current user: public

If you have questions about the server, please let us know.

Query: gi|15923007|ref|NP_370541.1| adenylosuccinate synthetase (SAV0017) [Staphylococcus aureus subsp. aureus Mu50], from S.aureus

Results of FFAS03 search in PDB1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .
# Score Template Links and tools%idFirst MSSIVVVGTQWGDEGKGKITDFLAEQSDVIARFSGGNNAGHTIQFGGETYKLHLVPSGIFYKDKLAVIGNGVVVDPVALLKELDGLNERGIPTSNLRISNRAQVILPYHLAQDEYEERLRGDNKIGTTKKGIGPAYVDKVQRIGIRMADLLEKETFERLLKSNIEYKQAYFKGMFNETCPSFDDIFEEYYAAGQRLKEFVTDTSKILDDAFVADEKVLFEGAQGVMLDIDHGTYPFVTSSNPIAGNVTVGTGVGPTFVSKVIGVCKAYTSRVGDGPFPTELFDEDGHHIREVGREYGTTTGRPRRVGWFDSVVLRHSRRVSGITDLSINSIDVLTGLDTVKICTAYELDGKEITEYPANLDQLKRCKPIFEELPGWTEDVTSVRTLEELPENARKYLERISELCNVQISIFSVGPDREQTNLLKELWLast
1 -137.0004m0g_A mol:protein length:432 Adenylosuccinate synthetase  ali model follow..  70  4MSSVVVVGTQWGDEGKGKITDFLSEHAEVVARYQGGNNAGHTIVFGGVKYKLHLIPSGIFYKEKICVIGNGLVVDPKALLEELKYLHDRGVSTDNLRVSNRAHVILPYHLKQDELEEASKGDNKIGTTKKGIGPAYMDKAARIGIRMADLLDREAFKEKLEQNLAQKNRLFEKMYDTEGFSVDEIFEEYFEYGQQIAQYVCDTSVVLNDALDNNHRVLFEGAQGVMLDIDHGTYPFVTSSNPIAGGVTVGTGVGPAKVTRVVGVCKAYTSRVGDGPFPTELHDEIGHQIREVGREYGTTTGRPRRVGWFDSVVVRHARRVSGLTDLSLNSIDVLTGIPTLKICVAYKCDGKVIDEVPANLNILAKCEPVCEELPGWTEDITGVRSLDELPENARKYVERVSELTGIQLSMFSVGPDRNQTNIVRNVY 430
2 -133.0003ue9_A mol:protein length:452 Adenylosuccinate synthetase  ali model follow..  44  16.RNVVVVGTQWGDEGKGKIVDWLTDHAQGVVRFQGGHNAGHTLIIGGKKTILRLIPSGIMREGVACYIGNGVVLSPEALFKEIGELEEAGLSRERLFISEATTLILPYHIAIDQAREARKGAGKIGTTGRGIGPAYEDKVGRRALRVQDLFDARTFADRLRENLDFHNFVLTQYLGGAAVDFQATLDTMLGYADRLRPMVADVSRRLYEENHAGRNLLFEGAQGTLLDIDHGTYPFVTSSNCVAGAAAAGAGVGPQKLNYILGITKAYCTRVGSGPFPSELYDQIGITLANVGKEFGSVTGRPRRTGWLDAAALRRSIQINGVSGLCMTKLDVLDGLDEVKLCVGYKIDGEDADLLPRGAAEVARCEPVYETFGGWKESTVGINSWDALPANARAYLTRVQEVAGVPIDMVSTGPDRDETILLRHPF 450
