current user: public

If you have questions about the server, please let us know.

Query: gi|15923002|ref|NP_370536.1| putative homoserine-o-acetyltransferase (SAV0012) [Staphylococcus aureus subsp. aureus Mu50], from S.aureus

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .
# Score Template Links and tools%idFirst MFKEERTMTNYTVDTLNLGKFITESGEVIDNLRLRYEHVGYHGQPLVVVCHALTGNHLTYGTDDYPGWWREIIDGGYIPIHDYQFLTFDVIGSPFGSSSPLNDPHFPKKLTLRDIVRANERGIQALGYDKINILIGGSLGGMQAMELLYNQQFEVDKAIILAATSRTSSYSRAFNEIARQAIHLGGKEGLSIARQLGFLTYRSSKSYDERFTPDEVVAYQQHQGNKFKEHFDLNCYLTLLDVLDSHNIDRGRTDVTHIFKNLETKVLTMGFIDDLLYPDDQVRALGERFKYHRHFFVPDNVGHDGFLLNFSTWAPNLYHFLNLKHFKRKLast
1 -106.000d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]}  ali model 3D-neighbors follow..  26  1........SVQNVVLFDTQPLTLMLGGKLSYINVAYQTYGTLNNNAVLICHALTGDAEPYFDDGRDGWWQNFMGAGALDTDRYFFISSNVLGGCKGTTGPSSINPQFPNIVVQDIVKVQKALLEHLGISHLKAIIGGSFGGMQANQWAIDYPDFMDNIVNLCSSIYFSAEAIGFNHVMRQAVINDPNFGLSIARMLGMLTYRTDLQLAKAFGRFQVESYLSYQGKKFLERFDANSYLHLLRALDMYDPSLGYENVKEALSRIKARYTLVSVTTDQLFKPIDLYKSKQLLVDLHFYEFPSDYGHDAFLVDYDQFEKRIRDGLAGN..... 357
2 -105.000d5w8oa_ c.69.1.0 (A:) automated matches {Mycobacterium hassiacum [TaxId: 1122247]}  ali model 3D-neighbors follow..  32  1..........GELGIVDIGALTLESGAVIDNVQIAVERWGELSDNVVVVLHALTGDSHVAGNYPTPGWWDGVVGPGAIDTRRWCAIATNVLGGCRGSTGPGSLGSRFPAVTVRDQVRADLAALNAMGIHQVAAVVGGSMGGARALEWVIGHPETVRAGLILAVGARATADQIGTQSTQVAAIKADPNWGLQIARRFAHLTYRGEVELDTRFGNYAVESYLEYQGRKLVDRFDAGTYVTLTDSLSSHDVGRGRGGVEAALRSCEVPVVVGGFTSDRLYPLRLQEELAELMPGCGLNVVESIYGHDGFLIETEAVGKLIRQTLELAS.... 358
3 -102.000d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]}  ali model 3D-neighbors follow..  28  1...NRFEASLDAQDIARISLFTLESGVILRDVPVAYKSWGRMNDNCVIVCHTLTSSAHV------TSWWPTLFGQGAFDTSRYFIICLNYLGSPFGSAGPCSPDPKFPRTTIRDDVRIHRQVLDRLGVRQIAAVVGASMGGMHTLEWAFFGPEYVRKIVPIATSCRQSGWCAAWFETQRQCIYDDPKYGLETARKIANLTYKSKPAMDERFHMEAVSSYLRYQAQKFAASFDANCYIAMTLKFDTHDISRGAGSIPEALAMITQPALIICARSDGLYSFDEHVEMGRSIPNSRLCVVDTNEGHDFFVMEADKVNDAVRGFLDQ...... 376
4 -101.000d3vvma_ c.69.1.0 (A:) automated matches {Streptomyces lavendulae [TaxId: 58340]}  ali model 3D-neighbors follow..  26  1...MREFIPPASRFIELPDGFAMRRGGALYGARIAYETFGSLNDNAVLVLTALSGDAHAASDDPTPGWWEAMVGPGPVDTDLWHVICVNSLGSCKGSTGPASTDPSFPELSIEDIADAAAHTVRALGISRLACVVGASMGGMSALALLARHPELARTHISLSGAVHALPFSIAVRSLQREAIRSDPGWGMLTARKLGMMTYRSAQEWDCRFGRFEVESYLDFHAQRFADRFDPNSYLYLSHAMDQFDLGDGGGAPGALSRMRVERALVMGARTDILFPLSQQQEIADGLSDVSFLPVDTPAGHDAFLVDIERFGPPVAKFLAIVA.... 374
5 -101.000d5jkja_ c.69.1.0 (A:) automated matches {Uncultured bacterium [TaxId: 77133]}  ali model 3D-neighbors follow..  19  2..........VEKRVFEMPHFTTFGGKQIKNVKVGWEAYGTLNSNVILITHYFSGSSHAAGNDPAPGYWDSIIGPGAIDTDRFYVISVDTLANLNAYDPHVITGLDFPVVTIRDFVNVQKALLESLGISKLYAVIGPSMGSMQAIDWASAYPGWVERMISVIGAGQSDAWTTAALEHWATPITLDKNWGLAASLMLITQNALTPSFFNQTGNTHSIVNWLRERAKTRAKSMDANHLLYLVRACQLFVAGHQ-GNLEQGLASIKAKTLFIPAQTDLLLMPYLSQSAHQGLNDSTLVTLNGKLGHDEGVTNVSAQAQAIRQFLEND..... 370
6 -98.300d3i1ia_ c.69.1.0 (A:) automated matches {Bacillus anthracis [TaxId: 261594]}  ali model 3D-neighbors follow..  20  1.......MQIVKKEKFILKEYTFENGRTIP-VQMGYETYGTLNSNVILICHYFSATSHAAGHDEESGWWDGLIGPGAIDTNQYFVICTDNLCNVQVKNPHVITAMDFPVFTFLDVARMQCELIKDMGIARLHAVMGPSAGGMIAQQWAVHYPHMVERMIGVITNPQNPIISVNVAQNAIEAIRLDPSWGLQLANRMMFMNAFDEHFYETTYPRTSFEKEINKLTYRSIELVDANSWMYTAKAVLLHDIAHGFSSLEEALSNVEANVLMIPCKQDLLQPSRYNYKMVDLLQYAEVYEIESINGHMAGVFDIHLFEKKVYEFLNRKVSS.. 372
7 -39.900d3hssa1 c.69.1.0 (A:2-261) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  21  1...............................INLAYDDNG--TGDPVVFIAGRGGAGRT---------WHPHQVPAFL-AAGYRCITFDNRGIGATENAEG--------FTTQTMVADTAALIETLDIAPAR-VVGVSMGAFIAQELMVVAPELVSSAVLMATRGRLDRARQFFNKAEAELYDSGVQLPPTYDARARLLENFSRKTLNDDVAVGDWIAMFSMWPIK-----STPGLRCQLDCAPQTN-------RLPAYRNIAAPVLVIGFADDVVTPPYLGREVADALPNGRYLQIPDA-GHLGFFERPEAVNTAMLKFFASVK.... 260
8 -39.400d3qvma_ c.69.1.0 (A:) automated matches {Oleispira antarctica [TaxId: 188908]}  ali model 3D-neighbors follow..  12  13................................RNNINITGG-GEKTVLLAHGFGCDQNM---------WRFMLPE----EKQFTVIVFDYVGSGQSDLESFSTKRYS---SLEGYAKDVEEILVALDLVNVS-IIGHSVSSIIAGIASTHVGDRISDITMICPSPCFMNFPPDYVGGFERDDLE------ELINLMDKNYIGWANYLAPLVMGASHSSELIGELSGSFCTTDPIVAKTFAKATFFSD-------YRSLLEDISTPALIFQSAKDSLASPEVGQYMAENIPNSQLELIQAE-GHCLHMTDAGLITPLLIHFIQNN..... 273
