current user: public

If you have questions about the server, please let us know.

Query: gi|15923008|ref|NP_370542.1| response regulator (SAV0018) [Staphylococcus aureus subsp. aureus Mu50], from S.aureus

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .
# Score Template Links and tools%idFirst MQMARKVVVVDDEKPIADILEFNLKKEGYDVYCAYDGNDAVDLIYEEEPDIVLLDIMLPGRDGMEVCREVRKKYEMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLRRHYSQPAQDTGNVTNEITIKDIVIYPDAYSIKKRGEDIELTHREFELFHYLSKHMGQVMTREHLLQTVWGYDYFGDVRTVDVTIRRLREKIEDDPSHPEYIVTRRGVGYFLQQHELast
1 -64.800d2qzja_ c.23.1.0 (A:) automated matches {Clostridium difficile [TaxId: 272563]}  ali model 3D-neighbors follow..  30  1...QTKILIIDGDKDNCQKLKGFLEEKGISIDLAYNCEEAIGKIFSNKYDLIFLEIILSDGDGWTLCKKIRNVTTCPIVYMTYINEDQSILNALNSGGDDYLIKPLNLEILYAKVKAILRRMNS............................................................................................................... 121
2 -64.000d4nica_ c.23.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}  ali model 3D-neighbors follow..  41  1....NKIVFVEDDPEVGTLIAAYLGKHDMDVVVEPRGDRAEEVIAREKPDLVLLDIMLPGKDGMTLCRDLRGQWQGPIVLLTSLDSDMNHILSLEMGASDYILKTTPPAVLLARLRLHLRQ.................................................................................................................. 117
3 -63.400d2jbaa_ c.23.1.1 (A:) automated matches {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  44  1...ARRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNEPWPDLILLAWMLPGGSGIQFIKHLRRESDIPVVMLTARGEEEDRVRGLETGADDCITKPFSPKELVARIKAVMRRISP............................................................................................................... 124
4 -63.300d1zgza1 c.23.1.1 (A:2-121) TorCAD operon transcriptional regulator TorD, N-terminal domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  37  2....HHIVIVEDEPVTQARLQSYFTQEGYTVSVTASGAGLREIMQNQSVDLILLDINLPDENGLMLTRALRERSTVGIILVTGRSDRIDRIVGLEMGADDYVTKPLELRELVVRVKNLLWRID................................................................................................................ 120
5 -62.500d3t6ka_ c.23.1.0 (A:) automated matches {Chloroflexus aurantiacus [TaxId: 324602]}  ali model 3D-neighbors follow..  41  2...PHTLLIVDDDDTVAEMLELVLRGAGYEVRRAASGEEALQQIYKNLPDALICDVLLPGIDGYTLCKRVRQHKTLPILMLTAQGDISAKIAGFEAGANDYLAKPFEPQELVYRVKNILAR.................................................................................................................. 122
6 -62.000d4q7ea_ c.23.1.0 (A:) automated matches {Leptospira biflexa [TaxId: 355278]}  ali model 3D-neighbors follow..  27  1..MKPRILLVEDDEGLGETLKERLEQDKYRVEWAKTISEAENLYRPNAFDLVVLDLRLPDGNGFDLAEMIVKKKDLPFLFLTAQAGAQERLRGFELGAAEFIPKPFHLKEFLIRLERVISLTRP............................................................................................................... 123
7 -59.800d5dcla_ c.23.1.0 (A:) automated matches {Streptococcus agalactiae [TaxId: 1311]}  ali model 3D-neighbors follow..  34  2...QGKIYIVEDDMTIVSLLKDHLS-ASYHVSSVSNFRDVKQEIIAFQPDLILMDITLPYFNGFYWTAELRKFLTIPIIFISSSNDEMDMVMALNMGGDDFISKPFSLAVLDAKLTAILR................................................................................................................... 117
8 -59.500d3gl9a_ c.23.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  43  1...SKKVLLVDDSAVLRKIVSFNLKKEGYEVIEAENGQIALEKLSEFTPDLIVLDIMMPVMDGFTVLKKLQEKKRIPVIVLTAKGGEEDESLALSLGARKVMRKPFSPSQFIEEVKHLLN................................................................................................................... 120
