current user: public

If you have questions about the server, please let us know.

Query: gi|6319249|ref|NP_009332.1|(removed signalp:1-20) hypothetical protein; Pau8p (YAL068C) [Saccharomyces cerevisiae], from S.cerevisiae

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
# E-value Template Links and tools%idFirst TTTLAQSDERVNLVELGVYVSDIRAHLAQYYMFQAAHPTETYPVEVAEAVFNYGDFTTMLTGIAPDQVTRMITGVPWYSSRLKPAISSALSKDGIYTIANLast
1 2.000e-27UniRef50_P38155 Seripauperin-24 n=119 Tax=Opisthokonta TaxID=33154 RepID=PAU24_YEAST  ali  96  26.....QSDERVNLVELGVYVSDIRAHLAQYYSFQVAHPTETYPVEIAEAVFNYGDFTTMLTGIAPDQVTRMITGVPWYSSRLKPAISSALSKDGIYTIAN 120
2 2.000e-27UniRef50_Q07987 Seripauperin-23 n=116 Tax=Opisthokonta TaxID=33154 RepID=PAU23_YEAST  ali  88  24TTTLSPSDERVNLVELGVYVSDIRAHLAEYYMFQAAHPTETYPVEIAEAVFNYGDFTTMLTGIPADQVTRVITGVPWYSTRLRPAISSALSKDGIYTAV. 122
3 5.000e-27UniRef50_A0A0L8RKD0 Uncharacterized protein n=2 Tax=Saccharomycetaceae TaxID=4893 RepID=A0A0L8RKD0_SACEU  ali  89  24TTTLAPSDERVNLVELGVYVSDIRAHMAQYYAFQAAHPTDTYPIEVAEAVFNYGDFTTMLTGISPDQVTRMITGVPWYSTRLRPAISSALSSDGIYTA.. 121
4 2.000e-25UniRef50_G2WHF7 K7_Dan4ap n=1 Tax=Saccharomyces cerevisiae (strain Kyokai no. 7 / NBRC 101557) TaxID=721032 RepID=G2WHF7_YEASK  ali  78  24.TTLSPYDERVNLIELAVYVSDIRAHIYQYYSFQNQHKTETYPSEIAAAVFDYGDFTTRLTGISGDEVTRMITGVPWYSTRLKPAISSALSKDGIYTA.. 120
5 7.000e-23UniRef50_G8JN06 Uncharacterized protein n=1 Tax=Eremothecium cymbalariae (strain CBS 270.75 / DBVPG 7215 / KCTC 17166 / NRRL Y-17582) TaxID=931890 Re  ali  29  16STATADDLTPEDIAKIKVFLSDVKANFSEYMNLYTSIPDNFIPVWRAMQTYTDESYTSLFTSLKMDQVNSALTAVPWYSSRLAPALVSIGGGGDA..... 114
6 2.000e-22UniRef50_A0A1E3P6T3 Uncharacterized protein (Fragment) n=1 Tax=Wickerhamomyces anomalus NRRL Y-366-8 TaxID=683960 RepID=A0A1E3P6T3_WICAO  ali  26  1.ATLATAIDQDEVAAVTALYGDINGHLSDYLNYIQQGPDGLLNLYQEAQTYTDDSYTTLLSTVDFNAVEGFVTGLPWYSSRLAGAFASATGEGAATTSSA 102
7 2.000e-21UniRef50_E7NJ15 Tir3p n=1 Tax=Saccharomyces cerevisiae (strain FostersO) TaxID=764101 RepID=E7NJ15_YEASO  ali  28  17TQLVSAEVGQYEIVEFDAILADVKANLEQYMSLAMNNPDGVLDVYQHMTTATDDSYTSYFTEMDFAQITTAMVQVPWYSSRLEPEIIAALQSAGISVTS. 120
8 4.000e-21UniRef50_G0VFL3 Uncharacterized protein n=2 Tax=Saccharomycetaceae TaxID=4893 RepID=G0VFL3_NAUCC  ali  59  21.TTLSPSDEQVNLIELSVYVKDIRANMNDYLSMAKANPNQAYPAIIATAVMKGDDFTTMLTGISGDEVTMMLTGVPWYSSRLVPAVEAALSAQGIVT... 117