9 -38.700d4pw0a_ c.69.1.0 (A:) automated matches {Chitinophaga pinensis [TaxId: 485918]}  ali model 3D-neighbors follow..  17  12...........................EVNGTRYAYRSLGAPSDIPLICFQHFTGTLDN---------WDPLITNGL--SKGRQLIIFDNKGVGLSSGTTP--------DNVAAMTADALEFITALGIRYFD-VLGFSLGGFIVQYMAHIQPDMIRKIIIVGAAPQGVKVLHTFPDLIARAMQLEPK---------RFLFIFFEQSEHSRSKGLATLGRLYERTTDRDQDASAQAIGAQLTAITNW----GKKTPSFEITSIQHPVFVVQGSNDEMMDTYNSYELFKQLPDAILSLYPDA-AHGSFYQYPELFVSQTEYFLDS...... 274
10 -37.400d3w06a_ c.69.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}  ali model 3D-neighbors follow..  12  1.........................GVV--EEAHNVKVIGS-GEATIVLGHGFGTDQSV---------WKHLVPH----VDDYRVVLYDNMGAGTTNPDYFDFDRY---SNLEGYSFDLIAILEDLKIESC-IFVGHSVSAMIGVLASLNRPDLFSKIVMISASPRYVNDVDYQGGFEQEDLN-------QLFEAIRSNYKAWCLGFAPLAVGGDMDSIAVQEFSRTLFNMRPDIALSVGQTIFQSDM-------RQILPFVTVPCHILQSVKDLAVPVVVSEYLHANLGCESVVEVIPSDGHLPQLSSPDSVIPVILRHIRND..... 266
11 -37.300d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]}  ali model 3D-neighbors follow..  6...........................PSGDVELWSDDFGDPADPALLLVMGGNLSAL---------GWPDEFARRLAD-GGLHVIRYDHRDTGRSTTRDFAAHP----YGFGELAADAVAVLDGWGVDRAH-VVGLSMGATITQVIALDHHDRLSSLTMLLGGGLDIDFDANIERVMRGEPTLDGLPGPQQPFLDALALMNQPAEGRAAEVAKRVSKWRDAEYARWEERAIDHAGGVLAEPYAHYSLTLPPPSRAAELREVTVPTLVIQAEHDPIAPAPHGKHLAGLIPTARLAEIPGM-GHALPSSVHGPLAEVILAHTRSAA.... 297
12 -36.700d4uhca1 c.69.1.0 (A:2-275) automated matches {Planctomycetes bacterium [TaxId: 1331910]}  ali model 3D-neighbors follow..  14  11...........................TPGEIELAFEDTG--TGLPVLLVHGFPLDRTM---------WKAQREE----CDEFRVIVPDLRGFGESQVIPGV-------ATMEAMADDLAGLCNHLGLTGKIVLGGLSMGGYVAFAFARKYRDRLAGLILCDTRARPDSPEA--KENRRRVAERVRREGPGFIAEEMIPRLCCESTFRNH-------PEVIEKIRQMILSAPPEGVAAAALGM------AERPDSTDLLPALSCPTLVLVGQFDAISPPEEMEAMARTIPQSQFVVIPDA-GHLPPMEQPERVTQAIREWLRKVHTE.. 273
13 -36.500d5a62a_ c.69.1.0 (A:) automated matches {Candidatus nitrososphaera [TaxId: 497727]}  ali model 3D-neighbors follow..  13  6...........................PSNSVSTYYEDHGDARSYPLVLIHPIGGNILI---------WDYEIQ--LLLKSGFRVIAYELRGHHRTNMGKTG------AYTMQDLIDDLRRLLEHLNIGKCT-IIGHSIGGIISSMYAAQHPGKVDAIIMINGSPKKFQEKDL--EKHFRTREVAITQGMKALAEHKLVSLDEARDLFA-------DKRHADFFREVFTKTSVEGFVAATVALYTIP-----GNVVQGLRASGCKVFAIVGSDDDV-FMRLIKETKEEIPEMELRVLQGS-DHWVVIEKPKEMYDILMGFLAIVTKD.. 271
14 -36.500d2ocga_ c.69.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  8...........................AVNGVQLHYQQTGEGDHAVLLLPGMLGSGETD---------FGPQLK--NLNKKLFTVVAWDPRGYGHSRPPDRD----FPADFFERDAKDAVDLMKALKFKKVS-LLGWSDGGITALIAAAKYPSYIHKMVIWGANAYVTDEDSMIYEGIRDVSKWSERTRKPLEAL-------------------------------YGYDYFARTCEKWVDGIRQFKHLPDGNICRHLLPRVQCPALIVHGEKDPLVPRFHADFIHKHVKGSRLHLMPEG-KHNLHLRFADEFNKLAEDFLQ....... 254
15 -36.300d4i3fa1 c.69.1.0 (A:1-282) automated matches {Cycloclasticus sp. [TaxId: 385025]}  ali model 3D-neighbors follow..  10  7...........................QTGSFNTFLNEAGTDKDTSILLLHGSGPGANAMSN------WQYALPF----AENYHCLAPDIAGFGLSQHNCPPNGTSH---WIDIWVQQQIDLLDAKGIEQTH-IVGNSMGGGVTLHLLNRHPERFKKAVLMGPVGAPFAPTEGLTKGWEFYKDPSKE----ALEYLITKFLFDPSLLGNDIASIAAQRFDNVMKDEVRLQFEAMFSGGTKKGIDAFVL------SDDELNNISHQMLVTHAREDFFIPLNNAYYLIDRIPNAQLHVFDHC-GHWVQIEKKKAFNNLTKLFFDGMFDD.. 282
16 -36.300d2xuaa_ c.69.1.0 (A:) automated matches {Burkholderia xenovorans [TaxId: 266265]}  ali model 3D-neighbors follow..  14  4...........................AVNGTELHYRIDGE-NAPWIVLSNSLGTDLSM---------WAPQVAA----SKHFRVLRYDTRGHGHSEAPKGP-------YTIEQLTGDVLGLMDTLKIARAN-FCGLSMGGLTGVALAARHADRIERVALCNTAARIGS-----PEVWVPRAVKARTEGMHALADAVLPRWFTADYMERE-------PVVLAMIRDVFVHTDKEGYASNCEAIDAADL-------RPEAPGIKVPALVISGTHDLAATPAQGRELAQAIAGARYVELDA--SHISNIERADAFTKTVVDFLTE...... 260
17 -36.200d5h3ha_ c.69.1.0 (A:) automated matches {Exiguobacterium antarcticum [TaxId: 1087448]}  ali model 3D-neighbors follow..  16  6..........................QAVDGTKIYVEDIG--SGQPVVMLHGWPANNNM---------FEYQK--NRLLEEGYRYIGVDYRGYGKSDAPATG-------YDYTTMASDINEVIQQLKLTNVT-LLGFSMGGGIALKYLLNHGENVSKLILAGAAAPVFTQRDGYPYGMTKDEVDALIEDTKQDRPSML------KGFGEIFFAKEHPEPLQQWFHNLSVDASSHGTIQSAIALRDED-------LRDGLPKITVDTLIMHGKKDQVCPFEFAEVMHENIAGSRLEVFEES-GHGMFLDEREKFTETLVSYVKS...... 268
18 -36.200d4rnca1 c.69.1.0 (A:1-280) automated matches {Rhodococcus sp. [TaxId: 1831]}  ali model 3D-neighbors follow..  12  1....................MSIREAVSVDGTSIVYRVTGNSAGTPLVLLHGWAQSSQC---------WGEQVLADL--AADYRLIAVDLRGHGYSDAPESGYD------DSANWAGDVAAVLAAEGVTENAILLGWSYGGLVICDYLAAHTGAVAGAVLVGAITSIGRGEKGGKVGSAMRSAVPGAMSEDPREAIRALGAFGNALTGPPEGKGAASQALFGYSLS-------------TRPRVRAALFNRAVGHDELLRNLDIPVLVLHGTDDSVVDVSAGKHAEELIPKSQASYWVGC-NHGPFVEDPTRFVSEVRTFISSLGKLA. 278
