current user: public

If you have questions about the server, please let us know.

Query: gi|6319249|ref|NP_009332.1|(removed signalp:1-20) hypothetical protein; Pau8p (YAL068C) [Saccharomyces cerevisiae], from S.cerevisiae

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# Score Template Links and tools%idFirst TTTLAQSDERVNLVELGVYVSDIRAHLAQYYMFQAAHPTETYPVEVAEAVFNYGDFTTMLTGIAPDQVTRMITGVPWYSSRLKPAISSALSKDGIYTIANLast
1 -7.570sp|Q9H3S5|PIGM_HUMAN GPI mannosyltransferase 1 OS=Homo sapiens GN=PIGM PE=1 SV=1  ali follow..  22  265....................RDIRHNFSPYLGIAAFLPQLILLSAVSFAYYRDLVFCCFLHTSIFVTFNKVCTSFLWYLCLL.................. 343
2 -6.680sp|Q6YHU6|THADA_HUMAN Thyroid adenoma-associated protein OS=Homo sapiens GN=THADA PE=1 SV=1  ali   239...............VGRLLEYVYTHWEHPLDALRHQTKIMFKNLLQMHRLTVEGADFVPDPF-FVELTESLLRLEWH...................... 300
3 -6.140sp|Q5UE93|PI3R6_HUMAN Phosphoinositide 3-kinase regulatory subunit 6 OS=Homo sapiens GN=PIK3R6 PE=1 SV=1  ali   103DGEMLPGVSRLHTARVLVLGDDLGRLAQAYHRLRKRETQKFLSLQLYYIPVLAPEKPAASRQPELGELATFLGRVPWYQSNVNTLCPAIHKLAEMPPSLD 210
4 -5.920sp|Q92793|CBP_HUMAN CREB-binding protein OS=Homo sapiens GN=CREBBP PE=1 SV=3  ali   11  45ALFAFEEIDGVDVCFFGMHVQEYGSDCPPYISYLDSIHHEILIGYLEYVKKLGYVTGHIWACPPSEGDDYIFHCHPWYKKMLDKAFAERI.......... 165
5 -5.860sp|P59093|CU099_HUMAN Uncharacterized protein C21orf99 OS=Homo sapiens GN=C21orf99 PE=2 SV=1  ali follow..  16  4.........QMELISLNAFINNFWNINKRYLKILK--------------------------VIQKEHLKEHLTRLPWRKEHLT................. 53
6 -5.630sp|Q02040|AK17A_HUMAN A-kinase anchor protein 17A OS=Homo sapiens GN=AKAP17A PE=1 SV=2  ali   19  1.......................................................................LEGLPWFSEDVLVKVFEKFGE........ 33
7 -5.610sp|P48751|B3A3_HUMAN Anion exchange protein 3 OS=Homo sapiens GN=SLC4A3 PE=1 SV=2  ali   235..................LVRDVRRRYPHYPS------------------LRDALHSQCVAAVLFIYFAALSPAIT-FGGLLGEKTEGLMGVSELIVSTA 298
8 -5.580sp|Q09472|EP300_HUMAN Histone acetyltransferase p300 OS=Homo sapiens GN=EP300 PE=1 SV=2  ali   13  9ALFAFEEIDGVDLCFFGMHVQEYGSDCPPYISYLDSVHHEILIGYLEYVKKLGYTTGHIWACPPSEGDDYIFHCHPWYKKMLDKAVSERI.......... 129
9 -5.410sp|Q9UKL3|C8AP2_HUMAN CASP8-associated protein 2 OS=Homo sapiens GN=CASP8AP2 PE=1 SV=1  ali   18  1...........................KNYMKFKAKFSLIQFHRIIESAIL---SFTSLIKHLNLHKISKSVTTL---QKNLCDIIESKLKQ........ 59
10 -5.390sp|Q96DN5|WDR67_HUMAN WD repeat-containing protein 67 OS=Homo sapiens GN=WDR67 PE=2 SV=2  ali   201AFPFVKLFQNNQLICFEVIATLIINWCQHWFEYFPNPPINILSMIENVLAFHD---KELLQHFIDHDITSQLYAWPLLETVFSEVL.............. 283

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.