9 -58.500d3cg4a_ c.23.1.0 (A:) automated matches {Methanospirillum hungatei [TaxId: 323259]}  ali model 3D-neighbors follow..  31  2...KGDVMIVDDDAHVRIAVKTILSDAGFHIISADSGGQCIDLLKKGFSGVVLLDIMMPGMDGWDTIRAILDNQGIAIVMLTAKNAPDAKMIGLQEYVVDYITKPFDNEDLIEKTTFFMGFVRNQ.............................................................................................................. 126
10 -58.500d4lzla_ c.23.1.0 (A:) automated matches {Streptococcus pneumoniae [TaxId: 914130]}  ali model 3D-neighbors follow..  20  1...GKRILLLEKERNLAHFLSLELQKEQYRVDLVEEGQKALSMALQTDYDLILLNVNLGDMMAQDFAEKLSRTKASVIMILDHWEDLQEELEVVQRFAVSYIYKPVLIENLVARISAIFRGRD................................................................................................................ 121
11 -58.200d1kgsa2 c.23.1.1 (A:2-123) PhoB receiver domain {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  44  1...NVRVLVVEDERDLADLITEALKKEMFTVDVCYDGEEGMYMALNEPFDVVILDIMLPVHDGWEILKSMRESGNTPVLMLTALSDVEYRVKGLNMGADDYLPKPFDLRELIARVRALIRRKSE............................................................................................................... 122
12 -57.900d5t3ya_ c.23.1.0 (A:) automated matches {Burkholderia multivorans [TaxId: 87883]}  ali model 3D-neighbors follow..  27  1..MIRTILAIDDSATMRALLHATLAQAGYEVTVAADGEAGFDLAATTAYDLVLTDQNMPRKSGLELIAALRQLADTPILVLTTEGSDAFKAAARDAGATGWIEKPIDPGVLVELVATLSEPAAN............................................................................................................... 125
13 -56.800d3ltea_ c.23.1.0 (A:) automated matches {Bermanella marisrubri [TaxId: 207949]}  ali model 3D-neighbors follow..  31  1....KRILVVDDDQAMAAAIERVLKRDHWQVEIAHNGFDAGIKLSTFEPAIMTLDLSMPKLDGLDVIRSLRQNANQPKILVVSGLDKAKLQQAVTEGADDYLEKPFDNDALLDRIHDLVN................................................................................................................... 118
14 -56.700d1p2fa2 c.23.1.1 (A:3-120) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  40  2.....KIAVVDDDKNILKKVSEKLQQLGR-VKTFLTGEDFLN--DEEAFHVVVLDVMLPDYSGYEICRMIKETPETWVILLTLLSDDESVLKGFEAGADDYVTKPFNPEILLARVKRFLEREKK............................................................................................................... 118
15 -56.100d3w9sa_ c.23.1.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 484021]}  ali model 3D-neighbors follow..  33  1.....KILVIEDDALLLQGLILAMQSEGYVCDGVSTAHEAALSLASNHYSLIVLDLGLPDEDGLHFLSRMRREKTQPVLILTARDTLEDRISGLDTGADDYLVKPFALEELNARIRALLR................................................................................................................... 116
16 -54.900d3rqia_ c.23.1.0 (A:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}  ali model 3D-neighbors follow..  19  1...DKNFLVIDDNEVFAGTLARGLERRGYAVRQAHNKDEALKLAGAEKFEFITVDLHLGNDSGLSLIAPLCDLQDARILVLTGYASIATAVQAVKDGADNYLAKPANVESILAALQTNASEVQ---AEEALENPVVLSVDRLEWEHIQRVLAENNNNISATARALNMHRRTLQR............................................................. 169
17 -53.900d1p6qa_ c.23.1.1 (A:) CheY protein {Sinorhizobium meliloti, CheY2 [TaxId: 382]}  ali model 3D-neighbors follow..  24  3LAEKIKVLIVDDQVTSRLLLGDALQQLGFKITAAGDGEQGMKIMAQNPHHLVISDFNMPKMDGLGLLQAVRANKKAAFIILTAQGDRALVQKAAALGANNVLAKPFTIEKMKAAIEAVFGALK................................................................................................................ 129
18 -53.600d3a0ua_ c.23.1.0 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  38  2....KRILVVDDEPNIRELLKEELQEEGYEIDTAENGEEALKKFFSGNYDLVILDIEMPGISGLEVAGEIRKKKDAKIILLTAYSHYRSDLSSW--AADEYVVKSFNFDELKEKVKKLL.................................................................................................................... 115