19 -35.900d5egna_ c.69.1.0 (A:) automated matches {Uncultured bacterium [TaxId: 77133]}  ali model 3D-neighbors follow..  17  4...........................ENDGVKIYYDSYG--EGVPIVFLHPFSTNGGI---------WYFQTFP----AQTNHVIVIDHRGHGRSDKPATG-------YSIMEHADDVVAVLDALKVDRAV-FVGNSIGGMIAMQLNLDHPQRVIGNLILSSGTGLG-------EGMPPEAGAAFQNDYIGAFGGLLEGAVSARSKRERPEILAVMKAHFSVPSNFPKH-VFDAATADPNGVFAWNI-------KDRLSSIQAPTLVVAGEEDLVTTVANNQLLADNIPGAELRVINDV-GHFYQLERPSEFNELLRGFVA....... 260
20 -35.100d3kxpa_ c.69.1.0 (A:) automated matches {Mesorhizobium loti [TaxId: 381]}  ali model 3D-neighbors follow..  13  8...........................DIGRITLNVREKG--SGPLMLFFHGITSNSAV---------FEPLMIR----SDRFTTIAVDQRGHGLSDKPETG-------YEANDYADDIAGLIRTLARGHA-ILVGHSLGARNSVTAAAKYPDLVRSVVAIDFTPYIETEALDALEARVNAGSQ------------LFEDIKAVEAYLAGRYPNIPADAIRIRAESGYQPVDGGLRPLASSAAMAQTARGLRSDLVPAYRDVTKPVLIVRGESSKLVSAAALAKTSRLRPDLPVVVVPGA-DHYVNEVSPEITLKAITNFIDA...... 268
21 -34.400d4nmwa_ c.69.1.26 (A:) automated matches {Salmonella enterica [TaxId: 99287]}  ali model 3D-neighbors follow..  16  1................................DIWWQTYGE-GNCHLVLLHGWGLNAEV---------WHCIREE----GSHFTLHLVDLPGYGRSSGFGA--------MTLEEMTAQ----VAKNAPDQA-IWLGWSLGGLVASQMALTHPERVQALVTVASSPCFSARE---WPGIKPEILGGFQQQLSDDFQRTVERFLALQTLGTETARQDARTL--KSVVLAQPMPDVEVLNGGLEILKTVDL-------REALKNVNMPFLRLYGYLDGLVPRKIVPLLDTLWPHSTSQIMAKA-AHAPFISHPAAFCQALMTLKSS...... 253
22 -34.200d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Thermoplasma acidophilum [TaxId: 2303]}  ali model 3D-neighbors follow..  14  4.......................ENYAKVNGIYIYYKLCKA-EKAKLMTMHGGPGMSH--------DYLLSLRD-----KEGITVLFYDQFGCGRSEEPDQS------KFTIDYGVEEAEALRSKLGNEKVF-LMGSSYGGALALAYAVKYQDHLKGLIVSGGLSSVPLTVKEMNRLIDELYGSSGSYENPEYQEAVNYFYHQHLLRSEDWPPEVLKSLEYAERRNVYRIMNGPNEFTITGTIKDWDI-------TDKISAIKIPTLITVGEYDEV-TPNVARVIHEKIAGSELHVFRDC-SHLTMWEDREGYNKLLSDFILK...... 288
23 -34.100d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]}  ali model 3D-neighbors follow..  16  9...........................LAAGVLTNYHDVG--EGQPVILIHGSGPGVSAYAN------WRLTIPA----SKFYRVIAPDMVGFGFTDRPENY------NYSKDSWVDHIIGIMDALEIEKAH-IVGNAFGGGLAIATALRYSERVDRMVLMGAAGTRFDVTEGLNAVWGYTPSIE------NMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFSSMFPEPRQRWIDALA---------SSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELIDRAQLHVFGR-CGHWTQIEQTDRFNRLVVEFFNE...... 270
24 -33.800d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]}  ali model 3D-neighbors follow..  14  10...........................PSGTLASHALVAGDPQSPAVVLLHGAGPGAHAASN------WRPIIPD----AENFFVVAPDLIGFGQSEYPETYPGHI--MSWVGMRVEQILGLMNHFGIEKSH-IVGNSMGGAVTLQLVVEAPERFDKVALMGSVGAPMNARPPELARLLAFYADPR---LTPYRELIHSFVYDPENFPG------MEEIVKSRFEVANDPEVRRIQEVMFESMKAG--MESLVIPPATLGRLPHDVLVFHGRQDRIVPLDTSLYLTKHLKHAELVVLDRC-GHWAQLERWDAMGPMLMEHFRA...... 281
25 -33.400d2xmza_ c.69.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  15  1............................MTHYKFYEANVE--TNQVLVFLHGFLSDSRT---------YHNHIEK----TDNYHVITIDLPGHGEDQSSMDE------TWNFDYITTLLDRILDKYKDKSIT-LFGYSMGGRVALYYAINGHIPISNLILESTSPGIKEEA---NQLERRLVDDARAKVLDIAGIELFVNDWEKLPLFQSQLELPVE--IQHQIRQQRLSQSPHKMAKALRDYGTGQ----MPNLWPRLKEIKVPTLILAGEYDEKFV-QIAKKMANLIPNSKCKLISAT-GHTIHVEDSDEFDTMILGFLKEEQ.... 265
26 -33.300d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]}  ali model 3D-neighbors follow..  14  8...........................NAGGVETRYLEAG--KGQPVILIHGGGAGAESEGN------WRNVIPI----ARHYRVIAMDMLGFGKTAKPDIE-------YTQDRRIRHLHDFIKAMNFDGKVSIVGNSMGGATGLGVSVLHSELVNALVLMGSAGLVVEIHEDLRPIINYDFTRE------GMVHLVKALTNDGFKIDDAMINSRYTYATDEATRK-----------AYVATMQWIREQGGLFYDPEFIRKVQVPTLVVQGKDDKVVPVETAYKFLDLIDDSWGYIIPHC-GHWAMIEHPEDFANATLSFLSLR..... 268
27 -33.000d4x00a_ c.69.1.0 (A:) automated matches {Burkholderia cenocepacia [TaxId: 216591]}  ali model 3D-neighbors follow..  14  6....................VTAPDG-----VVLAVQEAGDPEGSPIIFIHGLLGSRLN---------WSKQL--QDPRLQHYRLITYDLRGHGLSGKPAEASSYTDGRRWADDLAA----IIESTHARKP-VLVGWSLGGAVISNYLAAYGDGIAGAVYVDGVIELKPDQIVAHPEVYRDMIASDLQTHLDGERAFLRLCFHRQPDATTFSLLLANA-------------------ALASWDMQRAVRSMTVEAAKGLSKAEVPLLLLYGAQDALVKAKPSIARASLNPRIRSELYADS-GHAPFLEEPERFNRDLSDFVRMALSR.. 273