9 5.000e-21UniRef50_A0A061B4T8 CYFA0S16e00562g1_1 n=1 Tax=Cyberlindnera fabianii TaxID=36022 RepID=A0A061B4T8_CYBFA  ali  24  75.ASIVAAESASGNAALSAIIGDINANLNDYLSNGNAPPAELLSLFQQVQTYTDDSYSTLLSKVDMGDVSSYITGLPWYSTRLSAEIASAVAAVSGADSSS 176
10 1.000e-20UniRef50_P47178 Cell wall protein DAN1 n=18 Tax=Saccharomyces TaxID=4930 RepID=DAN1_YEAST  ali  70  23TTTLSPYDERVNLIELAVYVSDIGAHLSEYYAFQALHKTETYPPEIAKAVFAGGDFTTMLTGISGDEVTRMITGVPWYSTRLMGAISEALANEGIATAV. 121
11 1.000e-20UniRef50_Q6FKZ0 Uncharacterized protein n=2 Tax=Candida glabrata TaxID=5478 RepID=Q6FKZ0_CANGA  ali  35  12AATLVNAQNAVEVAEIQVLVNDINSNLAQYLSLETNIPDNLLSLYRNVATYTDDSFSTLLSGVNFDEITSTIVGLPWYSSRLLPALE............. 104
12 3.000e-20UniRef50_J8Q6A3 Dan1p n=1 Tax=Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644) TaxID=1160507 RepID=J8Q6A3_SACAR  ali  73  23TTTLAQSDERVNLIELAVYVSDIGANLAQYYSFQALHKTETYPAEIAKAVFAGGDFTTMLTGISGDEVTRMVTGVPWYSTRIKAAISEALANEGIATVVS 122
13 3.000e-20UniRef50_G0W555 Uncharacterized protein n=1 Tax=Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) TaxID=1  ali  51  22.TTLTPDDETVNMIELAIYVNDIHGHMADYLSMQGANPDMPYPSEIMKAVMPNNKFTTLFSTIPPAEITSMITGVPWYSERLQPAISKSLEARGIVT... 124
14 3.000e-20UniRef50_G0VB07 Uncharacterized protein n=1 Tax=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) TaxID=1064592 RepID=G  ali  58  22.TTLSPSDETVNLIELAVYVNDIKANLNDYFAMAAAHPEQAYPDIIASAVFGDADFTTMLTGIEPAEVTSMLTGVAWYSSRIAPAIEASLSARGIVTAVA 120
15 4.000e-20UniRef50_A0A1E3P569 Uncharacterized protein n=1 Tax=Wickerhamomyces anomalus NRRL Y-366-8 TaxID=683960 RepID=A0A1E3P569_WICAO  ali  21  9..SVIAAALANNVDVATVLMNDVQNNMDEYIGLVGPIPPELIDYYAKVATYTDDSYTSILTDFPVDKIKPLVTQLPWYSSRLESKLEVAYTQEH...... 103
16 5.000e-20UniRef50_G0W5A0 Uncharacterized protein n=6 Tax=Saccharomycetaceae TaxID=4893 RepID=G0W5A0_NAUDC  ali  28  36.......QTETQVAELNLLLNDVGSNLNDYMTLATTMPAGVLDIGMALASATDKSYTTLYSEVDFAGVESMITKLPWYSSRLEGPLNSILGKDAATTSS. 136
17 6.000e-20UniRef50_G0W408 Uncharacterized protein n=1 Tax=Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) TaxID=1  ali  32  14.ATYASAQTPTEITELNVLLNDVGSHLEDYMNLAQNMPAGMLDVGMALASATDDSYTTLYSEVDFAGVQSMITELPWYSSRLRPALESALDTISDTASAT 121
18 7.000e-20UniRef50_A0A061B6D1 CYFA0S11e02828g1_1 n=1 Tax=Cyberlindnera fabianii TaxID=36022 RepID=A0A061B6D1_CYBFA  ali  30  13.ALFTNAQSASESAELTAIVNDINNNLQDYLGQVQAPPAELLSLYQQVQTYTDDSYTSLYSEVNMGDVSSYITGLPWYSSRLQPAIESA........... 103
