGGLGVSLRSKTPIVDDAGRVIGIVSVGYLTSYLDSITLTKVINIFIAAVLLLIALFIFSWYFTRSIKKQIFSL-------------------EPREIGLLV---------------------RQQKAMMESIFEGVIVIDRQRRIEVINHAARSLLGLPARQLRGQSIDSVISPQPFFASGDM--LERDTHDELCRFNQLTVLASRVRIM-LENTLQGWVITFRDRNEINALTAQLSDNLRIMRHEQLNRMTTLSGLLHMGHYD--EAIRYIQAQSEHAQELLDFISSHFHSPTLCGLLLGKATRAREKGVAL------------------SFDPACRIDRPLPSLMESELISIIGNLLDNAIEATQRAEL-PVEVLIQLNARELIIEVADRGVGIRPDIRERIFERGV-----TTKTRGDHGIGLYLIEHYVTQAGGTIEVADNAPRGTIFTLFIPADAHACPQPEA 537
50 -63.600IDP06113 histidine kinase sensor protein [Helicobacter pylori J99] NP_222872 [Helicobacter pylori J99]  ali follow..  17  28...........................................................................VSSQISHENYQNEMRHYQFVTTINEILNNY--SDYRAIEDYLYKIGFRETTI---ENLEKVLAKRRHQLHHRNIWYAEVFKFSDMVFILLKKDEHFVLYKDLHSVSYRNYFLAITVGLLLILFLFLFVLQSLLPLRELRSQVKRFAQGDKSVSCKSKQKDEIGDLANEFDNCIQKIN----------------------------------------------------------------------------------------------------------------------AMNESRVLFLRSIMHELRTPITKGKILSSMLKEE---------LSCKRFSSIFDHLNMLIEQFARIEQLASKNYGSNKEKFLMSDLIDKIEKMLLID-EDKKSPIHVSSSNYIIEADFELFAIALKNMIDNAIKYSDD-KQVFLDFIGNN------LVVSNKSKPLK-EDFEKYLQPYFKSS--NPSQAHGFGLGMYIIKNALEAMGLNLSYHYSNG-RICFTIHDCVFNSFYDLEAD 416
51 -63.200IDP02415 sensory box sensor histidine kinase/response regulator, putative [Coxiella burnetii RSA 493] CBU_1761 [Coxiella burnetii RSA 493]  ali follow..  19  3...............................................................................................................................................................................................................................................................GGKNNNEEALLEIINNVPHYIFWKDKNLIFRGCNKMFAEQFGYKDSGIIGKTDEDFPWSKELRKKYRQDDLS-EESQVQADGSIKTVLVSKVPYRNKEGNIVGILGIYTDITKRKRMEKVKSEFLANMGHDLRTPLTGIILIAEYLWKKQTEEKD--KQLSKDLILAGKQLLHFINEVLEITNVEAGNIDYEKKSFSLKKLIDQVFAMLRPSFQQKQLAFYNDYDP-VLIGSEIMIFRILMNLLGNSLKFT-EEGQVTIQTKLANRSGNIELIVSDTGIGIPKEEHKNIFAQFKRLTPSYASKYRGSGLGLFLVKTYAEALQGQVTLESEPGRGSRFICTIPLTVGKRKD... 373
52 -62.900IDP04133 gene: hpkA; sensor histidine kinase [Clostridium perfringens ATCC 13124] CPF_1195 [Clostridium perfringens ATCC 13124]  ali follow..  23  1.....................................................................................................................................................................................................MLLIIFILKTKEINRLTLELKKLNSEGKIEKLRLSPNKNIENLIVEINTLIDDKRKM---------------------------------------------------------------------------------------------------------------ENIYKEKDMELREAIANMSHDLRTPLTSIMGYVYLLNDDKL-DKEERKEYLKIIEKRSLVLNDLITNFYGLSRIQADQYEIKLEPVNLELVLGEIIAAFYETLDYKFGEINIEEGLGPVLGDKQALNRIFTNLIENIIKHGEG----EVKISLKKKNKYIVMEFSNKAEELEPKDVNRIFEKFFTKDRMRTG--QNTGLGLAIVKLLVEKQGQKIEAKKV-GNRLVINIIWSLES........ 287