28 -32.600d2pu6a_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]}  ali model 3D-neighbors follow..  14  16...........................GFSDFNIHYNEAG--NGETVIMLHGGGPGAG--------GWSNYYRNVGPFVDAGYRVILKDSPGFNKSDAVVMD------EQRGLVNARAVKGLMDALDIDRAH-LVGNAMGGATALNFALEYPDRIGKLILMGPGGLGPSMFAPMPMEGIKLLFK-AEPSYETLKQMLQVFLYDQSLITEEL-------------QGRWEAIQRQPEHLKNFLISAQKAPLSTWDVTARLGEIKAKTFITWGRDDRFVPLDHGLKLLWNIDDARLHVFSKC-GHWAQWEHADEFNRLVIDFLRHA..... 283
29 -32.600d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]}  ali model 3D-neighbors follow..  13  9...........................NSTSIDLYYEDHG--TGQPVVLIHGFPLSGHS---------WERQSA--ALLDAGYRVITYDRRGFGQSSQPTTG-------YDYDTFAADLNTVLETLDLQDAV-LVGFSTGTGEVARYVSSYTARIAKVAFLASLEPFLLKTDDNPDGAAPQEFFDGIVAAVKADRYAFYTGFFNDFYNLD--ENLGTRISEEAVRNSWNTAASGGFFAAAAAPTTWYT-----DFRADIPRIDVPALILHGTGDRTLPIENTRVFHKALPSAEYVEVEGA-PHGLLWTHAEEVNTALLAFLAK...... 277
30 -32.400d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]}  ali model 3D-neighbors follow..  13  4..........................TTRDGVEIFYKDWG--QGRPVVFIHGWPLNGDA---------WQDQL--KAVVDAGYRGIAHDRRGHGHSTPVWDG-------YDFDTFADDLNDLLTDLDLRDV-TLVAHSMGGGELARYVGRHTGRLRSAVLLSAIPPVMIKS-DKNPDGVPDEVFDALKNGVLTERSQFWKDTAEGFFSANRPGNKVTQGNKDAFWYMAMAQTIEGGVRCVDAFGYTD-------FTEDLKKFDIPTLVVHGDDDQVVPIDATRKSAQIIPNAELKVYEGS-SHGIAMVDKEKFNRDLLEFLNK...... 274
31 -32.200d5frda1 c.69.1.0 (A:1-252) automated matches {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  12  8...........................DVDGVKVSLLK----RERKVFYIHSSGSDATQ---------WVNQL-------TAIGGYAIDLPNHGQSDTVE--------VNSVDEYAYYASESLKK-TVGKA-VVVGHSLGGAVAQKLYLRNPEICLALVLVGTGARLRVLPEILEGLKKEP-------EKAVDLMLSMAFASKGEEYEKKRREFLDRVDVLHLDLSLCDRFDLLE------------------DYRNGKLKIGVPTLVIVGEEDKLTPLKYHEFFHKHIPNSELVVIPGA-SHMVMLEKHVEFNEALEKFLKKVGVA.. 252
32 -30.900d5w15a1 c.69.1.0 (A:1-267) automated matches {Burkholderia ambifaria [TaxId: 398577]}  ali model 3D-neighbors follow..  11  9...........................NFEGHRIAWGTLG--EGPPLVLVHGTPFSSQV---------WRRIAPW----ARRHRVFFYDLLGYGQSDMPDAD-------VSLGRQNVLFGALLDEWKISRPR-VLAHDYGGATVLRAHFLDGIAYSDLTLVNPVAIAPQGSPFVRHVAQHEA-------AFTGLPAYAHHALVSAYIGQAVAQPLSDDVLSIYRAPWLTPAGQAAFYRQIAQMRQRYIE----DAEARYAPPDFPVRIVWGEDDRWIPLEQGQALADRIANGKLIRVPRA-GHLVQEDAPEAIVAAVLD.......... 266
33 -28.300d2psfa_ c.69.1.0 (A:) automated matches {Renilla reniformis [TaxId: 6136]}  ali model 3D-neighbors follow..  12  26...........................NVLDSFINYYDSEKHAENAVIFLHGNATSSYL---------WRHVVPH----EPVARCIIPDLIGMGKSGKSGNG------SYRLLDHYKYLTAWFELLNLPKKIIFVGHDWGAALAFHYAYEHQDRIKAIVHMESVVDVIESWDEWPDIEEDALIKSEEGEKMVLENNFFVETVLPSKIMRKLEPEEFAAYLEPFKEKGEVRRPTLSWPREIPLVKGGKPDVVQ-RNYNAYLRASDDLPKLFIESDPGFFSNAIVEGAKKFPNTEFVKVKG--LHFLQEDAPDEMGKYIKSFVERVLKN.. 307
34 -27.400d5esra1 c.69.1.0 (A:1-302) automated matches {Caulobacter crescentus [TaxId: 190650]}  ali model 3D-neighbors follow..  10  2.....DVLRTPDERFEGLADWSFAPHYTGTALRIHHVDEGPKDQRPILLMHGEPSWAYL---------YRKVIA--ELVAKGHRVVAPDLVGFGRSDKPAKRTD-----YTYERHVAWMSAWLEQNDLKDI-VLFCQDWGGLIGLRLVAAFPERFSAVVVSNTGLPIGVGKSEGFEAWLNFSQNTPELPVGFILNGGTARDLSDAERSAYDAPFPDESY----------KEGARIFPALVPITPEHASVEENKAAWAVLETFDKPFVTAFSDADPITRGGEAMFLARVPGTKNVAHTTLKGGHFVQEDSPVEIAALLDGLVAGLPQA.. 302
35 -27.400d3wi7a_ c.69.1.0 (A:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}  ali model 3D-neighbors follow..  15  15...........................PAFGLQIHTVEHG--SGAPIVFLHGNPTSSYL---------WRHIFRR----HGHGRLLAVDLIGYGQSSKPDIE-------YTLENQQRYVDAWFDALDLRNV-TLVLQDYGAAFGLNWASRNPDRVRAVAFFEPVLRNIDSVDLSPEFVRAKLRQPGEGEIFVQQENRFLTELFPWFFLTPLAPEDLRQYQTPFPTPHSRKAILAGPRNLPVDGEPASTVAFLEQAVNWLNTSDTPKLLLTFKPGFLLTDAILKWSQVTIRNLEIEAAGAG-IHFVQEEQPETIARLLDAWLTRIA.... 291
36 -27.000d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]}  ali model 3D-neighbors follow..  11  6..........PPLAAYDSGWLDTGDG-----HRIYWELSGNPNGKPAVFIHG------------GPGGGISPHHRQLFDPERYKVLLFDQRGCGRSRPHASL-----DNNTTWHLVADIERLREMAGVEQW-LVFGGSWGSTLALAYAQTHPERVSEMVLRGIFTLRKQRLHWYYQDGASRFFPEKDVIAAYRQRLTSADPQVQLEAAKLWSVWEGETVTLLPSRESASFGEDDFALAFARIENHY-LESDDQLLRNVPLIRHIPAVIVHGRYDMACQVQNAWDLAKAWPEAELHIVEGA-GH--SYDEPGILHQLMIAT......... 308
37 -27.000d1r3da1 c.69.1.35 (A:2-263) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]}  ali model 3D-neighbors follow..  14  2..............................SNQLHFAKPTA-RTPLVVLVHGLLGSGAD---------WQPVL--SHLARTQCAALTLDLPGHGTNPERHC--------DNFAEAVEMIEQTVQAHVTSEVPVLVGYSLGGRLIMHGLAQGAFSRLNLRGAIIEGGHFGLQENEEKAARWQHDQQWAQRFSQQPIEHVLSDWYQQAVFSSLNHEQRQTLIAQRSAN-----LGSSVAHMLLATSLAK----QPYLLPALQALKLPIHYVCGEQDSKFQQ------LAESSGLSYSQVAQA-GHNVHHEQPQAFAKIVQAMIHS...... 259
