current user: public

If you have questions about the server, please let us know.

Query: gi|15923005|ref|NP_370539.1| 50S ribosomal protein L9 (SAV0015) [Staphylococcus aureus subsp. aureus Mu50], from S.aureus

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst MKVIFTQDVKGKGKKGEVKEVPVGYANNFLLKKNYAVEATPGNLKQLELQKKRAKQERQQEIEDAKALKETLSNIEVEVSAKTGEGGKLFGSVSTKQIAEALKAQHDIKIDKRKMDLPNGIHSLGYTNVPVKLDKEVEGTIRVHTVEQLast
1 -47.200d1diva1 d.99.1.1 (A:56-149) Ribosomal protein L9 C-domain {Bacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  54  1.......................................................RQAAEELANAKKLKEQLEKLTVTIPAKAGEGGRLFGSITSKQIAESLQAQHGLKLDKRKIELADAIRALGYTNVPVKLHPEVTATLKVHVTEQ 93
2 -40.100d2qamh1 d.99.1.1 (H:59-149) Ribosomal protein L9 C-domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  26  1..........................................................AEVLAAANARAEKINALEVTIASKAGDEGKLFGSIGTRDIADAVTAAGVEVAKSEVRLPNGVLRTTGEHEVSFQVHSEVFAKVIVNVVAE 91
3 -34.800d2hbaa1 d.100.1.1 (A:1-52) Ribosomal protein L9 N-domain {Bacillus stearothermophilus [TaxId: 1422]}  ali model 3D-neighbors follow..  69  1MKVIFLKDVKGMGKKGEIKNVADGYANNFLFKQGLAIEATPANLKALEAQKQ................................................................................................ 52
4 -6.020d2ouxa2 d.37.1.1 (A:136-262) Magnesium transporter MgtE {Enterococcus faecalis [TaxId: 1351]}  ali model 3D-neighbors follow..  15  82..............................................................DDQEDVAQTIRDYDFLAVPVTDYDDHLLGIVTVDDIIDVIDDEA.......................................... 125
5 -5.760d1vr9a3 d.37.1.1 (A:1-121) Hypothetical protein TM0892, CBS tandem {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  17  77..............................................................DNITHALLLFLEHQEPYLPVVDEEMRLKGAVSLHDFLEALIEALA......................................... 121
6 -5.750d1ipaa1 c.116.1.1 (A:106-263) RrmA (RrmH), C-terminal domain {Thermus thermophilus [TaxId: 274]}  ali model 3D-neighbors follow..  10  13..ILVAVGLEKPGNLGAVLRSADAAGAEAVLVAGGVDLYSPQVIRN----STGVVFSLRTLAASESEVLDWIKQHNLPLVATTPHAEALYWEAN-------LRPPVAIAVGPEHEGLRAAWLEAAQTQVRIPMQGQADS-LNVSVSA. 145
7 -5.530d1b3ob4 d.37.1.1 (B:112-231) Type II inosine monophosphate dehydrogenase CBS domains {Human (Homo sapiens), type II [TaxId: 9606]}  ali model 3D-neighbors follow..  13  11........................................................SPKDRVRDVFEAKARHGFCGIPITDTGRMGSRLVGIISSRDIDFLKEEEHDCFLEEIMTKREDLV........................... 75
8 -5.500d4tv9f2 d.142.1.10 (F:77-378) Tubulin tyrosine ligase (TTL) C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}  ali model 3D-neighbors follow..  11  10................ELSESCTWFPESYIYPTNLKTPVAPAQNGIRHLINNTRTDEREVFLAAYNRRREGREGNVWIAKSSAGAKGEILISSEASELLDFIDEQGQVHVIQKYLEKPLLLEP-GHRKFDIRSWVLVDHLYNIYLYRE 142
9 -5.470d2d4za3 d.37.1.1 (A:527-606,A:691-770) Chloride channel protein, CBS tandem {Marbled electric ray (Torpedo marmorata) [TaxId: 7788]}  ali model 3D-neighbors follow..  13  13VGDIMVRDVTSIASTSTYGDLLHVLRQTGLLQRRISAYRRQPXFEEMLTLEEIYRWEQREKNVVVNFETCRIDQSPFQLVEGTSSMGKLVGVVALAEIQAAIEG............................................ 161
10 -5.390d1ygya4 d.81.2.2 (A:317-451) D-3-phosphoglycerate dehydrogenase SerA {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  15  39...............GELAAEEVEVLRLSAL-RGLFSAVIEDAVTFVNAPALAAERGVTAEICKASESPNHRSVVDVRAVGADGSVVTVSGTLYGPQLSQKIVQINGRHFDLR................................... 135

FFAS is supported by the NIH grant R01-GM087218-01
1 4 7 2 8 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Zmasek CM, Zhang Q, Ye Y, Godzik A. Surprising complexity of the ancestral apoptosis network. Genome Biol. 2007 Oct 24;8(10):R226 [Epub ahead of print]