19 -53.600d3n53a1 c.23.1.0 (A:2-127) automated matches {Pelobacter carbinolicus [TaxId: 338963]}  ali model 3D-neighbors follow..  28  1....KKILIIDQQDFSRIELKNFLD-SEYLVIESKNEKEALEQIDHHHPDLVILDMDIIGENSPNLCLKLKRSKNVPLILLFSSEHKEAIVNGLHSGADDYLTKPFNRNDLLSRIEIHLRTQN................................................................................................................ 121
20 -53.400d2v0na1 c.23.1.1 (A:2-140) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]}  ali model 3D-neighbors follow..  40  1...SARILVVDDIEANVRLLEAKLTAEYYEVSTAMDGPTALAMAARDLPDIILLDVMMPGMDGFTVCRKLKDTRHIPVVLITALDGRGDRIQGLESGASDFLTKPIDDVMLFARVRSLTR................................................................................................................... 120
21 -53.100d3c3ma1 c.23.1.0 (A:3-123) automated matches {Methanoculleus marisnigri [TaxId: 368407]}  ali model 3D-neighbors follow..  30  2.....TILVVDDSPMIVDVFVTMLERGGYRPITAFSGEECLEALNATPPDLVLLDIMMEPMDGWETLERIKTDRDIPVLMLTAKPLTPEEANEYGSYIEDYILKPTTHHQLYEAIEHVLAR.................................................................................................................. 120
22 -53.100d2b4aa1 c.23.1.1 (A:2-119) Hypothetical protein BH3024 {Bacillus halodurans [TaxId: 86665]}  ali model 3D-neighbors follow..  19  4.....RVTLVEDEPSHATLIQYHLNQLGAEVTVHPSGSAFFQHRSQSTCDLLIVSDQLVDLSIFSLLDIVKEQTQPSVLILTTGRHELIESSE---HNLSYLQKPFAISELRAAIDYHKPS.................................................................................................................. 118
23 -53.100d2gkga_ c.23.1.0 (A:) automated matches {Myxococcus xanthus [TaxId: 34]}  ali model 3D-neighbors follow..  26  1....KKILIVESDTALSATLRSALEGRGFTVDETTDGKGSVEQIRRDRPDLVVLAVDLAGQNGYLICGKLKKDKNVPIVIIGNP-DGFAQHRKLKAHADEYVAKPVDADQLVERAGALIGFPE................................................................................................................ 122
24 -52.400d3gt7a_ c.23.1.0 (A:) automated matches {Syntrophus aciditrophicus [TaxId: 56780]}  ali model 3D-neighbors follow..  29  1...AGEILIVEDSPTQAEHLKHILEETGYQTEHVRNGREAVRFLSLTRPDLIISDVLMPEMDGYALCRWLKGQRTIPVILLTILSDPRDVVRSLECGADDFITKPCKDVVLASHVKRLLSGVKRTEERYSRES...................................................................................................... 133
25 -52.200d2zaya_ c.23.1.0 (A:) automated matches {Desulfuromonas acetoxidans [TaxId: 281689]}  ali model 3D-neighbors follow..  23  3.....RIMLVDTQLPALAASISALSQEGFDIIQCGNAIEAVPVAVKTHPHLIITEANMPKISGMDLFNSLKKNASIPVIALSGRATAKEEAQLLDMGFIDFIAKPVNAIRLSARIKRVLK................................................................................................................... 120
26 -51.900d1jbea_ c.23.1.1 (A:) CheY protein {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  27  2.DKELKFLVVDDFSTMRRIVRNLLKELGFNVEEAEDGVDALNKLQAGGYGFVISDWNMPNMDGLELLKTIRAXSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKLG................................................................................................................ 127
27 -51.800d3eoda_ c.23.1.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}  ali model 3D-neighbors follow..  26  4..VGKQILIVEDEQVFRSLLDSWFSSLGATTVLAADGVDALELLGGFTPDLMICDIAMPRMNGLKLLEHIRNRGQTPVLVISATENMADIAKALRLGVEDVLLKPVKDNRLREMVFACL.................................................................................................................... 122
28 -51.800d4h60a1 c.23.1.0 (A:1-119) automated matches {Vibrio cholerae [TaxId: 345073]}  ali model 3D-neighbors follow..  31  2....AKVLAVDDSISIRQMVSHTLQDAGYEVETAADGREALAKAQKARFDVIISDVNMPVMTGFEFVKAVRMQKFTPILMLTTETSPEKKQEGKAVGATGWLVKPFNPETLLKTLQRVL.................................................................................................................... 119