38 -26.500d3bdia1 c.69.1.0 (A:1-206) automated matches {Thermoplasma acidophilum [TaxId: 273075]}  ali model 3D-neighbors follow..  15  9...........................DVNGTRVFQRKMVT-NRRSIALFHGYSFTSMD---------WDKADLFNNYSKIGYNVYAPDYPGFGRSASSEKY---GIDRGDLKHAAEFIRDYLKANGVARS-VIMGASMGGGMVIMTTLQYPDIVDGIIAVAPAWVES--------------------------------------------------------------------------------------LKGDMKKIRQKTLLVWGSKDHVVPIALSKEYASIISGSRLEIVEGS-GHPVYIEKPEEFVRITVDFLRN...... 205
39 -26.500d1mj5a1 c.69.1.8 (A:2-296) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]}  ali model 3D-neighbors follow..  10  6...................PFGEKKFIEIKGRRMAYIDEGT--GDPILFQHGNPTSSYL---------WRNIMPH----AGLGRLIACDLIGMGDSDKLDPSGPERY---AYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRD-QAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTT-GRMRDFCRTWPNQTEITVAG--AHFIQEDSPDEIGAAIAAFVRRLRPA.. 295
40 -26.000d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]}  ali model 3D-neighbors follow..  13  1...MVNAIRTPDQRFSNLDQYPFSPNPGYPGLRAHYLDEGN-AEDVFLCLHGEPTWSYL---------YRKMIP--VFAESGARVIAPDFFGFGKSDKPVDEED-----YTFEFHRNFLLALIERLDLRNI-TLVVQDWGGFLGLTLPMADPSRFKRLIIMACLMTDPVTQPAFSAFVTQPADGFTAWKYDLVTPSDLRLDQFMKRWAPTLTEAEASAYAAPFPDT-SYQAGVRKFPKMVAQRDQACIDISTEAISFWQNDWNGQTFMAIGMKDKLLGPDVMYPMKALINGCPEPLEIADAGHFVQEFGEQVAREALKHFAETE..... 310
41 -25.400d3kdaa1 c.69.1.0 (A:25-319) automated matches {Pseudomonas aeruginosa [TaxId: 208963]}  ali model 3D-neighbors follow..  10  16...........................EVDGVKLHYVKGG--QGPLVMLVHGFGQTWYE---------WHQLMPE----AKRFTVIAPDLPGLGQSEPPKTG-------YSGEQVAVYLHKLARQFSPDRPFDLVAHDIGIWNTYPMVVKNQADIARLVYMEAPIPDARIYRFPAFTAQGE-----------SLVWHFSFFAADDRLAETLIAGKERFFLEHFIKSHASNFSERLLDLYARSYAKPHSLNASFEYYRALTRLQMPTMTLAGGGAGGMGTFQLEQMKAYAEDVEGHVLPGC-GHWLPEECAAPMNRLVIDFLSR...... 293
42 -25.000d1ehya1 c.69.1.11 (A:3-294) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]}  ali model 3D-neighbors follow..  13  13...........................QLPDVKIHYVREGA--GPTLLLLHGWPGFWWE---------WSKVIGP----AEHYDVIVPDLRGFGDSEKPDLNDLSKYSLDKAADDQAA---LLDALGIEKA-YVVGHDFAAIVLHKFIRKYSDRVIKAAIFDPGLGHVHESWYSQFHQLDMAVEVVGSSREVCKKYFKHFFDHWSYRDELLTEEELEVHVDNCMKPDNIHGGFNYYRANIRP-------DAALWTDLDHTMSDLPVTMIWGLGDTCVPYAPLIEFVPKYYSNYTMETIEDCGHFLMVEKPEIAIDRIKTAFR....... 292
43 -24.700d4inza_ c.69.1.0 (A:) automated matches {Bacillus megaterium [TaxId: 1404]}  ali model 3D-neighbors follow..  13  6...........................NVNGVNLHYISKG--QGELMLFLHGFPDFSHI---------WRHQIDE----SNDFHTVALDLRGYNLSEKPSGLES-----YEIDVLVEDIRQVIEGLGYSSC-TLVVHDWGAGIGWTFAYRYPEYVQKLIAF-NGPHPYTFMRELRTNKNQQKASEYAKWFQKQEVQDYMERDNFSGLRKLVIDPGVKKLTADDVQAYMNSWENGSVLSMLSYYRNLKIFTEEDLRRKSLEVLNIPVQIIWGNQDPTFMPENLDGIEEYVPNISVHRLAEA-SHAPQHEKPQEVNNVMWNFLNK...... 286
44 -24.000d3r40a_ c.69.1.0 (A:) automated matches {Rhodopseudomonas palustris [TaxId: 1076]}  ali model 3D-neighbors follow..  12  14...........................NTSSGRIFARVGG--DGPPLLLLHGFPQTHVM---------WHRVAPK----AERFKVIVADLPGYGWSDMPESDEQHT--PYTKRAMAKQLIEAMEQLGHVHF-ALAGHNRGARVSYRLALDSPGRLSKLAVLDILPTYEYWQRMNRALPENLLGGDPDFYVK-----AKLASWTRAGDLSAFDPRAVEHYRIAFADPMRRHVMCEDY----RAGAYADFEHDKIDVEAG-NKIPVPMLALWGASGIAQSAATPLDVWRKWASDVQGAPIES-GHFLPEEAPDQTAEALVRFFSA...... 297
45 -24.000d4jnca1 c.69.1.11 (A:238-548) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  5....................VTVKPR-----VRLHFVELG--SGPAVCLCHGFPESWYS---------WRYQIP--ALAQAGYRVLAMDMKGYGESSAPPE-----IEEYCMEVLCKEMVTFLDKLGLSQA-VFIGHDWGGMLVWYMALFYPERVRAVASLNTPFIPANPNMSPLESIKAN-VAEAELEQNLSRTFKSLFRASDESVLSMHKVCEAGGLFEEEIQFYVQQFKKSGFRGPLNWYRNMERN--KWACKSLGRKILIPALMVTAEKDFVLVPQMSQHMEDWIPHLKRGHIEDC-GHWTQMDKPTEVNQILIKWLDSDARN.. 311
46 -23.600d4nvra_ c.69.1.0 (A:) automated matches {Salmonella enterica [TaxId: 99287]}  ali model 3D-neighbors follow..  13  11.................IPGFALKDVRLENGLTVRVAIGG--SGSPLVLLHGHPQNHTT---------WRKVAPT----AQNHTVILPDLRGYGDSDKPTSD--PAHRTYSKRTMAQDIVMLMDALGFSRF-AFVGHDRGGRVGHRLALDYPDRVTCCTFIDIAPTATMYALTDKSLPETMIAHDPAFFLRKH-------ISGQLKIEGATSQEAFNEYLRCYQNPEMIHAICEDY----RAAATIDLDDDAADTS---ARIRCPLQLLWGGLGTVGQLYNVVGTWKEALNVQGEALPC--GHSPQEECPEYFIQKLQSFLHS...... 300
47 -23.200d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  12...........................QVQGQALFFREALPGSGQSVLLLHGIRFSSET---------WQNLGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPA-----PIGELAPGSFLAAVVDALELGPP-VVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTDK-------------------------------------------------------------------------------------INAANYASVKTPALIVYGDQDPMGQ--TSFEHLKQLPNHRVLIMKGA-GHPCYLDKPEEWHTGLLDFLQG...... 207