3 -133.0003hid_A mol:protein length:432 Adenylosuccinate synthetase  ali model follow..  45  3.KNVVVLGTQWGDEGKGKVVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILRENVISIIGNGVVLAPDALMKEMTELEARGVPRERLLLSEACPLILPYHVALDNAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVSDLFNKETFAIKLKEIVEYHNFQLVHYYKEAAVDYQKVLDDVLAIADILTAMVVDVSELLDNARKQGELIMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDYVLGIVKAYSTRVGAGPFPTELNDETGEFLRKQGNEYGATTGRSRRTGWLDIVAVRRAVQINSLSGFCMTKLDVLDGLKEVKLCVGYRMPDGREDTTPLAAEGWEGIEPIYETMPGWSETTFGVKEHSKLPQAALNYIQRVEELTGVPIDIISTGPDRDETMILRDPF 430
4 -133.0006bs7_A mol:protein length:439 Adenylosuccinate synthetase  ali model follow..  44  5.KNVVVLGTQWGDEGKGKIVDLLTQDAQVVVRYQGGHNAGHTLKINGVKTVLRLIPSGMLRPNVTCYIANGVVLSPQALLSEIKELEGNGINRERLRISLACPLILPYHIALDKARETHMGKSAIGTTGRGIGPAYEDKVARRALRVGDLFHRDRFANKLTELLDYHNFVLTQYFKQPAVDLESLLGESLQWAEELRPMVCDVSACLHEHRKQGENILFEGAQGVYLDIDHGTYPYVTSSNTCVGSVINGAGFGPRYIDYVLGITKAYTTRVGGGPFPTELLDDVGKRIAERGQEFGAVTGRPRRCGWFDAVLLKRSIELNSISGLCVTKLDVLDGLEVLRIAVAYKDRDGNISRPPLAADDFNDLLPVYEELPGWQESTADVTVMSDLPANARAYLKRIEEILGIPIDMLSTGPERDSTITLRGPF 432
5 -130.0001iwe_A mol:protein length:457 Adenylosuccinate Synthetase  ali model follow..  39  32.RVTVVLGAQWGDEGKGKVVDLLATDADIVSRCQGGNNAGHTVVVDGKEYDFHLLPSGIINTKAVSFIGNGVVIHLPGLFEEAEKNEKKGLKDKRLIISDRAHLVFDFHQAVDGLQEVQRQAKNIGTTKKGIGPTYSSKAARTGLRICDLLSDFDEFSAR---FKNLAHQHQSMFPTLEIDVEGQLKRLKGFAERIRPMVRDGVYFMEALHGPPKKVLVEGANAALLDIDFGTYPFVTSSNCTVGGVCTGLGIPPQNIGDVYGVVKAYTTRVGIGAFPTEQINEIGDLLQNRGHEWGVTTGRKRRCGWLDLMILRYAHMVNGFTALALTKLDILDVLSEIKVGISYKLNGKRIPYFPANQEILQKVEVEYETLPGWKADTTGARKWEDLPPQAQSYVRFVENHMGVAVKWVGVGKSRESMIQL.... 456
6 -130.0001kjx_A mol:protein length:432 Adenylosuccinate Synthetase  ali model follow..  46  3.NNVVVLGTQWGDEGKGKIVDLLTERAKYVVRYQGGHNAGHTLVINGEKTVLHLIPSGILRENVTSIIGNGVVLSPAALMKEMKELEDRGIPRERLLLSEACPLILDYHVALDNAREKARGAKAIGTTGRGIGPAYEDKVARRGLRVGDLFDKETFAEKLKEVMEYHNFQLVNYYKAEAVDYQKVLDDTMAVADILTSMVVDVSDLLDQARQRGDFVMFEGAQGTLLDIDHGTYPYVTSSNTTAGGVATGSGLGPRYVDYVLGILKAYSTRVGAGPFPTELFDETGEFLCKQGNEFGATTGRRRRTGWLDTVAVRRAVQLNSLSGFCLTKLDVLDGLKEVKLCVAYRMPDGRETTTPLAADDWKGVEPIYETMPGWSESTFGVKDRSGLPQAALNYIKRIEELTGVPIDIISTGPDRTETMILRDPF 430