19 9.000e-20UniRef50_A0A1X7R2V3 Similar to Saccharomyces cerevisiae YER011W TIR1 Cell wall mannoprotein of the Srp1p/Tip1p family of serine-alanine-rich proteins  ali  31  22...........QIAELNVIIADVKDNMADYTSLATSGPTGIMPLAMAVQTATDDSYTTLYSNVDFDAVATFLTKLPWYSSRLEAAIESATAAVGGDE... 114
20 2.000e-19UniRef50_I2H6J7 Uncharacterized protein n=1 Tax=Tetrapisispora blattae (strain ATCC 34711 / CBS 6284 / DSM 70876 / NBRC 10599 / NRRL Y-10934 / UCD 77  ali  37  22.......DREAAMVSLKVYMDDIGSHMKEYLSMQKANPDQSIPPYAAKMTAKDDSYTTFFSNIDDSYIQYMVTGVPWYSSRLEPAIVSALASAGLKDSHA 119
21 3.000e-19UniRef50_I2GUW0 Uncharacterized protein n=1 Tax=Tetrapisispora blattae (strain ATCC 34711 / CBS 6284 / DSM 70876 / NBRC 10599 / NRRL Y-10934 / UCD 77  ali  34  15AIANADGDREAAMISMQVYMNDIGSHMKEYLSMEKANPEQSIPPYAAKMTAKGDSYTSFFSDIPDSYIHYMITGVPWYSTRLAPAISSALASAGIKASSS 119
22 4.000e-19UniRef50_G0W5F5 Uncharacterized protein n=1 Tax=Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) TaxID=1  ali  52  21TQTLAADDETVNMIELAVYVNDIHSNMAAYLSMQMANPEMAYPAVIESATDPDNKFTTLLTGIDPEEITSMITGVPWYSSRLAPAISASLAARDIV.... 123
23 4.000e-19UniRef50_G8JU02 Uncharacterized protein n=1 Tax=Eremothecium cymbalariae (strain CBS 270.75 / DBVPG 7215 / KCTC 17166 / NRRL Y-17582) TaxID=931890 Re  ali  29  21......DLEPAQVSSIDVVVQDIKSHLTEYVSYAGSNPEDVISVYTQVATYTDGSYTSLFSNLNFQEINSAITGLPWYSSRLAPAFASLSPAAAT..... 114
24 8.000e-19UniRef50_Q6FSJ1 Uncharacterized protein n=1 Tax=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) TaxID=284593 RepID=Q  ali  50  23TTTLAPTDFRVNMIELQAYLADIKGHMMQYLSFQGANPNQPYPSQMLGAVMFGN--TGPLSEIAPETITMMITGVPWYSERLVGAIAARLADAGIVTA.. 118
25 9.000e-19UniRef50_J7R698 Uncharacterized protein n=1 Tax=Kazachstania naganishii (strain ATCC MYA-139 / BCRC 22969 / CBS 8797 / CCRC 22969 / KCTC 17520 / NBRC  ali  47  25ATTLPANAEEVKEVELGVYVNDITKNLMEYYAFRAEHPEQAYPGIIETAVFEDSEWINQLTTIDYNEVQSMFTGVPWYSDRLAPALSSSLKALNIATTVA 130
26 1.000e-18UniRef50_W6MGG6 Uncharacterized protein n=1 Tax=Kuraishia capsulata CBS 1993 TaxID=1382522 RepID=W6MGG6_9ASCO  ali  19  14TNRAAAAVDSSEVAFVTVFYNDLKGNLNEYLSYIQAHTENLLSLYAQVQTYTDDSYTTVIDDNIYKEISTFATALPWYSTRLVSEYEDAVG......... 108
27 1.000e-18UniRef50_A0A1E3QKS0 Uncharacterized protein n=1 Tax=Babjeviella inositovora NRRL Y-12698 TaxID=984486 RepID=A0A1E3QKS0_9ASCO  ali  33  21.......DETPNVCYITALVNDIKANLNEYLPFAASIPTGLLNLALAAQTYTDDSYTTLLTGFPYASVENIVTGLPFYSSRLSAEVNSAQSNCPGAAGGS 114