48 -23.000d5uroa1 c.69.1.0 (A:1-335) automated matches {Hypocrea jecorina [TaxId: 431241]}  ali model 3D-neighbors follow..  12  19...........................QIRGKTYSYILGEPAGPETVVLVHGWPDMAFG---------WRHQIP--YLMSLGFQVVAPNMLGYAGTDAPRD-----LSQFTLKSVSADIAELARSFVGQDGQIVGGHDWGGAVVWRTAYYHPELVKAVFSVCTPLHPLSAEYKPLEDIVAA--------GHMLNFKYQLQLKGPDVEARIQGKDMLRRFFEQELEYYVEQYALQEAPELRGPLNWYRTRELNAKDEMDRARFEMPALFVAASKDNALPPAMSKGMDAFYKDLTRAEVDA--THWALTQAGDEVNRVIGEWLNKA..... 334
49 -21.800d2dsta1 c.69.1.39 (A:2-123) Hypothetical protein TTHA1544 {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  14  7...........................HLYGLNLVFDRVGK--GPPVLLVAEEASR-----------WPEAL-------PEGYAFYLLDLPGYGRTEG---------PRMAPEELAHFVAGFAVMMNLGAPW-VLLRGLGLALGPHLEALGLRALPAEGVEVAEVLSSK................................................................................................................................................................ 118
50 -19.400d3dkra_ c.69.1.0 (A:) automated matches {Lactobacillus rhamnosus [TaxId: 486408]}  ali model 3D-neighbors follow..  12  12..........................................TDTGVVLLHAYTGSPNDMNF------------ARALQRSGYGVYVPLFSGHGTVEP------DILTKGNPDIWWAESSAAVAHMTAKY--FVFGLSLGGIFAMKALETLPGITAGGVFSSPILPGKHHLVPGFLKYAEYM------------------------------------------NRLAGKSDESTQILAYLPGQLAAIDQFATTVAADLNLVKQPTFIGQAGQDELVDGRLAYQLRDALINAARVDF-DDAKHVITVSAHHALEEDVIAFMQQENE... 241
51 -19.000d3stya_ c.69.1.0 (A:) automated matches {Lycopersicon hirsutum [TaxId: 283673]}  ali model 3D-neighbors follow..  14  3..........................................KKHFVLVHAAFHG-----------AWWYKIVA--LMRSSGHNVTALDLGASGINPKQALQ------IPNFSDYLSPLMEFMASLPANEKIILVGHALGGLAISKAMETFPEKISVAVFLSG---------LMPGPNIDATTVCTKAGSAVLGQLDNCVTYENGPTNPPTTLIAGPKFLATNVYHLSPIEDLALATALVRPLYLYLAEDISKEVVLSSKRYSVKRVFIVATENDALKKEFLKLMIEKNPPDEVKEIEGS-DHVTMMSKPQQLFTTLLSIANK...... 256
52 -18.500d1qj4a_ c.69.1.20 (A:) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]}  ali model 3D-neighbors follow..  12  3...........................................AHFVLIHTICHG-----------AWWHKLKP--LLEALGHKVTALDLAASGVDPRQIE------EIGSFDEYSEPLLTFLEALPPGEKVILVGESCGGLNIAIAADKYCEKIAAAVFHNSVLPDTEHCPS---------KLMEVFPDWKDTTYFTYTKDGKEITGLKLGFTLLRENLYTLCGP--EEYELAKMLTRKGSLFQNILAKRPFFTKEGYGSI--KKIYVWTDQDEIFLPEFQLWQIENYKPDKVYKVEGG-DHKLQLTKTKEIAEILQEVADT...... 254
53 -18.300d3rm3a_ c.69.1.0 (A:) automated matches {Bacillus sp. [TaxId: 129908]}  ali model 3D-neighbors follow..  13  19..........................................GPVGVLLVHGFTGTPHSMRP------------AEAYAKAGYTVCLPRLKGHGTHYE-------DMERTTFHDWVASVEEGYGWLKQRCQTIVTGLSMGGTLTLYLAEHHPD-ICGIVPINAAVDIPAIAAGMTGGGE------------------------------------LPRYLDSIGSDLKNPDVKELAYEKTPTASLLQLARLMAQTKAKLDRIVCPALIFVSDEDHVVPPGNADIIFQGISSTEKEIV-RNSYHVATLYDQPMIIERSLEFFAKHA.... 249
54 -18.300d5hk8a_ c.69.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}  ali model 3D-neighbors follow..  14  2...........................................IHFVFVHGASHG-----------AWWYKLTT--LLDAAGFKSTSVDLTGAGISLIDSN------IVFDSDQYNRPLFSLLSDLPPHHKVILVGHSIGGGSVTEALCKFTDKISMAIYLAASMVQPGSIPS-------PHLSNIHVGEEDIWEYTYGEGTDKPPTGVLMKPEFIRHYY-------YSQSPLEDVTLSSKLLRPAPMRAFQDLDKLPPNP-KVPRVYIKTAKDNLFDSVRQDLLVENWPPSQLYVLEDS-DHSAFFSVPTTLFAYLLRAVSF...... 250
55 -17.700d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  14  10..........................................GERAVLLLHGFTGNSADVRM------------GRFLESKGYTCHAPIYKGHGVPPE-------ELVHTGPDDWWQDVMNGYEFLKNKGYEAVAGLSLGGVFSLKLGYTVP--IEGIVTMCAPMYIKSEETMYEGVLEY-----------------------------------AREYKKREGKSEEQIEQEMEKFKQTPMKTLKALQELIADVRDHLDLIYAPTFVVQARHDEMINPDSANIIYNEIESPVKQIK-EQSGHVITLQEKDQLHEDIYAFLESLD.... 241
56 -17.200d2hu7a2 c.69.1.33 (A:322-581) Acylamino-acid-releasing enzyme, C-terminal donain {Aeropyrum pernix [TaxId: 56636]}  ali model 3D-neighbors follow..  14  16...................WVESFDGSRVPTY-VLESGRAPTPGPTVVLVH---GGPFAEDSDSWDTFAASLAAAG------FHVVMPNYRGSGYGEEWRLKIIGDPCGGELEDVSAAARWARES-GLASELYIMGYSYGGYMTLCALTMKPGLFKAGVAGASVVDWEEMYELSDAAFRNFIEQLTGGSREIMRSRSPINH---------------------------------------------------------VDRIKEPLALIHPQNDSRTPLKPLLRLMGELLAREAHIIPDA-GHAINTMEDAKILLPAVFFLATQRER.. 260
