|
current user: public |
|
Query: gi|33438754|ref|NP_878038.1| Putative protein of unknown function; identified by gene-trapping, microarray-based expression analysis, and genome-wide homology searching; Yal067w-ap (YAL067W-A) [Saccharomyces cerevisiae], from S.cerevisiae |
. 10 . 20 . 30 . 40 . 50 . 60 . 70 . | |||||||
# | Score | Template | Links and tools | %id | First | MPIIGVPRCLIKPFSVPVTFPFSVKKNIRILDLDPRTEAYCLSLNSVCFKRLPRRKYFHLLNSYNIKRVLGVVYC | Last |
1 | -5.030 | IDP91344 hypothetical protein VV2_0026 [Vibrio vulnificus CMCP6] VV2_0026 [Vibrio vulnificus CMCP6] | ali follow.. | 22 | 29 | ..........LRPFAYDLRLPIALKQSVRSLQVKPQGVIYADLFEQISLRKTPMPKKLELVKS............ | 89 |
2 | -4.890 | IDP00791 superantigen-like protein SACOL1178 [Staphylococcus aureus subsp. aureus COL] | ali follow.. | 17 | 167 | ........................KPVLTLKEIDFRAREALIKNKILLSKRLHSDLANVYVKNPNKITV...... | 233 |
3 | -4.820 | IDP05142 isoleucyl-tRNA synthetase [Bacillus anthracis str. Sterne] BAS2027 [Bacillus anthracis str. Sterne] | ali follow.. | 15 | 226 | ............PWTLPANVALAVHPNMEYVKAKQEGHVYIVAKERV------LKENYEVLSVHKGEELLNISY. | 284 |
4 | -4.640 | IDP91814 gene: mdh; malate dehydrogenase, NAD(P)-binding [Escherichia coli str. K-12 substr. MG1655] b3236 [Escherichia coli str. K-12 substr. MG1655] | ali follow.. | 10 | 3 | VAVLGAAGGIGQALALLLKTQLPSGSELSLYDIAPVTPGVAVDLSHI............................ | 49 |
5 | -4.630 | IDP00770 superantigen-like protein SACOL0473 [Staphylococcus aureus subsp. aureus COL] | ali follow.. | 17 | 160 | ........................KEEVSLKELDFKIRKLLIEKYRLLSEKLSFERMFDVMDSKQIKNI...... | 227 |
6 | -4.590 | IDP02546 gene: neuA1; acylneuraminate cytidylyltransferase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1143 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819] | ali follow.. | 18 | 104 | ........CKQYPSFIPVKYPHEV-----QIENPQSEENKLHSYYNYVASFIPQDEWLIKIDVYDAKKLYKSFY. | 167 |
7 | -4.480 | IDP91143 superantigen-like protein [Staphylococcus aureus subsp. aureus NCTC 8325] SAOUHSC_00393 [Staphylococcus aureus subsp. aureus NCTC 8325] | ali follow.. | 17 | 160 | ........................KEEVSLKELDFKIRKLLIKKYKLLSDKLDFERMADVINSEQIKNI...... | 227 |
8 | -4.350 | IDP00895 gene: grxB; glutaredoxin 2 STM1165 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] | ali follow.. | 20 | 1 | MKLYIYDHC---PFCVKARMIFGLKNPVELNVLQNDDEATPTRMIG--QKMVPILQKRYLPESMDIVHYVDNLD. | 73 |
9 | -4.320 | IDP04114 conserved hypothetical protein [Yersinia pestis CO92] YPO1611 [Yersinia pestis CO92] | ali follow.. | 14 | 8 | ........SKIIRREIPADVVYQDELVTAFRDIAPQAPTHIL................................. | 41 |
10 | -4.290 | IDP06464 gene: I6L; I6L [Monkeypox virus Zaire-96-I-16] NP_536494 [Monkeypox virus Zaire-96-I-16] | ali follow.. | 24 | 270 | ....................PYIPKKIVSLLDLPSNVEIKAISRSGV--------DFITHINNKRLTTILVIA.. | 314 |
FFAS is supported by the NIH grant R01-GM087218-01
|
![]() ![]() ![]() ![]() ![]() ![]() |
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Pawlowski K, Jaroszewski L, Rychlewski L, Godzik A. Sensitive sequence comparison as protein function predictor. Pac Symp Biocomput. 2000;:42-53. |