28 2.000e-18UniRef50_Q6FX54 Uncharacterized protein n=3 Tax=Candida glabrata TaxID=5478 RepID=Q6FX54_CANGA  ali  52  22TTTLAPTDFRVNMIELQAYLADIKGHMMQYLSFQGAHPDQPYPSQMIGAVMFGN--TSPLSEIAPETITMMITGVPWYSERLIGAIASRLADEGIATA.. 117
29 3.000e-18UniRef50_A0A109UZ27 HDR017Cp n=1 Tax=Eremothecium sinecaudum TaxID=45286 RepID=A0A109UZ27_9SACH  ali  30  25..............EIAIVLKDILDHRSDYLRFQLEHPDGLLPVYEAYKTRTDDSYTTLFSNINVDQFHALVTALPWYSERIVPAFATIVEAGGATEA.. 113
30 5.000e-18UniRef50_G8BXU2 Uncharacterized protein n=3 Tax=Tetrapisispora phaffii (strain ATCC 24235 / CBS 4417 / NBRC 1672 / NRRL Y-8282 / UCD 70-5) TaxID=1071  ali  27  23........TEQQIQEMEILLTDVGANLNDYVGLQMDIPDALFDIYGEMLTATDDSYTTLLAQLDMSQISTMMTALPWYSSRLLPLVST............ 104
31 7.000e-18UniRef50_J7SAM1 Uncharacterized protein n=1 Tax=Kazachstania naganishii (strain ATCC MYA-139 / BCRC 22969 / CBS 8797 / CCRC 22969 / KCTC 17520 / NBRC  ali  48  20ATTVAADSQVVKMVELGVYVMDIANNLPQYYSFQGANPGEKYPPVIETAVIDQSQWITLLSDIDEADVQRMLTGVPWYSSRIAPALSASLEAQGIVIAA. 125
32 8.000e-18UniRef50_K0KAQ0 Cell wall protein n=1 Tax=Wickerhamomyces ciferrii (strain F-60-10 / ATCC 14091 / CBS 111 / JCM 3599 / NBRC 0793 / NRRL Y-1031) TaxID  ali  23  13...ITSALAVNNVEYATILLNDVQNNMNDYGYLFKALPTELFNYYKEIITYTDDSFTSVLTDFPVNKVQSVVTEFPWYSSRLESRLKAAITHDSDLTTS. 112
33 8.000e-18UniRef50_P40552 Cell wall protein TIR3 n=18 Tax=Saccharomycetaceae TaxID=4893 RepID=TIR3_YEAST  ali  28  17TQLVSAEVGQYEIVEFDAILADVKANLEQYMSLAMNNPDGVLDVYQHMTTATDDSYTSYFTEMDFAQITTAMVQVPWYSSRLEPEIIAALQSAGISITS. 120
34 1.000e-17UniRef50_I2H9X7 Uncharacterized protein n=2 Tax=Tetrapisispora blattae (strain ATCC 34711 / CBS 6284 / DSM 70876 / NBRC 10599 / NRRL Y-10934 / UCD 77  ali  36  20.......DREAAMISMEVYMNDIGSHMKDYLSMEKAHPEQSIPPYAAKLTDKTDSYTSFFADIGDEQIHYMITGVPWYSTRLAPAISQALEAAGLGEAA. 116
35 1.000e-17UniRef50_H0GX81 Dan4p n=1 Tax=Saccharomyces cerevisiae x Saccharomyces kudriavzevii (strain VIN7) TaxID=1095631 RepID=H0GX81_SACCK  ali  82  26...LSPYDERVNLIELAVYVSDIRAHLWQYYSFQNKHKTETYPPEIAQAVFNYGDFTTMLTGIAPDQVTRMITGVPWYSTRLKPAISSALTKDGIHTT.. 120
36 1.000e-17UniRef50_E7QKK5 Tir4p n=1 Tax=Saccharomyces cerevisiae (strain Zymaflore VL3) TaxID=764100 RepID=E7QKK5_YEASZ  ali  27  19.......QTQAQINELNVVLDDVKTNIADYITLSXTMPAGIMDIAAQVANPSDDSYTTLYSEVDFSAVEHMLTMVPWYSSRLLPELEA............ 109