57 -16.900d1odtc_ c.69.1.25 (C:) Cephalosporin C deacetylase {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  14  40.AEPDLQPVDYPADGVKVYRLTYKSFGNARITGWYAVPDKEGPHPAIVKYHGYNASYDGEIHEMV-----------NWALHGYATFGMLVRGQQSSTKGILDKDTYYYRGVYLDAVRALEVISSFDEVDETRIVTGGAQGGGLTI-AAAALSDIPKAAVADYPY-------------------------LSNFERAIDVALEEPYLEINSFFRRNGSPETEVQAMKTLSYFDIMNL----------------------ADRVKVPVLMSIGLIDKVTPPSTVFAAYNHLETKKELKVYRYFGHEYIPAFQTEKLAFFKQHLK....... 317
58 -16.600d3fcya_ c.69.1.0 (A:) automated matches {Thermoanaerobacterium sp. [TaxId: 60708]}  ali model 3D-neighbors follow..  12  37.PKIELKESSFQVSFAECYDLYFTGGARIHAKYIKPKTEGKH--PALIRFHGYSSNSGDWNDKL------------NYVAAGFTVVAMDVRGQGGQSQDDDDADNMLFRHIFLDTAQLAGIVMNMPEVDEDRVVMGPSQGGGLSLACAALEPRV------------------------RKVVSEYPFLSDYKRVWDLDLAKNAYQEITDYFRLFDPRHERENEVFTKLGYIDVKNL----------------------AKRIKGDVLMCVGLMDQVCPPSTVFAAYNNIQSKKDIKVYPDYGHEPMRGFGDLAMQFMLELYS....... 317
59 -16.400d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]}  ali model 3D-neighbors follow..  8...................VLRVNNGQELHVWETPPKENVPFKNNTILIASGFARRMDHFAGLA-----------EYLSTNGFHVFRYDSLHHVGLSSG------SIDEFTMTTGKNSLCTVYHWLQTKG--GLIAASLSARVAYEVISD--LELSFLITAVGVVNLRD---TLEKALGFDYLSLPIDELPNDLDFEGHKLGSEVFVRDCFEHHWDTLD----------------------------------STLDKVANTSVPLIAFTANNDDWVKQEEVYDMLAHIRTGKLYSLLGS-SHGENLVVLRNFYQSVTKAAIAMDGGSL 266
60 -14.700d4zwna1 c.69.1.0 (A:2-310) automated matches {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 559292]}  ali model 3D-neighbors follow..  11  16....................YENFDGAKFGYMFWPVQNGTNEVRGRVLLIHGFGEYT---------KIQFRLM--DHLSLNGYESFTFDQRGAGVTSPGRSKGVTDEYHV-FNDLEHFVEKNLSECKAKGIPLMWGHSMGGGICLNYACQHKNEISGYIGSGPLIILHPHTMY------------NKPTQIIAPLLAKFRVRIDTGLDLKGITSDKAYRAFLGSDPMSVPLYGSFRQIHDFMQRGAKLYKNENNYIQKNFAKDKPVIIMHGQDDTINDPKGSEKFIRDCADKELKLYPGAR-HSIFSLETDTVFNDMKQWLDKHTTTE. 309
61 -14.600d3pe6a_ c.69.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  12  20.............................DGQYLFCRYWAPTGTPLIFVSHGAGEHS---------GRYEELA--RMLMGLDLLVFAHDHVGHGQ-SEGERMVVSDFHVF-VRDVLQHVDSMQKDYPGLPVF-LLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANP---------------------ESATTFKVLAAKVLNSVLPNLSSGPIDSSVLSRNKTEVDIYNSDPLICGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAQDKTLKIYEGAY-HVLHKELPEVTNSVFHEINMWVSQR.. 287
62 -14.200d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  13  6........................ERLTLAGLSVLARI--EAPKALLLALHGLQGSKEHILALLP-----------GYAERGFLLLAFDAPRHGEREGPPPSSKSPRYVEEVYRVALGFKEEARRV-AEEAEFLAGGSLGAFVAHLLLAEGFR-PRGVLAFIGSG-------FPMKLPQGQVVEDPGV-----------------------------------------------------------ALYQAPPATRGEAYGGVPLLHLHGSRDHIVPLARMEKTLEALRPHARFVEEGA-GHTLTPLMARVGLAFLEHWLEAR..... 238
63 -14.200d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  12  5..............................................VIVVHGLFDSSYS---------FRHLLEYINETHPGTVVTVLDLFDGRESLRPLWE--------QVQGFREAVVPIMAKA--PQGVHLICYSQGGLVCRALLSVMDDNVDSFISLSSPQMDTDYLKWLFPTSMRSNLYRICYSPWGQEFSICNYWHDPHHDDLYLNASSFLALINGERDHPNATVWRKNFLRVGHLVLIGGPDDG----SSFFGFYDANETVLEMEEQLVYL-RDSFGLKTLLARGAIVRCPAGISHTAWHSNRTLYETCIEPWLS....... 268
64 -13.900d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]}  ali model 3D-neighbors follow..  10  27...............AEEYEVVTEDGYILGIDRIPYNSENIGRRPVAFLQHGLLASATNWISNLPNNSLAFILADAGYD-----VWLGNSRGNTWARRNLYYSPDSFDEMAKYDLPATIDFILKKTGQDKLH-YVGHSQGTTIGFIAFSTNPKLAKRIKTFYALAPVATVKYTETLINKLMLVPSFLFKLIFGNKIFYPHHFFDQFLATEVCSRETVDLLCSNALFIICGFDTMNLAVKSGKFQAFDWGSPVQNMMH-LTDMHVPIAVWNGGNDLLADPHDVDLLLSKLPNLIYHRKIPPYNHLDFIWAMDAPQAVYNEIVSMMGTD.. 377
65 -13.300d1ys1x_ c.69.1.18 (X:) automated matches {Burkholderia cepacia [TaxId: 292]}  ali model 3D-neighbors follow..  18  7..........................................TRYPIILVHGLTGTDKYAGV----EYWYGIQ--EDLQQRGATVYVANLSGFQSDDG---------PNGRGEQLLAYVKTVLAATGATKVN-LVGHSQGGLTSRYVAAVAPDLVASVTTIGTPHRGS................................................................................................................................................................. 117
66 -12.400d3g02a1 c.69.1.11 (A:5-396) Bacterial epoxide hydrolase {Aspergillus niger [TaxId: 5061]}  ali model 3D-neighbors follow..  12  72.........PFEARLNSFPQFTTE----IEGLTIHFAALFSEREDAIALLHGWPGSFVEFYPIL-----QLFREEYTPETLPFHLVVPSLPGYTFSSGPPLDKD-----FGLMDNARVVDQLMKDLGFGS-GYIIQGGDIGSFVGRLLGVGFDACKAVFCNMSAPPEGPSIESLSAAEKEGIARMEKFMTDGYSPIALLAWIGEKYLQWVDKPLPSETILEMVSLYWLTESFPRAIHTYREWVPTASAPNGATPYQKE-LYIHKPFGFSFFPKDLVPVP---RSWIATTGNLVFFRDHAEGGHFAALERPRELKTDLTAFVEQ...... 390