53 -62.000IDP04365 sensory box histidine kinase [Clostridium perfringens ATCC 13124] CPF_1523 [Clostridium perfringens ATCC 13124]  ali follow..  25  385........................................................................................................................................................................................................................................................TEEYKMEKNLKLEEQRLRGVTENIKDLIFTIDVEGKISYVNKAVIDVLGYSEEELIGKNYYDLLLVESNLNIIDSKYFNEDKILTIDKKGLVQLESISSRIKDNKNNTLGWVRVARNIEDVREIEKVRSEFFANLSHELRTPINIIYSCIQLLNTSKKNKANLYDKYEKTLKQNCFRMLRLVNNLIDITKIDSGFIKMDFINYDIIKLTEDITMSVIPYVESKNIDIDTNCEELEIRCDPDKIERIILNLLSNAIKFTEPGGKIEVSIFADE--TWVDIRVKDTGIGIPSHMKEFIFERFIQNDKSLNRNKEGSGIGLSLVKSLVELHEGKVFLRESNESGSEFSILLPNVKLENDVCEN 764
54 -61.900IDP04498 sensor kinase citA [Vibrio cholerae O1 biovar eltor str. N16961] VC0791 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  17  11.TKVCQTLSFQQRVGALLVAMVVIQLSLVAGFFHQTLSETLQDQISTKALIQAREIAT--DPNLIVLIQQNRLAEVQAKIDRLQRISDANFIVIGDANGIRIAHPDEQ---KIGLPMQGGDSRRALKEGEYYTS---TQKGSLGWAIRGKAAIVAPSGEILGVVSVGYLLDNISSWLRVYSYPVIFTVLLLMLLSALGAWIFTRHIKQQMFNME-----------------------------------------EEIAMNLNLQQSILQSVYEGIVAISLKGEILSVNAKALNILGIQPTHLIGRNVQEFITPTCFFMGASPFGNRVSQQDELISCNGETLVANRVPIN-SGQQQIGWVVSFRRRNDFNTLTRQHNDNLRVMSHEFANRLSTIGGLIQI---------GAYDEAVKTIRRETAEQQQLIDFIAQTFH---------------PKVIAGLLLGKYSRAKELGLCLEFDPLSEPQCMTSDELAAVLGNLLDNAFKNPHSNKTISLLL--TDNGAELVIEVADNGIGISADIAQTLFLKGVS-----SKNQEGHGIGLYLVHQFVTQAHGSILIDSAEPQGTIFSIFIPNRPKTLAAENL 558
55 -61.600IDP04272 lantibiotic biosynthesis sensor histidine kinase, putative [Bacillus anthracis str. `Ames Ancestor`] GBAA3899 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  17  1MEKVKKQVNLSKILIQYIFAFSIGTIALVTFFMI-----LFQVGVNAEIILPANYYEKQIESQRDAIVKAEQEDDQI---------LKQYKYALYDFSGNVIQGSINKD----------------------YAGQIWNNIHNDEKGDSKYYYAIIERDKDICVILYTLHATFKNPILQKYVPSIVLFILLFVAEVIFLSRSFGKSLSKEMMILRKVTDKIQKEDLDFQVEQSKIKEVNEVLTSLVKMKDELNHS---------------------------------------------------------------------------------------------------------------LRTQWNMETNRREQIAALAHDIKTPLTILRGNAELLNESMLDSNQ--KKCNEHILKSIDEMEIYMKSLLDITKCEEG-APLQFMQTDLRDFIHNIIEESAICVLGKQLNLNVQDIPNFIPIDETALKRAIMNIMMNAIEYSPTKGDLMFSVEMIS--EKLQFIVEDSGRGFTEEEMHSATEQFYRGDKSRNAK-DHHGMGLYIAKSFAKQHGGNLYLSNEKLHGAKVVLEIS........... 452