7 -129.0002v40_A mol:protein length:459 ADENYLOSUCCINATE SYNTHETASE ISOZYME 2  ali model follow..  39  26.RVTVVLGAQWGDEGKGKVVDLLAQDADIVCRCQGGNNAGHTVVVDSVEYDFHLLPSGIINPNVTAFIGNGVVIHLPGLFEEAEKNVQKGKGEKRLIISDRAHIVFDFHQAADGIQEQQRQEQALGTTKKGIGPVYSSKAARSGLRMCDLVSDFDGFSERFKVLANQ---YKSIYPTLEIDIEGELQKLKGYMEKIKPMVRDGVYFLEALHGPPKKILVEGANAALLDIDFGTYPFVTSSNCTVGGVCTGLGMPPQNVGEVYGVVKAYTTRVGIGAFPTEQDNEIGELLQTRGREFGVTTGRKRRCGWLDLVLLKYAHMINGFTALALTKLDILDMFTEIKVGVAYKLDGEIIPHIPANQEVLNKVEVQYKTLPGWNTDISNARAFKELPVNAQNYVRFIEDELQIPVKWIGVGKSRESMIQL.... 452
8 -124.0005i33_A mol:protein length:441 Adenylosuccinate synthetase  ali model follow..  41  12.GVTVVLGAQWGDEGKGKLVDILAAEADICARCAGGNNAGHTIVVRNDSYAFNLLPSGLINPECTAFIGSGVVVHVPSLFNELDTLERKGLKAGRLLVSDRAHLVMGFHQIVDGLKEVELGGSSIGTTRKGIGPAYSSKASRSGLRVHHLFDPTFPAKFRKLVEGRFKR-----YGHFEFDTEGEIEMYLAFAERLRPFIVDGPTFMHNALSSGKRVLVEGANALMLDLDYGTYPFVTSSSTSIGGVVSGLGISPFAIKRVVGVIKAYTTRVGGGPFPTEDLATVGETLQEVGAEYGTVTGRRRRCGWLDLVVMKYSTMINGYTSLNLTKLDVLDGFEEIKVATGYKIDGVEVEGFPADLDRLAKVEVQYATLPGWKTDISNCKTYEEFPENAKAYIKFIEDYLGVKVQYVGVGPGRDQNVII.... 434
9 -124.0001p9b_A mol:protein length:442 Adenylosuccinate Synthetase  ali model follow..  36  15.NVVAILGAQWGDEGKGKIIDMLSEYSDITCRFNGGANAGHTISVNDKKYALHLLPCGVLYDNNISVLGNGMVIHVKSLMEEIESVGGKLL--DRLYLSNKAHILFDIHQIIDSIQETKKEGKQIGTTKRGIGPCYSTKASRIGIRLGTLKNFENFKNMYSKLIDHLMDLYNI----TEYDKEKELNLFYNYHIKLRDRIVDVISFMNTNLENNKKVLIEGANAAMLDIDFGTYPYVTSSCTTVGGVFSGLGIHHKKLNLVVGVVKSYLTRVGCGPFLTELNNDVGQYLREKGHEYGTTTKRPRRCGWLDIPMLLYVKCINSIDMINLTKLDVLSGLEEILLCVNFKNKKTGKGCYPVEEEISEEYEPVYEKFSGWKEDISTCNEFDELPENAKKYILAIEKYLKTPIVWIGVGPNRKNMIVKKNFN 440
10 -123.0003r7t_A mol:protein length:419 Adenylosuccinate synthetase  ali model follow..  43  6.KADIIVGIQWGDEGKGKVVDKLCENYDFVCRSAGGHNAGHTIWVNGVRYALHLMPSGVLHPRCINIIGNGVVVSPEVLIAEMAQFEN---LKGRLYISDRAHLNLKHHSLIDIAKEKLKGKNAIGTTGKGIGPSYADKINRTGHRVGELLEPQRLCEALIKDFEANKTFFEM-LEIEIPSAEELLADLKRFNEILTPYITDTTRMLWKALDEDKRVLLEGAQGSMLDIDHGTYPYVTSSSTISAGTLTGLGLNPKEAGNIIGIVKAYATRVGNGAFPTEDKGEDGEKIAQIGKEIGVSTGRKRRCGWFDAVAVRYTARLNGLDALSLMKLDVLDGFEKIKICRAYEYKGMEIDYIPSD---LENVQPIYEEMDGW-DKVFGIKDYDLLPENAKKYIARLEELAGVKVKYISTSPERDDTIIL.... 419