37 1.000e-17UniRef50_P10863 Cold shock-induced protein TIR1 n=39 Tax=Saccharomycetaceae TaxID=4893 RepID=TIR1_YEAST  ali  32  19.......QTQDQINELNVILNDVKSHLQEYISLASDMPAGVLDIGMALASATDDSYTTLYSEVDFAGVSKMLTMVPWYSSRLEPALKS............ 108
38 2.000e-17UniRef50_P47179 Cell wall protein DAN4 n=4 Tax=Saccharomyces TaxID=4930 RepID=DAN4_YEAST  ali  77  24.TTLSPYDERVNLIELAVYVSDIRAHIFQYYSFRNHHKTETYPSEIAAAVFDYGDFTTRLTGISGDEVTRMITGVPWYSTRLKPAISSALSKDGIYTA.. 120
39 4.000e-17UniRef50_Q6FWQ0 Uncharacterized protein n=3 Tax=Saccharomycetaceae TaxID=4893 RepID=Q6FWQ0_CANGA  ali  30  23........SNNEISEFNVILSDVMGHLTDYISYAETLPDHVLDLYMAMTTATDDSYTTMYDQINFSQVTDAMTRLPWYSSRILPNVSPFLED........ 111
40 6.000e-17UniRef50_G8BXU0 Uncharacterized protein n=1 Tax=Tetrapisispora phaffii (strain ATCC 24235 / CBS 4417 / NBRC 1672 / NRRL Y-8282 / UCD 70-5) TaxID=1071  ali  26  14.SLVAADTNSAQLAEIQLLVNDITSNQQEYLSLIANGPADLLALYGVYATATDSAYTTLFTQINPTEVQSLVTQLPWYSSRLESGFESIQAAASGAV... 113
41 7.000e-17UniRef50_A5DA07 Uncharacterized protein n=2 Tax=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324  ali  30  8.TIFATSVMADDL--LSKLVSDVKANPQEYLSYIQTIPEDLTPLALQVRTYTDDSFTTLLDSSQKSEISAFATGLPWYSSRLLDDSNSAGSTE....... 101
42 8.000e-17UniRef50_Q8TGE1 Cell wall protein AWA1 n=2 Tax=Saccharomyces TaxID=4930 RepID=AWA1_YEASK  ali  71  157...LSPYDERVNLIELGVYVSDMRAHLVEYLLFQAAHSTEPHPTEIAAAFLDHGDFTTRLTGISGDEVTRMITGVPWYSTRLKPAISEALAKDGIYTA.. 251
43 3.000e-16UniRef50_K0KMN8 Transcription elongation factor n=3 Tax=Wickerhamomyces TaxID=599737 RepID=K0KMN8_WICCF  ali  26  18.........QQNTELVQGVFSDVQAHSAEYLSYIGGVPLGLLSLYREAQTYTDQGYTSLFTEVDVNEVSSFATGLPWYSSRLQSVFQAA........... 103
44 5.000e-16UniRef50_A0A1X7RBB2 Similar to Saccharomyces cerevisiae YOR009W TIR4 Cell wall mannoprotein of the Srp1p/Tip1p family of serine-alanine-rich proteins  ali  29  26.........PYELAEIEGIMEDAKAHLFSYMLLVSSGPAGVVDVAMAVIN-GDEGYTSLFTEVDFAGVSSMVTELPWYSTRLLPEINSIYSKELASST.. 120
45 5.000e-16UniRef50_C5DQ49 ZYRO0A08624p n=2 Tax=Zygosaccharomyces rouxii TaxID=4956 RepID=C5DQ49_ZYGRC  ali  21  39SASLRLDAAEADMRFFSVFLSDFRVNMDSYTSYLGAHPQKVADYYHHVAELPQDLEKDIAASFPFSQFRTFIADFPWYSTLLSSANESTM.......... 134
46 9.000e-16UniRef50_J7S467 Uncharacterized protein n=2 Tax=Kazachstania naganishii (strain ATCC MYA-139 / BCRC 22969 / CBS 8797 / CCRC 22969 / KCTC 17520 / NBRC  ali  28  19....ADQLTPEQNAVLIVLFKDVFKNFPKYGSWFMSVPNNIIEVYEAAHTYTDDSFSTMLTSLEMSQIMPMVTAVPWYSSYLSAEVAAALAP........ 110