56 -61.400IDP04227 sensory box histidine kinase [Clostridium perfringens ATCC 13124] CPF_0198 [Clostridium perfringens ATCC 13124]  ali follow..  26  390........................................................................................................................................................................................................................................................TEEYTLTKNIKRNEQLLSCINNNVQDLIISVDNNGLITYVNDSVLKTLNYTYEEIIGMPIINLLGKNDLNQLKLEDEEDSIKCKLVGKHSFVYVESIIRTLNDNNEIPYGKVIVAKNLTSKKRLEQIRNEFFANISHELRTPLNIIYSTIQLLNTDPMDFNNFYDKYKQGLKINCYRMLRLINNLIDVSKIEVGFLKADFTNRDIVFLVENIVSLVIPHSENKDINIDTNVEENIIKCDPVKIERLILNLLSNAIKFTQNHGEIFVDLNISK--DWVKISIKDNGIGIPKEMQASIFDRFVQADKSLKRRNEGSGIGLSIVKSIAELHDGKIELISDGIKGSEFIVWLPNVKLNYTEESN 768
57 -61.100IDP04132 putative two-component system sensor kinase [Yersinia pestis CO92] YPO2997 [Yersinia pestis CO92]  ali follow..  20  1.....MRGRLFWKILLGFWLTFILMTQMLW-VIFSFYGHRHEPPENDLVRQIARLQVVSAASVLHTGGQPALNAMMAD-----WPEADKKYFSVLPAEMADTAEKDISALSGEEPKLYSSEIVTWVTAPDKENYRVSYDIEG---------------------LRAANLANAPDKHRREILNVPIPMIWMGVLGGLFFSTLLAWNLTRPMRQLRVGFERVAQGDLSVRLLRRRHDELTEVARDFDSMAERLQ----------------------------------------------------------------------------------------------------------------------ALVSAREQLLHDVSHELRSPLARLQLAIGLAHQN----PDNVDNALQRIEHESERLDKMIGELLALSRAENHSLADDDEYFDLQELVKVVVNDARYEAQLPGVEIQLEQSEYTVKGNAELMRRAIENIVRNALRFSASGQQVKVTLSALD--KRYQIQVADQGPGVEENKLSSIFDPFVRVKSAMSG--KGYGLGLAITHKVILAHGGQVEARNGEQGGLVITLRVPRWQA....... 449
58 -60.800IDP04104 gene: rstB; two-component regulatory system, sensor kinase protein [Yersinia pestis CO92] YPO2309 [Yersinia pestis CO92]  ali follow..  22  111.....................................................................................................................................................................LAVGPVPYLFYLHQMRLLDLALLILIGLSLALPVFLWMRPHWKDLLKLENAAQRLGSGHLDERTHFDPTSSLSRLGVAFNQMADNIN----------------------------------------------------------------------------------------------------------------------TLIVSKKLLIDGIAHELRTPLVRLRYRLAMSDNLTESE-------QQALHHDIGQLEALIDELLTYARLDRPQVSLNLEPIDLPAWLTTKIMDIRSIHQEREIELDIPHRGDFGAVDLRLMERVLDNLVNNALRYSHQRLRIGLWF----DGDNACLQVEDDGPGIPPEERTRIFEPFVRLDPSRDRATGGCGLGLAIVHSIALAYQGSISVNTSPLGGASFRFSWPIKTHLPLSADQ 424
59 -60.600IDP91425 aerobic respiration control sensor protein ArcB [Vibrio vulnificus CMCP6] VV1_0550 [Vibrio vulnificus CMCP6]  ali follow..  22  141........................................................................................................................................................................................................................................................FQRERTQVELAERTALLRSFIDASPDLIYYRNAEGVFSGCNRAMEELTGKKEHQLVGLSPWDVYSKEVAQQIVDTDQQTYEQWLEYPDGRKHYFELRKVPFYSKDGRHLGLVGFGRDITERKRHERDKTTFISTISHELRTPLNGIVGLSRMLLDTRLTDEQ--RKYMQTINVSAITLGNIFNDIIDMDKFDRRKLELLPAPLNFEDFVAEIESISALMAEQKGLRFDLERLS-AIEVDATRLRQVIWNLISNAMKFTKEGGVMTVSSEVEEDFATIIIEVEDTGIGIPEAELDKIFAMYYQVKSGKDNLHAGTGIGLAVSRQLINMMDGDITVSSEEGFGSTFTISIHVPVIESAP... 515
