current user: public

If you have questions about the server, please let us know.

Query: gi|161375866|ref|NP_370532.2| histidine ammonia-lyase (SAV0008) [Staphylococcus aureus subsp. aureus Mu50], from S.aureus

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500
# Score Template Links and tools%idFirst MTLYLDGETLTIEDIKSFLQQQSKIEIIDDALERVKKSRAVVERIIENEETVYGITTGFGLFSDVRIDPTQYNELQVNLIRSHACGLGEPFSKEVALVMMILRLNTLLKGHSGATLELVRQLQFFINERIIPIIPQQGSLGASGDLAPLSHLALALIGEGKVLYRGEEKDSDDVLRELNRQPLNLQAKEGLALINGTQAMTAQGVISYIEAEDLGYQSEWIAALTHQSLNGIIDAYRHDVHSVRNFQEQINVAARMRDWLEGSTLTTRQAEIRVQDAYTLRCIPQIHGASFQVFNYVKQQLEFEMNAANDNPLIFEEANETFVISGGNFHGQPIAFALDHLKLGVSELANVSERRLERLVNPQLNGDLPAFLSPEPGLQSGAMIMQYAAASLVSENKTLAHPASVDSITSSANQEDHVSMGTTAARHGYQIIENARRVLAIECVIALQAAELKGVEGLSPKTRRKYEEFRSIVPSITHDRQFHKDIEAVAQYLKQSIYQTTACHLast
1 -137.000d1gkma_ a.127.1.2 (A:) Histidine ammonia-lyase (HAL) {Pseudomonas putida [TaxId: 303]}  ali model 3D-neighbors follow..  38  2.ELTLKPGTLTLAQLRAIHAAPVRLQLDASAAPAIDASVACVEQIIAEDRTAYGINTGFGLLASTRIASHDLENLQRSLVLSHAAGIGAPLDDDLVRLIMVLKINSLSRGFSGIRRKVIDALIALVNAEVYPHIPLKGSVGASGDLAPLAHMSLVLLGEGKARYKGQWLSATEALAVAGLEPLTLAAKEGLALLNGTQASTAYALRGLFYAEDLYAAAIACGGLSVEAVLGSRSPFDARIHEARGQRGQIDTAACFRDLLGDSSEVSHKNADKVQDPYSLRCQPQVMGACLTQLRQAAEVLGIEANAVSDNPLVFAA--EGDVISGGNFHAEPVAMAADNLALAIAEIGSLSERRISLMMDKHMSQLPP-FLVENGGVNSGFMIAQVTAAALASENKALSHPHSVDSLPTSANQEDHVSMAPAAGKRLWEMAENTRGVLAIEWLGACQGLDLRKGLKTSAKLEKARQALRSEVAHYDRDRFFAPDIEKAVELLAKGSLTGLLP. 502
2 -125.000d1y2ma_ a.127.1.2 (A:) Phenylalanine ammonia-lyase, PAL {Fungus (Rhodosporidium toruloides) [TaxId: 5286]}  ali model 3D-neighbors follow..  25  34.TLELDGYSLNLGDVVSAARKGRPVRVKDSDEIRSKIDKSVEFLRSQLSMSVYGVTTGFGGSADTRTEDAISLQPSSFDSFRLGRGLENSLPLEVVRGAMTIRVNSLTRGHSAVRLVVLEALTNFLNHGITPIVPLRGTISASGDLSPLSYIAAAISGHPDSKVKEKILYAREAMALFNLEPVVLGPKEGLGLVNGTAVSASMATLALHDAHMLSLLSQSLTAMTVEAMVGHAGSFHPFLHDVRPHPTQIEVAGNIRKLLEGSRFAVHHEEILRQDRYPLRTSPQWLGPLVSDLIHAHAVLTIEAGQSTTDNPLI-DVENKTSHHGGNFQAAAVANTMEKTRLGLAQIGKLNFTQLTEMLNAGMNRGLPSCLAEDPSLSYHCKGLDIAAAAYTSELGHLANPVTTHVQPAEMANQAVNSLALISARRTTESNDVLSLLLATHLYCVLQAIDLRAIEFKKQFGPAIVSLIDQHFGSAMTGSNLRDELVEKVNKTLAKRLEQTNS. 565
3 -118.000d1w27a_ a.127.1.2 (A:) Phenylalanine ammonia-lyase, PAL {Parsley (Petroselinum crispum), PAL1 [TaxId: 4043]}  ali model 3D-neighbors follow..  27  32.VVKLGGETLTISQVAAISARGVTVELSEAARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQKELLNAGIFGNGSDNTLPHSATRAAMLVRINTLLQGYSGIRFEILEAITKFLNQNITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPTPEEAFKLAGVEGGFFELQPKEGLALVNGTAVGSGMASMVLFEANILAVLAEVMSAIFAEVMQGKPEFTDHLTHKLKHHPGQIEAAAIMEHILDGSAYVKAAQKKPKQDRYALRTSPQWLGPQIEVIRSSTKMIEREINSVNDNPLIDVS--RNKAIHGGNFQGTPIGVSMDNTRLAIAAIGKLMFAQFSELVNDFYNNGLPSNLSRNPSLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQDVNSLGLISSRKTSEAVEILKLMSTTFLVGLCQAIDLRHLENLKSTVKNTVSSVAKRVLTMGVNGELHPSRFCEKDLLRVVDREYIFAY 554
4 -5.710d1s68a_ d.142.2.4 (A:) RNA ligase 2, N-terminal domain {Bacteriophage T4 [TaxId: 10665]}  ali model 3D-neighbors follow..  10  32AREKIHGTNFSLRDKVTCAKRTGPILPAEDYADSIKAVQDIMETSAVVSYQVFGEFAGPGIQKNVDYCDKDFYVFDIIVTTESGDVT--------------------------VDDYMMESFCNTFKFKMAPLL----GRGKFEELIKLPNDLDSVVQDYNFTVDHAGLVDANKCVWNAEAKGEVFTAEGYVLKPCYPSWLRNGNRVAIKCKN................................................................................................................................................................................................................................................................................................... 228
5 -5.100d2v25a_ c.94.1.0 (A:) automated matches {Campylobacter jejuni [TaxId: 197]}  ali model 3D-neighbors follow..  3.........................................LESIKSKGQLIVGVKNDVPHYALLDQATGEIKGFEVDVAKLLAKSIGDDKKIKLVAVNAKTRGPLLDNGSVDARKRIYNFSEPYYQDAIGLLVLKEKKYKSLADM------------------KGANIGVAQATTKKAIGEAAKKIGIDVKFSEFPDYPSIKAALDAKRVDAFSVDKSILLGYVDDKSEILPDSFEPQSYGIVTKKDDPAFAKYVDDFVK................................................................................................................................................................................................................................................... 216