29 -51.400d3cfya1 c.23.1.0 (A:2-128) automated matches {Vibrio parahaemolyticus [TaxId: 223926]}  ali model 3D-neighbors follow..  26  1...RPRVLLVEDSTSLAILYKQYVKDEPYDIFHVETGRDAIQFIERSKPQLIILDLKLPDMSGEDVLDWINQNDPTSVIIATAHGSVDLAVNLIQKGAEDFLEKPINADRLKTSVALHLKRAKLEDLVE.......................................................................................................... 127
30 -50.300d3grca_ c.23.1.0 (A:) automated matches {Polaromonas sp. [TaxId: 296591]}  ali model 3D-neighbors follow..  20  2...RPRILICEDDPDIARLLNLMLEKGGFDSDMVHSAAQALEQVARRPYAAMTVDLNLPDQDGVSLIRALRRDRDLAIVVVSANAREGEEFNSQPLAVSTWLEKPIDENLLILSLHRAIDNMA................................................................................................................ 125
31 -49.400d2hwva1 a.4.6.0 (A:134-232) automated matches {Enterococcus faecalis [TaxId: 226185]}  ali model 3D-neighbors follow..  78  1........................................................................................................................................MTIGDLTIHPDAYMVSKRGEKIELTHREFELLYYLAKHIGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDSPSHPTYLVTRRGVGYYLRNPE 99
32 -49.400d2v0na2 c.23.1.1 (A:141-293) Response regulator PleD, receiver domain {Caulobacter crescentus [TaxId: 155892]}  ali model 3D-neighbors follow..  22  11.GLGGRVLIVDDNERQAQRVAAELGVEHRPV--IESDPEKAKISAGGPVDLVIVNAAAKNFDGLRFTAALRSERQLPVLAMVDPDDRGRMVKALEIGVNDILSRPIDPQELSARVKTQIQRKR................................................................................................................ 133
33 -49.300d2qxya1 c.23.1.0 (A:4-121) automated matches {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  25  1...TPTVMVVDESRITFLAVKNALEKDGFNVIWAKNEQEAFTFLRREKIDLVFVDVF-EGEESLNLIRRIREEFDTKVAVLSAYVDKDLIINSVKAGAVDYILKPFRLDYLLERVKKIISS.................................................................................................................. 118
34 -49.000d4ixaa_ a.4.6.0 (A:) automated matches {Staphylococcus epidermidis [TaxId: 176280]}  ali model 3D-neighbors follow..  33  2......................................................................................................................................EQLEFDGLVLKNLSKTLTINNIEIPMRIKEFELLWYLASREGEVISKSELLEKVWGYDYYEDANTVNVHIHRIREKLEKHDFLPYTITTVWGLGYKFERSR 102
35 -48.100d3nhma_ c.23.1.0 (A:) automated matches {Myxococcus xanthus [TaxId: 246197]}  ali model 3D-neighbors follow..  24  1....PKVLIVENSWTMRETLRLLLS-GEFDCTTAADGASGLQQALAHPPDVLISDVNMDGMDGYALCGHFRSEKHIPVIFVSGYAPR-TEGPADQPVPDAYLVKPVKPPVLIAQLHALLARAE................................................................................................................ 120
36 -48.000d3hzha_ c.23.1.0 (A:) automated matches {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]}  ali model 3D-neighbors follow..  27  11.GIPFNVLIVDDSVFTVKQLTQIFTSEGFNIITAADGEEAVIKYKNHYPDIVTLDITMPKMDGITCLSNIMEDKNARVIMISALGKEQLVKDCLIKGAKTFIVKPLDRAKVLQRVMSVFVK.................................................................................................................. 134
37 -48.000d2plna1 c.23.1.0 (A:1-114) automated matches {Helicobacter pylori [TaxId: 210]}  ali model 3D-neighbors follow..  22  2.....RVLLIEKNSVLGGEIEKGLNVKGFMADVTESLEDGEYLMDIRNYDLVMV----SDKNALSFVSRIKEKSSIVVLVSSDNPTSEEEVHAFEQGADDYIAKPYSIKALVARIEARLR................................................................................................................... 114
