current user: public

If you have questions about the server, please let us know.

Query: gi|33438755|ref|NP_878039.1| Putative protein of unknown function; identified by expression profiling and mass spectrometry; Yal063c-ap (YAL063C-A) [Saccharomyces cerevisiae], from S.cerevisiae

Results of FFAS03 search in SCOP207
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .
1 -6.820d4cbug_ d.109.1.1 (G:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}  ali model 3D-neighbors follow..  10  38...............FFTGDAYVILKTVQLRNGNLQYDLHYWLGNECSQDESGAAAIFTVQLDYLNGRAVQHREVQGFESSTFSGYFKSGLK.... 115
2 -5.820d1ikpa3 f.1.5.1 (A:252-394) Exotoxin A, middle domain {Pseudomonas aeruginosa [TaxId: 287]}  ali model 3D-neighbors follow..  18  41..................QRLVALYLAARLSWNQVDQV--IRNALASPGSGGDLGEAIREQPEQARLALTLSERFVRQGTGNDEAGAANADVVS.. 118
3 -5.540d1tbfa_ a.211.1.2 (A:) cGMP-specific 3`,5`-cyclic phosphodiesterase pde5a1-Ibmx {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  22  94....AALKAGKIQNKLTDLEILALLLSHDLDHPGVSNQFLINTNSELALMYNDESVLEHHHFDQCLMILQILSGLSIEEYKTTLKIIKQAILATDL 193
4 -5.530d2fh1a1 d.109.1.1 (A:412-532) Gelsolin {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  14  30...............FYGGDSYIILYNYRHGGRQGQIIYNWQGAQSTQDEVAASAILTAQLDEELGGTPVQSRVVQGKEPAHLMSLFGGKPM.... 106
5 -5.380d2czra1 c.52.4.1 (A:1-218) TBP-interacting protein {Thermococcus kodakaraensis [TaxId: 311400]}  ali model 3D-neighbors follow..  26  66......IVAIPDNGVFYIKN--SFVLTYRYLKATLADI-LVQEDVYEYLGAALVNHIKNNALAGQDYI--FWQFYKCEECGKYVDI.......... 158
6 -5.260d2ebba_ d.74.1.0 (A:) automated matches {Geobacillus kaustophilus [TaxId: 1462]}  ali model 3D-neighbors follow..  16  24...RWIVKKYRFQDYLQGIEFVRRIAAISENANHHPFISIDYKLITVKLSSWRAKGLTKLDFDLAKQYDEVYNQMK.................... 96
7 -5.250d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  7..PSRVLHIRKLPGEVTETEVIALGLPF----GKVTNILMLKGK--------NQAFLELATEEAAITMVNYYSAVTPHLRNQPIYI.......... 78
8 -5.090d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  16  17..PNKVLYLKNLSPRVTERDLVSLFIQFRMMTGRMRGQAFITFPNKEIAWQA-LHLVNGYKLYGKILVIEFGKNKKQRS................. 102
9 -4.870d3dy8a2 a.211.1.2 (A:182-505) High-affinity cGMP-specific 3`,5`-cyclic phosphodiesterase 9A, PDE9A {Human (Homo sapiens) [TaxId: 9606]}  ali model 3D-neighbors follow..  15  85....SMVWLCSLQEKFSQTDILILMTAHDLDHPGYNNTYQINARTELAVRYNDISPLENHHCAVAFQILNIFSNIPPDGFKQIRQGMITLILATDM 184
10 -4.810d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]}  ali model 3D-neighbors follow..  17  5.................DQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQE................. 66

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 8 0 4   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.