current user: public

If you have questions about the server, please let us know.

Query: gi|6319252|ref|NP_009335.1| Putative protein of unknown function; has homology to FLO1; possible pseudogene; (YAL065C) [Saccharomyces cerevisiae], from S.cerevisiae

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst MNSATSETTTNTGAAETTTSTGAAETKTVVTSSISRFNHAETQTASATDVIGHSSSVVSVSETGNTKSLITSGLSTMSQQPRSTPASSIIGSSTASLEISTYVGIANGLLTNNGISVFISTVLLAIVWLast
1 -7.650sp|Q8TEW0|PARD3_HUMAN Partitioning defective 3 homolog OS=Homo sapiens GN=PARD3 PE=1 SV=2  ali   23  8............................................................QEERESSQQAQRQYSSLPRQSRKNASSEGFQSAKENPRYSSYQGSRNGYLGGHGFN---ARVML.... 81
2 -6.500sp|Q5TGU0|TSPO2_HUMAN Translocator protein 2 OS=Homo sapiens GN=TSPO2 PE=2 SV=1  ali follow..  10  35..............................................................................RMLSWCPFYKVLLLVQTAIYSV--VGYASYLVWKDLLGLYAVQLTISWTV 93
3 -6.450sp|Q02846|GUC2D_HUMAN(removed signalp:1-51) Retinal guanylyl cyclase 1 OS=Homo sapiens GN=GUCY2D PE=1 SV=2  ali   14  154LTVDDITFLHPHGGTSRKVAQGSRSSLGARSMSDIRSGPSQHLDSPNIGVYEGDRVWLKKFPGDQHIAIRPATKTAFSKELRHENVALYLGEGPAALWVSEHCGSLQDLLAQREIKLFKSSLLLDLI. 300
4 -6.430sp|P30536|TSPOA_HUMAN Translocator protein OS=Homo sapiens GN=TSPO PE=1 SV=3  ali follow..  18  38..............................................................................QKPSWHPPHWVLGPVWGTLYSA--MGYGSYLVAVVPLGLYTGQLALNWAW 95
5 -6.360sp|P20366|TKN1_HUMAN(removed signalp:1-19) Protachykinin-1 OS=Homo sapiens GN=TAC1 PE=1 SV=1  ali follow..  20  33.........................................................................LQRIARRPKPQQFFGLMGKRDADSSIEKQVALLKALYGHGQISSFVGLM...... 88
6 -6.220sp|A8MWP6|YQ019_HUMAN Uncharacterized protein ENSP00000382042 OS=Homo sapiens PE=2 SV=2  ali follow..  21  51.......................................AEEQPMTGLGIVWHSPLLDKALET------------SLQQQPDFSLGLGHLGLGTDATWMQSFPGSGGDAQAGTGVSGLL......... 119
7 -6.180sp|Q5H8A4|PIGG_HUMAN(removed signalp:1-19) GPI ethanolamine phosphate transferase 2 OS=Homo sapiens GN=PIGG PE=1 SV=1  ali   18  241..........................................................................................SNNIATVDISAFVGLDTYVEIPAVLLTAFGTYAGPVLW 279
8 -6.050sp|Q96D42|TIMD1_HUMAN(removed signalp:1-20) Hepatitis A virus cellular receptor 1 OS=Homo sapiens GN=HAVCR1 PE=1 SV=2  ali follow..  19  175....TSVPVTTTVSTFVPPMPLPRQNHEPVATSPSSPQPAETHPTTLQGAIRREPTSSPLYSYTTDGNDTVTESSDGLWNNNQTQLFLEHSLLTANTTKGIYAGVC--------ISVLVLLALLGVI. 289
9 -5.980sp|O15235|RT12_HUMAN 28S ribosomal protein S12, mitochondrial OS=Homo sapiens GN=MRPS12 PE=1 SV=1  ali follow..  10  46.....................................................PRKLGPTEGRPQLKGVVLCTFTRKPKKPNSANRKCCRVRLSTGREAVCFIGEGHTLQEHQIVLV........... 110
10 -5.660sp|P0C221|CN038_HUMAN Uncharacterized protein C14orf38 OS=Homo sapiens GN=C14orf38 PE=2 SV=1  ali   25  189......................................................................................SDLVYATNIQLNIDTYLGLNT-VLSNSAFHL........... 223

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.