38 -47.900d2k4ja1 a.4.6.0 (A:13-115) automated matches {Helicobacter pylori [TaxId: 85963]}  ali model 3D-neighbors follow..  28  1..................................................................................................................................EEVSEPGDANIFRVDKDSREVYMHEKKLDLTRAEYEILSLLISKKGYVFSRESIAIESESINPESSNKSIDVIIGRLRSKIEKNPKQPQYIISVRGIGYKLE... 102
39 -47.100d3luaa1 c.23.1.0 (A:2-125) automated matches {Clostridium thermocellum [TaxId: 203119]}  ali model 3D-neighbors follow..  21  1...DGTVLLIDYFEYEREKTKIIFDNIGYDFIEVENLKKFYSIFKDDSITLIIMDIAFPEKEGLEVLSAIRNNANTPVIIATKSDNPGYRHAALKFKVSDYILKPYPTKRLENSVRSVLK................................................................................................................... 123
40 -47.000d4nhja_ a.4.6.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}  ali model 3D-neighbors follow..  34  2.....................................................................................................................................HKTISFGSLTIDPVNRQVMLGGENVALSTADFDMLWELATHAGQIMDRDALLKNLRGVTYDGMDRSVDVAISRLRKKLLDNATEPYRIKTVRNKGYLFAPH. 102
41 -46.800d5lwka_ c.23.1.0 (A:) automated matches {Lactobacillus paracasei [TaxId: 1597]}  ali model 3D-neighbors follow..  25  3.....NILIVEDDPMVQFIHRNYLEKIGTTIYSSETIADAKKLLASRSIQLVLLDIRLKDGNGIDFLTDLRRTQTVDVILITAANEVNIVNDALHLGVIDYLIKPFTLERFEKSIQRYRTK.................................................................................................................. 121
42 -46.700d3zq7a_ a.4.6.0 (A:) automated matches {Escherichia coli K-12 [TaxId: 83333]}  ali model 3D-neighbors follow..  29  2.....................................................................................................................................DPLVKFSDVTVDLAARVIHRGEEEVHLTPIEFRLLAVLLNNAGKVLTQRQLLNQVWGPNAVEHSHYLRIYMGHLRQKLEQDPARPRHFITETGIGYRFM... 100
43 -46.300d1opca_ a.4.6.1 (A:) OmpR {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  30  1.......................................................................................................................................VIAFGKFKLNLGTREMFREDEPMPLTSGEFAVLKALVSHPREPLSRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYIQTVWGLGYVFVPD. 99
44 -45.900d3crna1 c.23.1.0 (A:2-122) automated matches {Methanospirillum hungatei [TaxId: 323259]}  ali model 3D-neighbors follow..  31  1....KRILIVDDDTAILDSTKQILEFEGYEVEIAATAGEGLAKIENEFFNLALFDIKLPDMEGTELLEKAHKLRGMKKIMVTGYASLENSVFSLNAGADAYIMKPVNPRDLLEKIKEKLDEQEK............................................................................................................... 121
45 -45.900d4uhta_ a.4.6.0 (A:) automated matches {Escherichia coli [TaxId: 83333]}  ali model 3D-neighbors follow..  31  1.....................................................................................................................................SPTLEVDALVLNPGRQEASFDGQTLELTGTEFTLLYLLAQHLGQVVSREHLSQEVLGKRLTPFDHAIDMHISNLRRKLPDRKDGHPWFKTLRGRGYLMVSA. 101
46 -45.600d1gxqa_ a.4.6.1 (A:) PhoB {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  33  1.................................................................................................................................PMAVEEVIEMQGLSLDPTSHRVMAGEEPLEMGPTEFKLLHFFMTHPERVYSREQLLNHVWGTNVYVEDRTVDVHIRRLRKALEPGG-HDRMVQTVRGTGYRFSTR. 104
47 -44.500d1ys6a1 a.4.6.1 (A:128-233) Transcriptional regulatory protein PrrA {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  34  1...............................................................................................................................STATSSSETITVGPLEVDIPGRRARVNGVDVDLTKREFDLLAVLAEHKTAVLSRAQLLELVWGYDFAADTNVVDVFIGYLRRKLEAG-GGPRLLHTVRGVGFVLRMQ. 106