67 -12.300d3c8da2 c.69.1.2 (A:151-397) Enterochelin esterase, catalytic domain {Shigella flexneri [TaxId: 623]}  ali model 3D-neighbors follow..  13..........................IPAKEIIWKSERLKNSRRVWIFTTGDVTAEERPLAVLLDGEFWTSLTHRQQLPP---AVYVLIDAIDTTHRAHELPCNADFWLAVQQELLPLVKVIAPFSDRADRTVVAGQSFGGLSALYAGLHWPERFGCVLSQSGSYWWPHRGGQQEGVLLEKLKAGEV---------------SAEGLRIVLEAGIREPMIMRANQALYAQLHPIKESIFWRQVDGHDALCWRGGLMQGLIDLWQPL............................................................... 245
68 -11.800d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]}  ali model 3D-neighbors follow..  14  16........................PVGPLDVAVDLPEPDVAVQPVTAIVCHPLSTEGGSMHNKVVTMAARALRELG------ITVVRFNFRSVGTSAGSFDHGDGE-----QDDLRAVAEWVRAQRPTDTL-WLAGFSFGAYVSLRAAAALE--PQVLISIAPPAGRWDFSDV---------------------------------------------------------------------------------------QPPAQWLVIQGDADEIVDPQAVYDWLETLEQQPTLVRMPDTSHF-FHRKLIDLRGALQHGVRR...... 212
69 -11.700d2i3da1 c.69.1.36 (A:2-219) Hypothetical protein Atu1826 {Agrobacterium tumefaciens [TaxId: 358]}  ali model 3D-neighbors follow..  16  11..............................RLEGRYQPSKEKSAPIAIILHPHPQFGGTMNNQIVYQLFYLFQKRG------FTTLRFNFRSIGRSQGEFDHGAGE-----LSDAASALDWVQSLHPDSKSCWVAGYSFGAWIGMQLLMRRPE-IEGFMSIAPQPNTYDF--------------------------------------------------------------------------------------SFLAPCPSSGLIINGDADKVAPEKDVNGLVEKLKTITHRTLPGA-NHF-FNGKVDELMGECEDYLDRRLNGEL 214
70 -11.500d4b6ga1 c.69.1.0 (A:3-275) automated matches {Neisseria meningitidis [TaxId: 122586]}  ali model 3D-neighbors follow..  11  11................SQQVWAHHAQTLQCEMKFAVNNPENRPLGVIYWLSGLTCTEQ--------NFITKSGFQRYAAEHQVIVVAPDTLGQSAGTEQPWAANYQMYDYILNELPRL---IEKHFPTNGKRSIMGHSMGGHGALVLALRNQERYQSVSAFSPILSPSL................................................................................................................................................................ 174
71 -11.400d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  15  1...........................................TKQVYIIHGYRASST-------NHWFPWL--KKRLLADGVQADILNM--------------PNPLQPRLEDWLDTLSLYQHTLHENTY--LVAHSLGCPAILRFLEHLQLRAALGGIILVSGFAKS-----------------------------------------------LPTLQMLDEFTQGSFDH-----------------------QKIIESAKHRAVIASKDDQIVPFSFSKDLAQQI-DAALYEVQHG-GHDEGFTSLPIVYDVLTSYFSK...... 186
72 -11.300d5a71a_ c.69.1.17 (A:) Triacylglycerol lipase {Pseudozyma antarctica [TaxId: 84753]}  ali model 3D-neighbors follow..  10  30..........................................VSKPILLVPGTGTTGPQS-------FDSNW--IPLSTQLGYTPCWISPPPFMLNDTQVNT----------EYMVNAITALYAGSGNNKLP-VLTWSQGGLVAQWGLTFFPSKVDRLMAFAP----------------------DYKGTVLAGPLDALAVSAPSVWQQT------------TGSALTTALRNAG------------------------LTQIVPTTNLYSATDEIVQPQVSNSPSSYLFNGKNVQAQAVCDHAGSLTSQFSYV-VGRSALRSTTGQ.. 247
73 -11.200d4qeka_ c.69.1.3 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}  ali model 3D-neighbors follow..  15  2.......................RPGLPVEYLQVPSASMGRGGPHAVYLLDGLRAQDDYNG-------WDINTPAFEEYYQSGLSVIMPVGGQSSSQSNGQNYTYKWETFLTREMPAW---LQANKGVSP-NAAVGLAMSGGSALILAAYYPQQFPYAASLSGFLNPSE................................................................................................................................................................ 154
74 -11.100d1qlwa_ c.69.1.15 (A:) A novel bacterial esterase {Alcaligenes sp. [TaxId: 512]}  ali model 3D-neighbors follow..  10  4..TPAGPLTLSGQGSFFVGGRDVTSETTVDQMYVRYQIPQRAKRYPITLIHG-TGMTWETTPDGRMGWDEYFLRKG------YSTYVIDQSGRGRSATDISAINAVKLGKAPASSLPDLFA------AGHEAAWAIFRFGPRYPDAFKDTQFPVQAQAELWQQMVPDWLGSMPTPNPTVANLSK----------------------LAIKLDGTVLLSHSQSGIYPFQTAAMNPKGITAIVSVE----PGECPKPEDVKPLTSIPVLVVFGDHIEEFPRAFIDALNAAGGKGQLMSLPAL-SHMMMQRNNLQVADLILDWIGRNTA... 318
75 -11.100d4a5sa2 c.69.1.0 (A:509-766) automated matches {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  13  7...................DFIILNETKFWYQMILPPHFDKSKKYPLLLDVYAGPCSQKADTVFRLNWATYLAS-----TENIIVASFDGRGSGYGDKIMHAINRRLGTFEVEDQIEAARQFSKMGFVDNKRIAIGWSYGGYVTSMVLGSGSGVFKCGIAVAPVSRWEYYDSVY----------------------------TERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQISKALVGVDFQAMWYTDEDHGIASSTAHQHIYTHMSH...................................... 249

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 8 9 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.