current user: public

If you have questions about the server, please let us know.

Query: gi|33438754|ref|NP_878038.1| Putative protein of unknown function; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching; Yal067w-ap (YAL067W-A) [Saccharomyces cerevisiae], from S.cerevisiae

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
# Score Template Links and tools%idFirst MPIIGVPRCLIKPFSVPVTFPFSVKKNIRILDLDPRTEAYCLSLNSVCFKRLPRRKYFHLLNSYNIKRVLGVVYCLast
1 -8.050[S] COG4003 Uncharacterized protein conserved in archaea  ali follow..  28  5..LIFLPRSITPRDYVPSKQISFLKLNIFLLSISLEKSS---------------KNNFLMLSSENYFRQFGVI.. 60
2 -6.800[S] KOG3188 Uncharacterized conserved protein  ali follow..  19  139............PFPLTLKFKAMLQRGVDLVSLDS---AWVSSAS------------WYFLCMFGLRSIYTLV.. 184
3 -5.820[R] KOG0522 Ankyrin repeat protein  ali follow..  18  490.......KGLRPVLWLSERFPLQTKELLPLLDILANKVKAIRRLRELMTTKLP--------GTFPVKVAIPVIP. 549
4 -5.480[KB] KOG3265 Histone chaperone involved in gene silencing  ali follow..  13  10VQILDNPAMFVDKFKMEITFEVQVLDSALVGPIPEGRHKFVFDAEHPDISKIPVEDIVLLRCKYNDQEFINMGW. 112
5 -5.350[S] KOG2889 Predicted PRP38-like splicing factor  ali follow..  19  36...........KEHCFALTAELVVDKGMDLRYIGG-TPFLCL-ALKMLQIQPDKDIVLEFIQQEEFKRALGAMY. 106
6 -5.280[L] KOG1532 GTPase XAB1, interacts with DNA repair protein XPA  ali follow..  15  46..VVGMAGSGKTSFLHRLCHTFDSKSHGYVVNLDPAVMSLPFGANIDIRDTVKYKE---VMKQYNLGPNGGILTS 116
7 -5.270[U] KOG4697 Integral membrane protein involved in transport between the late Golgi and endosome  ali follow..  18  72.........VLNAFLASLALWCIVRRAKLCLDFSCTFHVLHLLICWWYNRSFPANASWWLLNTGTIMCIGGEFLC 139
8 -5.070[R] KOG1533 Predicted GTPase  ali follow..  14  38..VIGAPGAGKSTFCAGLDIFSQTKRPFLTINLDPANDTMAYAPDVNITEMITVND---VMDRLGLGPNGALKYC 108
9 -5.040[K] KOG1534 Putative transcription factor FET5  ali follow..  16  8..VCGVASSGKSTFCGALSYMKSVGRSCHLVNLDPAAENFEWEPTVDIRDLISIDD---VMEELDYGPNGGLIYC 78
10 -4.740[S] COG3812 Uncharacterized protein conserved in bacteria  ali follow..  56  172........................................................YFHLTTAYDILRHNGV... 187

FFAS is supported by the NIH grant R01-GM087218-01
1 4 3 9 1 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Grynberg M, Godzik A. NERD: a DNA processing-related domain present in the anthrax virulence plasmid, pXO1. Trends Biochem Sci. 2004 Mar;29(3):106-10.