48 -44.500d1p2fa1 a.4.6.1 (A:121-217) Response regulator DrrB {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  38  1......................................................................................................................................GLYDFGDLKIDATGFTVFLKGKRIHLPKKEFEILLFLAENAGKVVTREKLLETFWEDPV--SPRVVDTVIKRIRKAIEDDPNRPRYIKTIWGVGYMFT... 96
49 -44.200d3hdva_ c.23.1.0 (A:) automated matches {Pseudomonas putida [TaxId: 160488]}  ali model 3D-neighbors follow..  23  1...RPLVLVVDDNAVNREALILYLKSRGIDAVGADGAEEARLYLYQKRIGLMITDLRMQPESGLDLIRTIRASEALSIIVVSGDTDVEEAVDVMHLGVVDFLLKPVDLGKLLELVNKELK................................................................................................................... 120
50 -44.000d1m5ta_ c.23.1.1 (A:) Cell division response regulator DivK {Caulobacter crescentus [TaxId: 155892]}  ali model 3D-neighbors follow..  27  1...TKKVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIARENKPDLILMDIQLPEISGLEVTKWLKEDAHIPVVAVTAFAMKGDEERIREGGCEAYISKPISVVHFLETIKRLLER.................................................................................................................. 121
51 -43.300d2hqra2 a.4.6.0 (A:118-223) automated matches {Helicobacter pylori [TaxId: 85963]}  ali model 3D-neighbors follow..  27  1.....................................................................................................................................SNVIEIGDLTISPDEEKIIYKGREVEVKGKPFEVLTHLARHRDQIVSKEQLLDAIWEEPEMVTPNVIEVAINQIRQKMD-KPLGISTVETVRRRGYRFCYPK 101
52 -43.200d2pmub_ a.4.6.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}  ali model 3D-neighbors follow..  31  1.................................................................................................................................KEPRNVRLTFADIELDEETHEVWKAGQPVSLSPTEFTLLRYFVINAGTVLSKPKILDHVWRYDFGGDVNVVESYVSYLRRKID--TGEKRLLHTLRGVGYVLREP. 103
53 -42.900d3q9va_ a.4.6.0 (A:) automated matches {Deinococcus radiodurans [TaxId: 1299]}  ali model 3D-neighbors follow..  27  1......................................................................................................................................ESLSMGDLTLDPQKRLVTYKGEELRLSPKEFDILALLIRQPGRVYSRQEIGQEIWQGRLPEGSNVVDVHMANLRAKLR-DLDGYGLLRTVRGVGYALR... 97
54 -42.900d3eqza1 c.23.1.0 (A:3-125) automated matches {Colwellia psychrerythraea [TaxId: 167879]}  ali model 3D-neighbors follow..  25  1....NRVFIVDDDTLTCNLLKTIVEPIFGNV-EAFQHPRAFLTLSLNKQDIIILDLMMPDMDGIEVIRHLAEHKPASLILISGYDSGVTLALSCGLNVINTFTKPINTEVLTCFLTSLSNR.................................................................................................................. 122
55 -42.500d2jzya_ a.4.6.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 573]}  ali model 3D-neighbors follow..  33  2....................................................................................................................................AATVCTIADMTVDMVRRTVIRSGKKIHLTGKEYVLLELLLQRTGEVLPRSLISSLVWNMNFDSDTNVIDVAVRRLRSKID-DDFEPKLIHTVRGAGYVLEIRE 103
56 -42.300d3q15c_ c.23.1.1 (C:) Sporulation response regulator Spo0F {Bacillus subtilis [TaxId: 1423]}  ali model 3D-neighbors follow..  34  1....EKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDNIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYL.................................................................................................................... 116
57 -42.100d5tqja_ c.23.1.0 (A:) automated matches {Burkholderia phymatum [TaxId: 148447]}  ali model 3D-neighbors follow..  30  1...KPFVVVVDDDASVGRAIRRLLRSVGIAADTYTSGDEFLDVLSAYRPDCVILDVQMPGSNGIEVQRRLAG-GAVPVIFITAHDDAGVRETALAAGARAYLRKPFNDVLFIRTVCAVLGIAAP............................................................................................................... 123