60 -60.000IDP90001 gene: qseC; sensor histidine kinase FTT0094c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  18  2FLKNKKESSILSFLVVSFASFFAVFMLVISIFSFYQVKHQNDSLLDYQLRTAAEVIETVLKIYPLEDDENTTHMIMNRISNSFLNINKSIGFIVYDRKHKKLLLKTSNL----------PNFHKNYDGITSTTGFEWVYTNEEDGQKNWYTYTLKTDNGN--LITVFANDTIKDKISRQIIFKFALLLASTYIVLIGFIYYILKTALHPLERINKRVAKINPRKNEKLNEDVIPYEIKSIVDQINLLIEKFHETLER----------------------------------------------------------------------------------------------------------------------EKRFSGDAAHELKTPIAGVKTLVEIALAS--DDIDEIKQKLERIKSSTNRYSHIIDQLLTLSRIQPNEQVTFGKKLMINKVLESFIAENAIKAIEKNIEIVFYQQHLYCYSNDYLLGILFKNLISNAIKYTPNGGLIEISSYQEE--NNIVVEIKDNGIGVPQENIERIFDRFYRETGTGE---EGSGLGLAIVAEIVRLHNGKIFAQNNIQKGLTITVKIPIDHKYEEN... 475
61 -59.700IDP04431 sensor histidine kinase [Bacillus anthracis str. `Ames Ancestor`] GBAA5088 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  19  98........................................................................................................................................................................................................................................................................................................................................................................LFQKELQSYEVKQQEHQLFINHWVHQMKTPVSVMQLMVLEMEDE---------HLIPKFKKELERLNQGLDMALYMARLNNFHEDFHVETISLKDTVTKNINGLKELFIRNGVFPVLEHSDLKVASDAKWLKFIIYQLMTNAVRYSGERGKK-VFLSAYRNGKDIILEVRDEGVGIPQEDIRRVFEPFYTGKNGRTFG-ESTGMGLYIVSKICDYLGHSVKLDSEVGKGTTIKIIFHNAANNQSEQTE 335
62 -58.800IDP02394 gene: phoQ; sensor protein PhoQ [Yersinia pestis CO92] YPO1633 [Yersinia pestis CO92]  ali follow..  16  2LRKNNKPFSLRARFLMATAGVILALSLSYGMVAVVGYIVSFDKSTFRAHRGESNLFFSLAQWHNNKLSISV---------PPELELNVPSLVLIYDKDGNILWRQRHGFYELDTGTHISRMMMGDNPKAQDQLKKYDDTDDSALTHSVSVNTYAATSRLPQLTIVVVDTIPQELQRTDLVWNWFSYVLLANLLLVIPLLWLAAYWSLRPIKALASQISQLEKGERE-QLDENPPRELQSLVRNLNILLMNERQRYTK----------------------------------------------------------------------------------------------------------------------YRTTLADLTHSLKTPLAVLQTTLRSLRTG---KQTTIEEVEPIMLEQISRISQQIGYYLHRASMRSEHNVLGREIHSVPALLDSLYSALNKVYQRKGIALTLDSPEVTFLGEKNDFMEVMGNVLENACKYCLEFVEVTTL----HSEKQLTIVVDDDGPGIPENKRQLIFQRGQRVDTLR----PGQGLGLSIAAEIIEQYQGKISITESPLGGARMMVTFGQQQDCHDD... 484