47 1.000e-15UniRef50_A0A1E3QTD7 Uncharacterized protein n=1 Tax=Babjeviella inositovora NRRL Y-12698 TaxID=984486 RepID=A0A1E3QTD7_9ASCO  ali  21  14.ALLNVAQAADNVCYITALISDVKNNLDQYLPYAGEIPPDLLSLALAAQTYTDDSYTTLITSFPYAAIESIVTGLPFYSSRLSAELAAGDAAC....... 106
48 1.000e-15UniRef50_P27654 Temperature shock-inducible protein 1 n=21 Tax=Saccharomycetaceae TaxID=4893 RepID=TIP1_YEAST  ali  23  14ASLAVADTSAAETAELQAIIGDINSHLSDYLGLETGNPSDVLSVYQQVMTYTDDAYTTLFSELDFDAITKTIVKLPWYTTRLSSEIAAALAS........ 110
49 1.000e-15UniRef50_A0A1Q3A8C6 Uncharacterized protein n=1 Tax=Zygosaccharomyces rouxii TaxID=4956 RepID=A0A1Q3A8C6_ZYGRO  ali  18  39SAFLKSEAAEVDMRFFSVFLLDFRDNEDSYTSYHKTMPQKVADYYNHVAQLPADLERDIAASFPFSQFQTFIAEFPWYSTLLSKAHASTM.......... 134
50 2.000e-15UniRef50_K0KQE8 Zonadhesin n=1 Tax=Wickerhamomyces ciferrii (strain F-60-10 / ATCC 14091 / CBS 111 / JCM 3599 / NBRC 0793 / NRRL Y-1031) TaxID=120646  ali  21  8ALSLASIALADKTEIINGVYNDINSHLEEYLKIIDQVPSDLLQLFKQAQTYTDDSYTTLYDNVDLNEVSTFATGLDWYDQRLKSASPSTEAPEVSTTSDA 112
51 2.000e-15UniRef50_C4YBJ0 Uncharacterized protein n=3 Tax=Saccharomycetales TaxID=4892 RepID=C4YBJ0_CLAL4  ali  23  24...........EVQFLTAFVGDFQSNKKDYLGFIKTVPPQLTSLAIKVATYKDDSYTTLLDNVNVPQLMSFATELPWYS-RIEAE--AGISAKGSST... 111
52 2.000e-15UniRef50_G8BZV9 Uncharacterized protein n=1 Tax=Tetrapisispora phaffii (strain ATCC 24235 / CBS 4417 / NBRC 1672 / NRRL Y-8282 / UCD 70-5) TaxID=1071  ali  27  14AAYARALTSEEQVQEMEILLSDVNANLAQYAGLQVAIPDELFDIYFVMATATDDSYTTLLAQLDMNEISSMMTALPWYSSRLQPLLTAFDAVVTTP.... 111
53 3.000e-15UniRef50_I2JYW4 Tir3p n=1 Tax=Brettanomyces bruxellensis AWRI1499 TaxID=1124627 RepID=I2JYW4_DEKBR  ali  24  13ATMAAADLTPKQVADISVLFEDIDSNTMQYISYLLTHPSNLINLYTKMMTYTDDSFTTLFKTLEYSQISSLETALPWYSTRLYSEIKSAEAAA....... 113
54 3.000e-15UniRef50_G8ZXT1 Uncharacterized protein n=1 Tax=Torulaspora delbrueckii (strain ATCC 10662 / CBS 1146 / NBRC 0425 / NCYC 2629 / NRRL Y-866) TaxID=107  ali  24  29...ARKSAAGANLPFFTVFVSDINTNLAAYNSFMESNPQAVADYYFHVIRLTADLEKDVASSFPFTQFKTFITKFPWYDSLLQRASVSTLYVPQDFVSSA 131
55 4.000e-15UniRef50_G0WGV1 Uncharacterized protein n=4 Tax=Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) TaxID=1  ali  25  25........TTTEIAELKVLLDDVKSNLNDYVALAFTPPAGVLDVGKALFTASDDSYTTLYANVDFDGVSSLMTKLPWYQSRLEAPLQSIANS........ 117
56 5.000e-15UniRef50_A0A1E3NFZ4 Uncharacterized protein n=1 Tax=Pichia membranifaciens NRRL Y-2026 TaxID=763406 RepID=A0A1E3NFZ4_9ASCO  ali  21  10.SVAALVASTQAEDLLVALNSDIQSNPNQYLSFVQEHTTALLSLYQQAQTYTDDSYTTLVDSSELASISSFATELPWYSSRIAPELGADATTTD...... 106