58 -41.900d1kgsa1 a.4.6.1 (A:124-225) PhoB {Thermotoga maritima [TaxId: 2336]}  ali model 3D-neighbors follow..  22  1...................................................................................................................................SKSTKLVCGDLILDTATKKAYRGSKEIDLTKKEYQILEYLVMNKNRVVTKEELQEHLWSFDDEVFSDVLRSHIKNLRKKVDK-GFKKKIIHTVRGIGYVARDE. 102
59 -41.200d2mska_ c.23.1.1 (A:) NTRC receiver domain {Salmonella typhimurium [TaxId: 90371]}  ali model 3D-neighbors follow..  29  3...RGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALASKTPDVLLSDIRMPGMDGLALLKQIKQRHMLPVIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAISHYQE............................................................................................................... 124
60 -41.000d2jrla_ c.23.1.0 (A:) automated matches {Aquifex aeolicus [TaxId: 224324]}  ali model 3D-neighbors follow..  27  2....KRVLVVDDEESITSSLSAILEEEGYHPDTAKTLREAEKKIKELFFPVIVLDVWMPDGDGVNFIDFIKENSDSVVIVITGHGSVDTAVKAIKKGAYEFLEKPFSVERFLLTIKHAFEE.................................................................................................................. 119
61 -41.000d2qr3a1 c.23.1.0 (A:2-125) automated matches {Bacteroides fragilis [TaxId: 295405]}  ali model 3D-neighbors follow..  25  2.....TIIIVDDNKGVLTAVQLLLKNHFSKVITLSSPVSLSTVLREENPEVVLLDMNFTGNEGLFWLHEIKRQYDLPVVLFTAYADIDLAVRGIKEGASDFVVKPWDNQKLLETLLNAASQA................................................................................................................. 124
62 -40.900d4d6ya_ c.23.1.0 (A:) automated matches {Brucella abortus [TaxId: 235]}  ali model 3D-neighbors follow..  32  1.....DILVVDDEVDIRDLVAGILSDEGHETRTAFDADSALAAINDRAPRLVFLDIWLQGLDGLALLDEIKKQHELPVVMISGHGNIETAVSAIRRGAYDFIEKPFKADRLILVAERALETSK................................................................................................................ 121
63 -40.700d2m87a_ a.4.6.0 (A:) automated matches {Klebsiella pneumoniae [TaxId: 1185418]}  ali model 3D-neighbors follow..  28  1..................................................................................................................................NQGDNEISVGNLRLNVTRRLVWLGETALDLTPKEYALLSRLMMKAGSPVHREILYNDIYSWDNEPATNTLEVHIHNLREKIG-----KSRIRTVRGFGYMLANNI 100
64 -40.700d4euka_ c.23.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}  ali model 3D-neighbors follow..  26  4.....KILLVEDNKINIMVAKSMMKQLGHTMDIANNGVEAITAINSSSYDLVLMDVCMPVLDGLKATRLIRSTNRLPIIAMTANTLAESSEECYANGMDSFISKPVTLQKLRECLQQYLH................................................................................................................... 147
65 -40.100d2ayxa1 c.23.1.1 (A:817-949) Sensor kinase protein RcsC, C-terminal domain {Escherichia coli [TaxId: 562]}  ali model 3D-neighbors follow..  27  10.....MILVVDDHPINRRLLADQLGSLGYQCKTANDGVDALNVLSKNHIDIVLSDVNMPNMDGYRLTQRIRQLLTLPVIGVTANALAEEKQRCLESGMDSCLSKPVTLDVIKQTLTLYAERVRKSRDS........................................................................................................... 133
66 -39.700d5kbxb_ c.23.1.0 (B:) automated matches {Baker`s yeast (Saccharomyces cerevisiae) [TaxId: 559292]}  ali model 3D-neighbors follow..  28  7.....NVLIVEDNVINQAILGSFLRKHKISYKLAKNGQEAVNIWKEGGLHLIFMDLQLPVLSGIEAAKQIRDQAPVIIVALTASNSQMDKRKALLSGCNDYLTKPVNLHALSKKITEWG.................................................................................................................... 149