63 -58.700IDP04569 sensor histidine kinase [Clostridium perfringens ATCC 13124] CPF_2242 [Clostridium perfringens ATCC 13124]  ali follow..  19  241......................................................................................................................................................................................................................................IDKNKKLKILNKKMEESNNEFKEFKKKLRDNEIYFRNFLNNAPMSIAILNNDNRIFAVNKRFSHELNLKSREVINKNLFKIINIENKEEFLRTK----KGEASFVTSGIEVFWELDILL----QSKGYLIISMKNITELKFSEQIKNDFLSSISHDLKTPINVIYSSVQVQEKFYSNEIKKVDYYNQVNKENCMTLLRLANNLIDSSKIDYDYLKPNFKIYNIVTLIEDSIGNLAEYIKEKNLTYDTNEEEVYVNCDQEFIQRIILNLISNSIKHTREGG---IGVEIKAKKSKVIISFTDTGEGMDKEFIEKAFLRYSKGNKKGVKN-KSTGIGLYIVKNLVELQNGTININSIKDTGTNIRLEFSREKSCG..... 619
64 -58.600IDP04271 sensor histidine kinase [Clostridium perfringens ATCC 13124] CPF_2241 [Clostridium perfringens ATCC 13124]  ali follow..  17  264......................................................................................................................................................................................................................................LLKRGEFKRNKRYLRKKIEELKELENLLDREELLFNNITSAIGDYIF-ISKDEKLFYLNDEALEFLEVENKESILFESMEVLYEKILEKQVYLKEKGSMDSYKEIIFKNIKGGYSNGEFYTIPFGDNYKIIIINDITKKNNALNIKGEFFTNICHELRTPINVISSALQLNNLNIENKLNSIERNNLVIKQNCLRLIRTINNFIDANKISEGQIEENVMVLNVVEVVENILDASSEYISKKKINFDPDFEEIFIAIDSEFLERIILNLLSNSVKYGSENGNIYVKIYFEG--KDLVIMIENDGIAISYDEQKYIFDKFTKSNKALNRTQEGSGLGLYISKSLMKMQGGDLKVDIYEGHGNRFKLYFYDVDLFKETDRT 654
65 -58.600IDP04543 sensor histidine kinase/response regulator [Vibrio cholerae O1 biovar El Tor str. N16961] VC2453 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  20  1...MTQRYGLRARVMTLTLAPTLIIGLLLSALFSFNRYHDLETQVINSGASIIEPLAIASEDALRMQSRESVRRIISYAHRK--NSKLVRSIAVFDANHELFVTSNFHPNFEKLMYPKDKPIPFLSSSVIDENTLILR-TPIISERTVLDNGDANPATPVMGYIAIELDLSSLRLQQYQEIFSAGLVLVIGILLSGVFASRLMYDVTRPITHMKNMVDRIRRGHLDVRIEGKMHGELDTLKKGINAMAVSLSEYHVEMQHSIDQATSDLRETLEQLEIQNVE--LDIAKKRAQE-----------------------------------------------------------------------------AARVKSEFLANMSHELRTPLNGVIGFTRQMLKTQLTNSQ--ADYLQTIEKSANNLLTIINDILDFSKLEAGKLALENIPFEFQEVLEEVVNLQATSAHEKGLEITLPKIPRGVVGDPLRIQQVLTNLVGNSIKFT-ERGNIDVSVEMRALRDDLQFMVRDTGIGISERQQAQLFQAFSQADASISRRYGGTGLGLVITQKLVSHMGGEISLTSRLHQGSTFWFTLRLHTTELP.... 522