6 -5.090d1xg8a1 c.47.1.17 (A:2-102) Hypothetical protein SA0798 {Staphylococcus aureus [TaxId: 1280]}  ali model 3D-neighbors follow..  16  1..................................................VVYGADVICASCVNAPTSKDIYDWLQPLLKRKYP------------NISFKYTYIDITKDNDNLTDHDLQFIERIEQDELYPLITMNDEYVADGYIQ..................................................................................................................................................................................................................................................................................................................................................................... 86
7 -4.450d2pi2a_ b.40.4.3 (A:) Replication protein A 32 KDa subunit (RPA32) fragment {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  8........PCTISQLLSATLVDEVFRIGNVEISQVTIVGIIRHAEKAPTNIVYKIDDMTAAPMDVR-TDDTSSENTVVPPETYVKVAGHLRSFQNKKSLVAFKIMPL-EDMNEFTTHILEVINAHMVLSKANSQP................................................................................................................................................................................................................................................................................................................................................................................. 136
8 -4.230d1pn2a1 d.38.1.4 (A:4-151) 2-enoyl-coa hydratase domain of multifunctional peroxisomal hydratase-dehydrogenase-epimerase {Yeast (Candida tropicalis) [TaxId: 5482]}  ali model 3D-neighbors follow..  1.......................................DPVWRFDDRDVILYNIALGATTKQLKYVYENDSDFQVIPTFGHLITFNSGKSQNSFAKLLRNFNPMLLLHGEHYLEIKTTFEPIATTPKGTNVVIVHGSKSNKSGELIYSNEATYFIRNCQADNKVYADRPAFAT.......................................................................................................................................................................................................................................................................................................................................... 148
9 -4.210d2qdla1 b.40.7.0 (A:10-155) automated matches {Thermoanaerobacter tengcongensis [TaxId: 273068]}  ali model 3D-neighbors follow..  10  9.........................................................................................................SLAEELYGLDIFDVHEVVKDVSITKIPETPEEGIINLRGKIIPVIDLK----------------------KRFGIGKRGKSKDSRIIIVEILGQKAGLIVDAVHEVIPIIEPPPPVTTIDTAFVE-----------------GIAKTDDKMIIIIKLHFLFEVNGKEMLLN.................................................................................................................................................................................................................................... 146
10 -4.150d2i5ha1 e.71.1.1 (A:16-195) Hypothetical protein AF1531 {Archaeoglobus fulgidus [TaxId: 2234]}  ali model 3D-neighbors follow..  10  26.........................................................................................................................................................................PLAQVVGERNFTLLEVSIRKGKQPLVMDRVYIGKGE-VVYKIKRRLRYEDLTPAAKTEIIKQDEKKYVDFFNKADSITTRMHQLELLPGV--GKKMMWAIIEERKKRPFSFEDIAQRVKGIQRPEKLIVSRIIYEIKNPQTKYKLFTA........................................................................................................................................................................................... 180

FFAS is supported by the NIH grant R01-GM087218-01
1 4 5 8 9 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rychlewski L, Wilson IA, Lesley SA, Godzik A. XtalPred: a web server for prediction of protein crystallizability. Bioinformatics. 2007 Dec 15;23(24):3403-5. Epub 2007 Oct 5.