67 -39.600d3i42a1 c.23.1.0 (A:19-134) automated matches {Methylobacillus flagellatus [TaxId: 265072]}  ali model 3D-neighbors follow..  18  1....QQALIVEDYQAAAETFKELLEMLGFQADYVMSGTDALHAMSTRGYDAVFIDLNLPDTSGLALVKQLRALKTSKFVAVSGFAKN-DLGKEACELFDFYLEKPIDIASLEPILQSI..................................................................................................................... 116
68 -39.300d1s8na_ c.23.1.1 (A:) Probable two-component system transcriptional regulator Rv1626 {Mycobacterium tuberculosis [TaxId: 1773]}  ali model 3D-neighbors follow..  26  1.AVPRRVLIAEDEALIRMDLAEMLREEGYEIVEAGDGQEAVELAELHKPDLVIMDVKMPRRDGIDAASEIASKRIAPIVVLTAFSQRDLVERARDAGAMAYLVKPFSISDLIPAIELAVSRFREITALEGEVATLSERLETRKLVERAKGLLQTKHGMT-EPDAFKWIQRAAMDRRTTMKREVVLETL............................................... 189
69 -39.200d1ny5a1 c.23.1.1 (A:1-137) Transcriptional activator sigm54 (NtrC1), N-terminal domain {Aquifex aeolicus [TaxId: 63363]}  ali model 3D-neighbors follow..  27  2.....NVLVIEDDKVFRGLLEEYLSMKGIKVESAERGKEAYKLLSEKHFNVVLLDLLLPDVNGLEILKWIKERSETEVIVITGHGTIKTAVEAMKMGAYDFLTKPCMLEEIELTINKAIEHRK................................................................................................................ 120
70 -39.100d3jtea1 c.23.1.0 (A:4-128) automated matches {Clostridium thermocellum [TaxId: 203119]}  ali model 3D-neighbors follow..  27  1....AKILVIDDESTILQNIKFLLEIDGNEVLTASSSTEGLRIFTENSIDVVITDMKMPKLSGMDILREIKKITHMAVIILTGHGDLDNAILAMKEGAFEYLRKPVTAQDLSIAINNAINRKK................................................................................................................ 122
71 -38.900d1qkka1 c.23.1.1 (A:5-143) Transcriptional regulatory protein DctD, receiver domain {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]}  ali model 3D-neighbors follow..  20  2.....SVFLIDDDRDLRKAMQQTLELAGFTVSSFASATEALAGLSADFAGIVISDIRMPGMDGLALFRKILALDDLPMILVTGHGDIPMAVQAIQDGAYDFIAKPFAADRLVQSARRAEEKRRLVMENRSLRRAAEAASEGL............................................................................................. 139
72 -38.500d3khta_ c.23.1.0 (A:) automated matches {Hahella chejuensis [TaxId: 349521]}  ali model 3D-neighbors follow..  25  1...SKRVLVVEDNPDDIALIRRVLDRKDIQLEFVDNGAKALYQVQQAKYDLIILDIGLPIANGFEVMSAVRKPQHTPIVILTDNVSDDRAKQCMAAGASSVVDKSSNNTDFYGRIYAIFSY.................................................................................................................. 124
73 -38.300d5dcma1 a.4.6.0 (A:128-221) automated matches {Streptococcus agalactiae [TaxId: 1311]}  ali model 3D-neighbors follow..  34  2........................................................................................................................................LTFGGFTLTRE-GLLSSQDKEVILSPTENKILSILLMHPKQVVSKESLLEKLWENDSFIDQNTLNVNMTRLRKKIV--PIGFDYIHTVRGVGYLLQ... 94
74 -37.600d3hdga1 c.23.1.0 (A:8-130) automated matches {Wolinella succinogenes [TaxId: 844]}  ali model 3D-neighbors follow..  20  3.....KILIVEDDTDAREWLSTIISNHFPEVWSAGDGEEGERLFGLHAPDVIITDIRMPKLGGLEMLDRIKAGGKPYVIVISAFSEMKYFIKAIELGVHLFLPKPIEPGRLMETLEDFRHIKLAK.............................................................................................................. 123
75 -37.300d1dbwa_ c.23.1.1 (A:) Transcriptional regulatory protein FixJ, receiver domain {Rhizobium meliloti [TaxId: 382]}  ali model 3D-neighbors follow..  22  3...DYTVHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPDVRNGVLVTDLRMPDMSGVELLRNLGDLKNIPSIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERASEH.................................................................................................................. 121

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 8 9 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.