current user: public

If you have questions about the server, please let us know.

Query: gi|7839146|ref|NP_058136.1| Putative protein of unknown function; YAL064C-A is not an essential gene; Yal064c-ap (YAL064C-A) [Saccharomyces cerevisiae], from S.cerevisiae

Results of FFAS03 search in H.sapiens
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst MTGYFLPPQTSSYTFRFAKVDDSAILSVGGDVAFGCCAQEQPPITSTNFTINGIKPWQGRLPDNIAGTVYMYAGFYCPMKIVYSNAVSWHTLPVSVELPDVTTVSDDFAGHVYSFDDDLTAQLYYPLast
1 -39.100sp|P08F94|PKHD1_HUMAN(removed signalp:1-23) Fibrocystin OS=Homo sapiens GN=PKHD1 PE=1 SV=1  ali   11  53LSGFFVAPETNNYTFWIQ-ADSQASLHFSWSEEPRTKVKVASISVGTADWFDSEQNRDEGTWQQKTPKLELLGGAMYYLEAEHHGIAPSRGMRIGVQIHNTWLNPDVVTTYLREKHQIRVRAQRLP 178
2 -38.000sp|Q86WI1|PKHL1_HUMAN(removed signalp:1-20) Fibrocystin-L OS=Homo sapiens GN=PKHD1L1 PE=2 SV=2  ali   10  72FSGFLVAPDSDVYRFYIK-GDDRYAIYFSQTGLPEDKVRIAYHSANANS--------YFSSPTQRSDDIHLQKGKEYYIEILLQEYRLSAFVDVGLYQYRNVYTEQQTGDAVNEEQVIKSQSTILQ 188
3 -34.900sp|P08F94|PKHD1_HUMAN(removed signalp:1-23) Fibrocystin OS=Homo sapiens GN=PKHD1 PE=1 SV=1  ali   13  203LSGFFVAPETNNYTFWIQ-ADSQASLHFSWSEEPRTKVKVASISVGTADWFDSWENRDEGTWQQKTPKLELLGGAMYYLEAEHHGIAPSRGMRIGVQ............................. 299
4 -33.700sp|Q76KP1|B4GN4_HUMAN(removed signalp:1-28) N-acetyl-beta-glucosaminyl-glycoprotein 4-beta-N-acetylgalactosaminyltransferase 1 OS=Homo sapiens GN=B4GALNT4 PE=1 SV=1  ali   141IFGFIHPARDGDVQFSVA-SDDNSEFWLSLDESPAAAQLVAFVGKTGSE---TAPGEFTKFSSQVSKPRRLMASRRYYFELLHKQDDRGSEVGWRAFLP-GLKFEVISSAHISLYTDESALK.... 261
5 -33.000sp|Q6L9W6|B4GN3_HUMAN(removed signalp:1-38) N-acetyl-beta-glucosaminyl-glycoprotein 4-beta-N-acetylgalactosaminyltransferase 2 OS=Homo sapiens GN=B4GALNT3 PE=1 SV=2  ali   14  132IFGYLHPFTDGKIQFAIA-ADDNAEFWLSLDDQVSGLQLLASVGKTGKE---TAPGEFGKFRSQISKPVSLSASHRYYFEVLHKQNEGTDHVEVAWRRNDGAKFTIIDSLSLSLFTNETFLQ.... 252
6 -32.400sp|Q76KP1|B4GN4_HUMAN(removed signalp:1-28) N-acetyl-beta-glucosaminyl-glycoprotein 4-beta-N-acetylgalactosaminyltransferase 1 OS=Homo sapiens GN=B4GALNT4 PE=1 SV=1  ali   1..........GDVQFSVA-SDDNSEFWLSLDESPAAAQLVAFVGKTGSE---TAPGEFTKFSSQVSKPRRLMASRRYYFELLHKQDRGSDHVEVGWRAFLGLKFEVISSAHISLYTDESALK.... 111
7 -30.900sp|Q86WI1|PKHL1_HUMAN(removed signalp:1-20) Fibrocystin-L OS=Homo sapiens GN=PKHD1L1 PE=2 SV=2  ali   12  222FSGFLVAPDSDVYRFYIK-GDDRYAIYFSQTGLPEDKVRIAYHSANANS--------YFSSPTQRSDDIHLQKGKEYYIEILLQEYR....................................... 299