11 -122.0001dj3_A mol:protein length:442 ADENYLOSUCCINATE SYNTHETASE  ali model follow..  43  19.NVSGVLGSQWGDEGKGKLVDVLAPRFDIVARCQGGANAGHTIYNEGKKFALHLVPSGILHEGTLCVVGNGAVIHVPGFFGEIDGLQSNGVSDGRILVSDRAHLLFDLHQTVDGLREAELANSFIGTTKRGIGPCYSSKVTRNGLRVCDLRHMDTFGDKLDVLFEDAAARFEGF-KYSKGMLKEEVERYKKFAERLEPFIADTVHVLNESIRQKKKILVEGGQATMLDIDFGTYPFVTSSSPSAGGICTGLGIAPRVIGDLIGVVKAYTTRVGSGPFPTELLGEEGDVLRKAGMEFGTTTGRPRRCGWLDIVALKYCCDINGFSSLNLTKLDVLSGLPEIKLGVSYNQMDGELQSFPGDLDTLEQVQVNYEVLPGWDSDISSVRSYSELPQAARRYVERIEELAGVPVHYIGVGPGRDALIYK.... 442
12 -117.0001dj2_A mol:protein length:443 ADENYLOSUCCINATE SYNTHETASE  ali model follow..  43  20.QVSGVLGCQWGDEGKGKLVDILAQHFDIVARCQGGANAGHTIYNEGKKFALHLVPSGILNEDTTCVIGNGVVVHLPGLFKEIDGLESNGVSKGRILVSDRAHLLFDFHQEVDGLRESELAKSFIGTTKRGIGPAYSSKVIRNGIRVGDLRHMDTLPQKLDLLLSDAAARFQGFKY-TPEMLREEVEAYKRYADRLEPYITDTVHFINDSISQKKKVLVEGGQATMLDIDFGTYPFVTSSSPSAGGICTGLGIAPSVVGDLIGVVKAYTTRVGSGPFPTENLGTGGDLLRLAGQEFGTTTGRPRRCGWLDIVALKFSCQINGFASLNLTKLDVLSDLNEIQLGVAYKRSDGTPVKSPGDLRLLEELHVEYEVLPGWKSDISSVRNYSDLPKAAQQYVERIEELVGVPIHYIGIGPGRDALIYK.... 443
13 -107.0005k7x_A mol:protein length:340 Adenylosuccinate synthetase  ali model follow..  38  2MPSVIVVGGQWGDEGKGSIVAYLSLEPEIIARGGVGTNAGHSVVINGKKYAVRQIPTGFMQTKARLLIGAGVLVDPEVFFHELEQLKDFNV-KDRVGIDYRCAIIEEKHKQLDRTNGYLHG--KIGTTGSGCGPANADRVMRKAKQAKDVKE-------------------------------------------LEPYLTDVAQEINDALDEGSLVLVEGTQGFGLSLYYGTYPYVTSKDVTASSVAADVGIGPTRVDEVIVVFKSFPTRVGAGPFPTEMPMEEADRLG--LVEYGTVTGRRRRVGWFDFEMARYSARINGATMLAVTMLD------------------------------------------KYDKEAFGVTDYDKLPRKAKEFIEEIEERVGVPVGLIKTGPELEHIIDRRDT. 339

FFAS is supported by the NIH grant R01-GM087218-01
1 4 0 5 9 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Reed JC, Doctor K, Rojas A, Zapata JM, Stehlik C, Fiorentino L, Damiano J, Roth W, Matsuzawa S, Newman R, Takayama S, Marusawa H, Xu F, Salvesen G, Godzik A.; RIKEN GER Group; GSL Members. Comparative analysis of apoptosis and inflammation genes of mice and humans. Genome Res. 2003 Jun;13(6B):1376-88.