66 -58.400IDP04236 sensor histidine kinase [Clostridium perfringens ATCC 13124] CPF_0837 [Clostridium perfringens ATCC 13124]  ali follow..  20  106.........................................................................................................................................................................................................................................................................................................................................................................MHEHVKKYILEQKEYREYIETWVHEIKTPIASTRLILENNESE----------SSENIKKEIKKIEEYIDQALYYARSTDVSKDYIVKEFSLGKSVRNVIKKNSRDFINKRIAIYLEDLDYKVYSDEKWVEFIINQVINNSIKYSSKNSRVKIFANKSK--NSITLKIKDSGVGIPNKDLGRVFEKGFTGENGR-RFTKSTGMGLYLCKNLCDKLGLGLKITSKENEGTEVSIIFPIGD........ 331
67 -57.600IDP04505 sensor histidine kinase [Vibrio cholerae O1 biovar eltor str. N16961] VCA0531 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  20  87.........................................................................................................................................................................................VITYAVLAFSGIFAVNITQAQRKQIEKNKRLQQQHKK-------------ELACHLSALSTSEDIAQATVKFLSKEKGIVSAIALYQPQWQWVAQHADFPVAAIELPQPPLTDNTSTLVQDEQINAFTLVDRGTILGVIYPHERFASPEALRRESKIAPWVRSLLTLSLARAHAHRTLAHVEAEKQLESTRTTLLASVSHDLKTPLGAIIGSATTLTDPSLHSTETQQELLTSIAEQGERLNRSLTKLLDITRYTASALVPKLDWVEPEELIGTVLSRLAPRLTHHKV--QIESQPMLVELDSLLIEQVLINLVENAAKYTPRGSEIEIACAYQE--QQFTLAVMDNGAGIPDEALPRIFDRFYRVEGNHA---DGTGLGLAICQVIVAAHQGSIRVHNRESGGACFTVTIPCRQYNLKELYE 496
68 -57.400IDP04180 C4-dicarboxylate transport sensor protein, putative [Vibrio cholerae O1 biovar eltor str. N16961] VCA0141 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  15  8.................WIVLVILLLIAVRWGSHAVSENWQLRQAQRHGEQRLLDYISDVRRTLSRQGDDRPQAQLQQQLAQLDKAANTKGWYILTLSGSLLTASKNAEN---KLSDGKAIIHKILQQREG---ISIVTKSVGSTPTYFVAAPVYLDVEIVGAVAVQVDLNVLADQWFASDELILFQNSQRHYFLSSSSVYSADWIATHPEVVAAAQKRSLFDGTRLTLWQVEQAPYLAQSVTLDDLNWTLAKIQHVLFEAEERQRNMINKTHVGLLLIDGQGRIEEINPMAKRYFSLSDSMVRQLQAWSLFDTGNPNATVPLLLKNTNVETVARRSDGSLFPVLFSLIAVSWKDRRHYLVTLIDISKRKKAEIALQRMSSAITHELNQPLTGLRTLLSSNEL-ERGETQLLKANTKLVHSLIDRMAAMTSQLKSFAF----NRPDALQAISLPDALQEILRIHQARLTPVDVRVRLSSDLPLVMGEEQRLRQVLGNLVSNALDAMSQTLEPKLSISAVSEEDQVIVRVSDNGCGIAPELLTTMFEPFQT-----SKKMGGLGLGLAIVANSLRDMQGSIVATNNPDAGMSFEIRLRAAQ........ 684
69 -56.800IDP04382 sensor histidine kinase [Clostridium perfringens ATCC 13124] CPF_0116 [Clostridium perfringens ATCC 13124]  ali follow..  19  106.........................................................................................................................................................................................................................................................................................................................................................................MNDEIGEFKRGINDYREYIELWVHEIKTPIATCKLLIENNES----------PLTESIGEEVCKLENYIDQALFYTRSNTLEKDYIIKEMSLSSCVNKVLNNNADSLIKKRVKISLGDLEKQVYSDSKWIEFILGQIISNSIKYMNKEHK-ELKIYCNENSKYVILNIEDNGAGISEKDISRVFDKGFTGENGRKFG-KSTGIGLYLCKKLCKKLGLDIKLISEEGKFTRVSIIFPINR........ 332
