current user: public

If you have questions about the server, please let us know.

Query: gi|33438755|ref|NP_878039.1| Putative protein of unknown function; identified by expression profiling and mass spectrometry; Yal063c-ap (YAL063C-A) [Saccharomyces cerevisiae], from S.cerevisiae

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .
# Score Template Links and tools%idFirst MCPRTVLLIININHWFYDKNIVRIILTFRLDSGHISDICFINKNLANALITADISLLKRHDIRCTKYIITYYQRYRNKEKGKFISLCKNTIISSSVLast
1 -6.940sp|Q6F5E8|LR16C_HUMAN Leucine-rich repeat-containing protein 16C OS=Homo sapiens GN=RLTPR PE=1 SV=2  ali   20  2.........................LSARVDEG-VEE--FFSKR-----LIQQDRLWAPEEDPATEGGATPVPRTLRKKLGTLFAFKKPRSTRGP. 63
2 -6.820sp|Q6VY07|PACS1_HUMAN Phosphofurin acidic cluster sorting protein 1 OS=Homo sapiens GN=PACS1 PE=1 SV=2  ali   15  120LFSLTLKKLVMLKE--MDKDLNSVVIAVKLQGSRSNEIVLPASGLVETELQLTFSLQYPHFLK-LQIMLQRRKRYKNRTILGYKTLAVGLINMAEV 221
3 -6.380sp|Q96MI9|CBPC4_HUMAN Cytosolic carboxypeptidase 4 OS=Homo sapiens GN=AGBL1 PE=2 SV=2  ali   14  248.......................LRFFSKFESGNLRKAIQVREF--------EYDLLVNADVNSTQHQQWFYFKVSGMQAA............... 297
4 -6.340sp|Q9NR09|BIRC6_HUMAN Baculoviral IAP repeat-containing protein 6 OS=Homo sapiens GN=BIRC6 PE=1 SV=2  ali   25  25...RTWKLQTDSNSW--DEHVFELVLPKACMVGHV-DFKFVLNSNITNIPQIQVTLLKNK.................................... 78
5 -6.280sp|Q8WWB3|DYDC1_HUMAN DPY30 domain-containing protein 1 OS=Homo sapiens GN=DYDC1 PE=1 SV=1  ali follow..  10  2....................................ESIYLQKHLGACLTQGLAEVARVRPVDPIEYLALWIYKYKENVTME.............. 47
6 -6.260sp|Q96IM9|DYDC2_HUMAN DPY30 domain-containing protein 2 OS=Homo sapiens GN=DYDC2 PE=1 SV=1  ali follow..  16  2....................................ETNYLKRCFGNCLAQALAEVAKVRPSDPIEYLAHWLYHYRKTAKAKEENREKKIHLQEE. 60
7 -6.220sp|Q15398|DLGP5_HUMAN Disks large-associated protein 5 OS=Homo sapiens GN=DLGAP5 PE=1 SV=2  ali   17  261..........................................KEVPSLERNEGRIAQPHHG-------VPYFRNILQSETEKLTSHCFE....... 300
8 -6.190sp|P59091|CU093_HUMAN Uncharacterized protein C21orf93 OS=Homo sapiens GN=C21orf93 PE=5 SV=1  ali follow..  20  87..PHTHGLPARPSHVRHQTEPVQVASRWHVPSDGLCRPCHVHQLLHPPLVPA............................................ 136
9 -6.060sp|O95838|GLP2R_HUMAN Glucagon-like peptide 2 receptor OS=Homo sapiens GN=GLP2R PE=1 SV=1  ali follow..  18  346..PMMLCVTVNF---FIFLKILKLLIS-KLKAHQMCFRDYKYRLAKSTLVL--IPLLGVHEI--AKLIRLFIQLTLSSFHGFLVALG-NGEVKAEL 447
10 -5.980sp|Q9NQW8|CNGB3_HUMAN Cyclic nucleotide-gated cation channel beta-3 OS=Homo sapiens GN=CNGB3 PE=1 SV=2  ali   21  233......CCFIPLRLVFPYQTHYWLIADIICDIIYLYDMLFIQPRVRGGDIIVDSNELRKHYRTSTKF............................. 300

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 5 6 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.