current user: public

If you have questions about the server, please let us know.

Query: gi|6319249|ref|NP_009332.1|(removed signalp:1-20) hypothetical protein; Pau8p (YAL068C) [Saccharomyces cerevisiae], from S.cerevisiae

Results of FFAS03 search in NEW_HUMAN_DOMAINS
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# Score Template Links and tools%idFirst TTTLAQSDERVNLVELGVYVSDIRAHLAQYYMFQAAHPTETYPVEVAEAVFNYGDFTTMLTGIAPDQVTRMITGVPWYSSRLKPAISSALSKDGIYTIANLast
1 -7.460sp|Q9UKL3|C8AP2_HUMAN CASP8-associated protein 2 OS=Homo sapiens GN=CASP8AP2 PE=1 SV=1  ali   16  4.KIVPIIAVPSSEQEIMHMLRMIRKHVKNYMKFKAKFSLI---QFHRIIESAILSFTSLIKHLNLHKISKSVTTL---QKNLCDIIESKLKQ........ 89
2 -7.070sp|Q71F23|CENPU_HUMAN Centromere protein U OS=Homo sapiens GN=MLF1IP PE=1 SV=1  ali   11  29..........SSLRNAAYFLSNLKQLYQDYSDVQAQEPNV-------KETYDSSSLPALL--FKARTLLGAESHLRNINHQLEKLLDQ............ 97
3 -6.170tr|F5H5J5|F5H5J5_HUMAN Uncharacterized protein OS=Homo sapiens PE=4 SV=1  ali   20...LTRDVKDLFKKNYKPLLNEIKEDTNKWKNIPCSWIGRINIMKMAILIYRFNAIPIKLPMTFFTKLEKTTLKFIWNQKR................... 100
4 -5.550sp|Q8IWY9|CDAN1_HUMAN Codanin-1 OS=Homo sapiens GN=CDAN1 PE=1 SV=4  ali   17  12..........................LAKFLGFVAFLPYRGPEPPPTGELQDSIL-SQVPPVLDVRTLRRAVLTVPWLVEFLS................. 77
5 -5.350sp|Q9NX78|CN101_HUMAN UPF0679 protein C14orf101 OS=Homo sapiens GN=C14orf101 PE=1 SV=3  ali   12  36.....................DQRTNIDKFKNLLTSMPHDAIILLRGDLPGNSLRYMHYCEGLDISLVDQEMMTYEWYLPKMAK................ 103
6 -5.330sp|Q8NEF3|CC112_HUMAN Coiled-coil domain-containing protein 112 OS=Homo sapiens GN=CCDC112 PE=2 SV=2  ali   1..........EEVLDFEKFLQQTGGRQGAW----DDYDHQNFVKVRNKHKGKPTFMEEVLEHLPGKTQDEVQQHEKWY...................... 64
7 -5.210sp|Q8IYL2|TRM44_HUMAN Probable tRNA (uracil-O(2)-)-methyltransferase OS=Homo sapiens GN=METTL19 PE=2 SV=2  ali   64................EIVVQDVLNGTITFLPLEEDDEGNLNVYQIQLSHSKEEWFISVLIFCPERWHSDGIVKPTWLGEELLAKLAKWSVENKKSDFKS 154
8 -5.150sp|Q8TDM0|BCAS4_HUMAN Breast carcinoma-amplified sequence 4 OS=Homo sapiens GN=BCAS4 PE=2 SV=1  ali   28.ALFLTPEPGAEAKEVEETIEGMLLRLEEFADLIRSDTSQILEENIPVLKAKLTEMRGIYAKVD--RLEAFVKMVGHHVAFLEADVLQAERDHGAFPQA. 126
9 -4.980tr|E7ENB9|E7ENB9_HUMAN Uncharacterized protein OS=Homo sapiens PE=4 SV=1  ali   1........TDTHWTDLTHLIEKLKEQKSHSEKMIQGDKEAVLQYFKELNDTLEQKKKSFLTALCNQEYTPQIERMKEIREQQLELMALT........... 87
10 -4.950sp|Q92797|SYMPK_HUMAN Symplekin OS=Homo sapiens GN=SYMPK PE=1 SV=2  ali   11  43ASLVTQFNSGLKAEVLSFILEDVRARLDEYNAYLAAGASGSLDKYEDCLIRLLSGLQEKPDQKD-GIFTKVVLEAPLITESALEVVRKYCEDESRTYLG. 148

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 2 2 3   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Slabinski L, Jaroszewski L, Rodrigues AP, Rychlewski L, Wilson IA, Lesley SA, Godzik A. The challenge of protein structure determination--lessons from structuralgenomics. Protein Sci. 2007 Nov;16(11):2472-82.