70 -56.700IDP04484 gene: barA; two-component regulatory protein [Yersinia pestis CO92] YPO3381 [Yersinia pestis CO92]  ali follow..  19  5........SLRARMMILILAPTLLLGLLLSTSFMVNRYNELQNQIVSAGTNIIEPLAVASEYGMSFRNRDTVRQLINLLHRR--HSNIVRSISVFDVDNKLFVTSNYNYNSSQLRLPPGEPVPDSLMLSYRGDSLILRMP-SESNLSSEQASGQGESDQILGYIAIDLDLQSVRLKQYKEIFISTLLLLFCMCVAILFAYRLMRDVTGPIRNMVNTVDRIRRGQLDSRVEGHMLGELDILKNGINSMAMSLAAYHEEMQQNIDQATSDLRETLEQMEIQNVE--LGLAKKRA-----------------------------------------------------------------------------QEASRIKSEFLANMSHELRTPLNGVIGFTRQTLKTSLTPTQ--TDYLQTIQRSANNLLCIINDVLDFSKLEADKLILEHIPFSLRETLDEVIILLAHTAHEKGLELTLNDVPDQVLGDAMRLQQIVTNLLGNAIKFT-EEGNIDILVVVKAIASQLMVEIHDTGIGISESQQAQLFQAFRQADASTSRRHGGTGLGLVITERLVKEMGGNISFQSQMSCGSIFRFHLTLELNES..... 522
71 -56.200IDP04166 sensory box sensor histidine kinase/response regulator VieS [Vibrio cholerae O1 biovar eltor str. N16961] VC1653 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  22  475..................................................................................................................................................................................................................................................RLRGKLRSSEQVAKLSTEQLRWLTELLDAIPSMIFISDAKGEVVLTNAAYRKIYHTCCEKGCVQPQPECSFLALPDQHEAEFSIIIQAPKSNCSIGEHYFHVTRRAISHPINQRKYYLTLFNDITELKETEEARNHFLAVVSHELRTPIAAMLGLMEILASRLKSSES--QLLLTNAISSAERLKLHVNDILDFSKIEAQQLQLDIGLYNLADELGPLLRGFEASAQLKEIEFDVPNSLLLANFDALRFNQIVTNLLSNAIKFTDQG---RVVFKIDVAPEMLTIVVEDTGCGMTQTQIESLFVPFAQADSTITRRFGGTGLGMSIVANLIELMNGKIEVKSEFEQGTQIQVNLPLVTQTCDE... 849
72 -56.100IDP04148 gene: basS; two-component system sensor protein [Yersinia pestis CO92] YPO3508 [Yersinia pestis CO92]  ali follow..  20  38..............................................................................................................................................................LVDETLSAKARNEQVDKEIAEAIASLLAPSLIMMTITLLLSFWAISWIIRPLDQLQQKLAERSADNLSPLVVNSEMQEIVSVTSTLNQLLLRLSNTIQQ----------------------------------------------------------------------------------------------------------------------ERLFTADAAHELRTPLAGIRLHLELMEKQGIAE-------SKSLINRIDLLMHTIEQLLMLSRAGQNFASGHYQTLDVNDVVPPLQEELAEMCELRRQTIQWEPPHAKMEGDATLLRLMLRNLVENAHRYSPVGSQIIVTLSTE--NQGVLLQVTDEGPGIKQNQAGELTQAFRRMDQRY----GGSGLGLNIVIRIAQLHQGKLTLENRLRTGLKAQCWLPATTYSQK.... 355