8 -25.100sp|Q6L9W6|B4GN3_HUMAN(removed signalp:1-38) N-acetyl-beta-glucosaminyl-glycoprotein 4-beta-N-acetylgalactosaminyltransferase 2 OS=Homo sapiens GN=B4GALNT3 PE=1 SV=2  ali   11  1....................DDNAEFWLSLDDQVSGLQLLASVGKTGKE---TAPGEFGKFRSQISKPVSLSASHRYYFEVLHKQNEGTDHVEVAWRRNDGAKFTIIDSLSLSLFTNETFLQ.... 102
9 -14.400sp|Q5T7M4|F132A_HUMAN(removed signalp:1-20) Protein FAM132A OS=Homo sapiens GN=FAM132A PE=2 SV=2  ali follow..  14  174.SGRFTAPVSGIFQFSASELQGKARLRARDVVCVLICIESLCQRHTCLEAVSGLESNSRVFTLQVQGLLQLQAGQYASVFVDNGSGAVLTIQAGS-----------SFSGLLL............. 280
10 -13.600sp|Q9H8L6|MMRN2_HUMAN(removed signalp:1-26) Multimerin-2 OS=Homo sapiens GN=MMRN2 PE=1 SV=2  ali   13  233.HGYFRAPERGVYLFAVSVEFGPGPGTG------------QLVFGGHHRTPVCTTGQGSGSTATVFAMAELQKGERVWFEL............................................. 300
11 -12.900sp|Q4G0M1|F132B_HUMAN(removed signalp:1-28) Protein FAM132B OS=Homo sapiens GN=FAM132B PE=2 SV=2  ali follow..  11  218.SGQYRAPVAGFYALAATEPPRRGPPRPRDHLRLLICIQSRCQRNASLEAIMGLESSSELFTISVNGVLYLQMGQWTSVFLDNASGCSLTVRSGS-----------HFSAVLLGV........... 326
12 -12.400sp|Q9H8L6|MMRN2_HUMAN(removed signalp:1-26) Multimerin-2 OS=Homo sapiens GN=MMRN2 PE=1 SV=2  ali   10  83.HGYFRAPERGVYLFAVSVEFGPGPGTG------------QLVFGGHHRTPVCTTGQGSGSTATVFAMAELQKGERVWFELTQGSITKRSLSGTAFGG............................ 167
13 -11.200sp|Q13201|MMRN1_HUMAN(removed signalp:1-19) Multimerin-1 OS=Homo sapiens GN=MMRN1 PE=1 SV=3  ali   12  65.TGKFRIPYLGVYVFKYTIESFSAHISGF----------VDGIDKLAFESENINSEIHCDRVLTGDALLELNYGQEVWLRLAKGTIPAKFPPVTTFSG............................ 153
14 -11.000sp|Q9Y6C2|EMIL1_HUMAN(removed signalp:1-23) EMILIN-1 OS=Homo sapiens GN=EMILIN1 PE=1 SV=2  ali   131.TGVFTAPLAGRYLLSAVRHEKVEAVLSRSNQGVARVDSGGYEPEGLENKPVAESQPSPGTLGVFSLILPLQAGDTVCVDLVMGQLAHSEEPLTIFSG............................ 231
15 -10.500sp|Q6UW01|CBLN3_HUMAN(removed signalp:1-32) Cerebellin-3 OS=Homo sapiens GN=CBLN3 PE=1 SV=1  ali follow..  14  81.SGSFVAPVRGVYSFRFHVVKVYNRQTVQVSLMLNTWPVISAFANDPDVTREA---------ATSSVLLPLDPGDRVSLRLRRGNLLGGWKYSS................................ 164
16 -10.500sp|Q8IUK8|CBLN2_HUMAN(removed signalp:1-51) Cerebellin-2 OS=Homo sapiens GN=CBLN2 PE=2 SV=1  ali follow..  11  81.SSIFVAPRKGIYSFSFHVVKVYNRQTIQVSLMQNGYPVISAFAGDQDVTREA---------ASNGVLLLMEREDKVHLKLERGNLMGGWKYST................................ 164
17 -10.400sp|P23435|CBLN1_HUMAN(removed signalp:1-21) Cerebellin-1 OS=Homo sapiens GN=CBLN1 PE=1 SV=1  ali follow..  13  80.RSTFIAPRKGIYSFNFHVVKVYNRQTIQVSLMLNGWPVISAFAGDQDVTREA---------ASNGVLIQMEKGDRAYLKLERGNLMGGWKYST................................ 163