73 -55.700IDP04540 sensor histidine kinase [Clostridium perfringens ATCC 13124] CPF_0511 [Clostridium perfringens ATCC 13124]  ali follow..  17  1.....MKVKFENKILLWAILITFIPLALSFTLFIEDKLSYMDEDVRNTLKETAFSISEI-PFIQEDLSNGEINSRIQEYTKHFIEAINDVDIVVADMRGVKYSHLDEK---QIGQVFVNEDKKEVLTQGSSYYS---LMKGSMGETLRWFQ-PVMYNGKQVGFIMVGKYYNEIQLLTHKTLIKYMGLFILVFLITILISKLFARKVKKAILGM-------------------EPEEIAALY---------------------KEKKIILNTVSEGIIALNKNNEITEINDNCYKLIDGFSKYKVLKKLLPYIE------------ENKPVEMKEIILQGKKVFVTIQPIM-KKGEYLGSVITLMDRNDIRKIADEVVKNLRANVHEFRNNLHVILGLIQ------LGEYEEARKYILKTQKVHENNSLKFSNVED-------------------YYVRGLLLSRELVAKERGVNFILTEESNHNYVDSYDIVTILGNLIENAFCSSSYNKEVEVTL--YEDDEKIELQVRDNGKPIDNNIKERIFELGV------SSKGEGRGTGLSLVKNRVELYDGCIDIEEF-NEEKIFIITILKGEK....... 516
74 -54.600IDP04437 gene: glnR; Two component regulatory protein involved in nitrogen assimilation [Yersinia pestis CO92] YPO0023 [Yersinia pestis CO92]  ali follow..  18  2.................................................................................................................................................................................................................................................................ATGTLPDAGQILNTLINSILLLDDDLAIHYANPAAQQLLAQSSRKLFGTPLPDLLGYFSNIVLMRESLQAGQGFTDNEVTLVVDGRAHILSLTAQSLAEGFILLELAPMDNQRRLSQEQLDLVRGLAHEIKNPLGGLRGAAQLLAKALPDPA--LLEYTQVIIEQADRLRNLVDRLLGPQR------PGQHITQSIHQVAERVCQLVSLEKPDNTLIRDYDPSLPELAHDPDQIEQVLLNITRNALQALGEGGTITLRTRTMRYRLAARIDIEDDGPGVPTQLQDTVFYPMV------SGREGGTGLGLSIARNLIDQHSGKIEFNSWPG-HTEFSVYLPIRQ........ 349
75 -54.000IDP04733 two component system histidine kinase [Coxiella burnetii RSA 493] CBU_0789 [Coxiella burnetii RSA 493]  ali follow..  20  142........................................................................................................................................................................................................................................................TQLQLVSGELKSKIFFYENILSKLPTNVYWKDKNSVYLGCNERLARVMGLPSRKIEGMTDFDFVWGKEAAKSFIEFDQK-EDVFKEASGNIVTVLTNKTPLKNEHGETIGVLAISVDITELKKTQKAKSEFIANMSHDIRTPIAGMLGMLQDLLNVAEETKETVQRDSELLMGATDELLQLCNEILEVIRLESGKESEQSEAFDLRELIKRTIELLQPVAHQKKLTLACEVDE-YLDGIRMYLSRTLLNLISNALKFTEN-GFVKVKVRLSDKTNSIQIAVEDTGMGIPRDKFDTIFEHFSRLTPSYEGLYKGAGLGLYTVKRYVDAMGGEITVDSEVGKGTCFTVIIPFTVADHAERTN 547

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 1 4 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Nika K, Tautz L, Saito K, Cerignoli F, Friedberg I, Godzik A, Mustelin T. Identification and characterization of DUSP27, a novel dual-specific protein phosphatase. FEBS Lett. 2007 May 29;581(13):2527-33. Epub 2007 Apr 30.