18 -10.100sp|Q9NTU7|CBLN4_HUMAN(removed signalp:1-27) Cerebellin-4 OS=Homo sapiens GN=CBLN4 PE=1 SV=1  ali follow..  11  82.ESVFVAPRKGIYSFSFHVIKVYQSQTIQVNLMLNGKPVISAFAGDKDVTREA---------ATNGVLLYLDKEDKVYLKLEKGNLVGGWQYST................................ 165
19 -10.100sp|Q9BXJ3|C1QT4_HUMAN(removed signalp:1-16) Complement C1q tumor necrosis factor-related protein 4 OS=Homo sapiens GN=C1QTNF4 PE=1 SV=2  ali follow..  12  202.AGVFRCRLPGAYFFSFT---------LGKLPRKTLSVKLMKNRDEVQAMIYDDGASRRREMQSQSVMLALRRGDAVWLLSHDHDGYGAYSNHGKYITFSGFLVYPDLAP................ 301
20 -9.960sp|Q9BXX0|EMIL2_HUMAN(removed signalp:1-30) EMILIN-2 OS=Homo sapiens GN=EMILIN2 PE=1 SV=3  ali   12  161.TGVFTAPYDGRYLITATERDAYVEAVL-SNASVAQLHTAGYRREFLEYHRPPGALHTCGGPGAFHLIVHLKAGDAVNVVVTGGKLA------------DFDEMYSTFSGVFL............. 266
21 -9.760sp|Q5VWW1|C1QL3_HUMAN(removed signalp:1-20) Complement C1q-like protein 3 OS=Homo sapiens GN=C1QL3 PE=2 SV=1  ali follow..  12  140.TGKFTCSIPGIYFFTYHRGGDGTSMWAD------------CKNNQVRASAIAQDADQNYDYASNSVVLHLEPGDEVYIKLHGGNNNKYSTFSGFIIYAD.......................... 235
22 -9.520sp|Q6IMN6|CAPR2_HUMAN Caprin-2 OS=Homo sapiens GN=CAPRIN2 PE=1 SV=1  ali   10  134.LGRFNCPVNGTYVFIFHMLKLAVNVPLYVNLMKNEEVLVSAYANDGAPDHET---------ASNHAILQLFQGDQIWLRLIYGSSWKYSTFSGYLLYQD.......................... 227
23 -9.360sp|Q9BXI9|C1QT6_HUMAN(removed signalp:1-27) Complement C1q tumor necrosis factor-related protein 6 OS=Homo sapiens GN=C1QTNF6 PE=1 SV=3  ali follow..  15  134.TGQFAAPLRGIYFFSLNHSWNYKETYV------------HIMHNQKEAVILYAQPSERSIMQSQSVMLDLAYGDRVWVRLFKRQRENAIYS-------NDFDTYITFSGHLIKAEDD........ 232
24 -9.280sp|Q03692|COAA1_HUMAN(removed signalp:1-18) Collagen alpha-1(X) chain OS=Homo sapiens GN=COL10A1 PE=1 SV=2  ali   10  118.TGIFTCQIPGIYYFSYHVHVKGTHVWVG------------YKNGTPVMYTYDEYTKGYLDQASGSAIIDLTENDQVWLQLPNAESNG-----------SSEYVHSSFSGFLV............. 209
25 -9.280sp|P02745|C1QA_HUMAN(removed signalp:1-22) Complement C1q subcomponent subunit A OS=Homo sapiens GN=C1QA PE=1 SV=2  ali follow..  126.SGRFVCTVPGYYYFTFQ---------LSQWEICLSIVSSSRGQVRRSLGFCDTTNKGLFQVVSGGMVLQLQQGDQVWVEKIYQGSEADSVFSGFLIFPSA......................... 223
26 -9.010sp|Q86Z23|C1QL4_HUMAN(removed signalp:1-15) Complement C1q-like protein 4 OS=Homo sapiens GN=C1QL4 PE=2 SV=1  ali follow..  13  128.SGKFTCPMPGVYFFAYHRGGDGTSMWAD-----------LMKNGQVRASAIAQDADQNYDYASNSVILHLDVGDEVFIKLHGGNTNKYSTFSGFIIYPD.......................... 223

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35