57 5.000e-15UniRef50_A0A061AV36 CYFA0S07e02168g1_1 n=1 Tax=Cyberlindnera fabianii TaxID=36022 RepID=A0A061AV36_CYBFA  ali  24  8.ALAASFVAADKNSELEGLLADLKANLNDYLSQVSTPPPQLLSLAQEARTYTDNSYTTLFDQVDINEVKSYVTGLPWYSSRLAS................ 93
58 6.000e-15UniRef50_J7SAH1 Uncharacterized protein n=1 Tax=Kazachstania naganishii (strain ATCC MYA-139 / BCRC 22969 / CBS 8797 / CCRC 22969 / KCTC 17520 / NBRC  ali  27  20.......LTDEQSAEIYAIVQDINSNQAQYIGLEMNIPPQLLSMYQQVLTYKDDSYTSLFTALDYNMITSTITGLSWYNERLAPALSSVRAK........ 109
59 6.000e-15UniRef50_H2B044 Uncharacterized protein n=1 Tax=Kazachstania africana (strain ATCC 22294 / BCRC 22015 / CBS 2517 / CECT 1963 / NBRC 1671 / NRRL Y-827  ali  23  14AISVASATTLYEVAEVEGLLEDVSNNLSDYVSLITSGKLSFTDLEIALAYMEGENWSTYLTDVDWSAVNSMLTELSWYSTRLEPEIASIYSEELATATST 118
60 7.000e-15UniRef50_A0A1E4RJM8 Uncharacterized protein n=1 Tax=Hyphopichia burtonii NRRL Y-1933 TaxID=984485 RepID=A0A1E4RJM8_9ASCO  ali  19  13.AQIVQAADSSDVAFFTRLVNDAQHHQQDYVKYMKTVPSDFTSIAKEIQTYRDDSYTTLIDAINMNQLESFASQLPWYSKRLA................. 100
61 7.000e-15UniRef50_I2H9X1 Uncharacterized protein n=1 Tax=Tetrapisispora blattae (strain ATCC 34711 / CBS 6284 / DSM 70876 / NBRC 10599 / NRRL Y-10934 / UCD 77  ali  23  14.ASYVAAQDKAEVIEFNAILTDVVNNLNDYMSIAENQPDGVLDVYTQMTTYTDDSYTTLFSILDFSEIDSVMAGLPWYSTRLAPAIASAYSSAGITNS.. 115
62 1.000e-14UniRef50_G0WB73 Uncharacterized protein n=1 Tax=Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) TaxID=1  ali  21  56.VSARSEAANVDMPFFMAFLDDFGSQLPQYTSYMAQNPQAIADYYYHIAFLPDDLQADIANTFPFNQFQTFITAFPWYSSLLSHASVSTI.......... 150
63 2.000e-14UniRef50_H2AY55 Uncharacterized protein n=2 Tax=Kazachstania africana (strain ATCC 22294 / BCRC 22015 / CBS 2517 / CECT 1963 / NBRC 1671 / NRRL Y-827  ali  26  13.TSVAYAQTAYQAAEAEALINDLGSNVSEYMALISSGPSGVLNLAMAIMSATDSSYTTLLADVDYAGVDSMITKLSWYSSRLLPEIESIYSAEG...... 112
64 2.000e-14UniRef50_I2JX76 Uncharacterized protein n=1 Tax=Brettanomyces bruxellensis AWRI1499 TaxID=1124627 RepID=I2JX76_DEKBR  ali  25  48ASVAMAELDAEXVESLTVLFSDIEDNINQYLXYLSSNPTNLIGIFKSIATYTDDSYTTILAALPYEQIQSLETALPWYXSRIEPKI.............. 141
65 3.000e-14UniRef50_A0A1X7R6M2 Similar to Saccharomyces cerevisiae YBR067C TIP1 Major cell wall mannoprotein with possible lipase activity n=1 Tax=Kazachstania  ali  23  17SAVNAADVTAEQTADLLVIINDIESHVSDYLSLETSGPPEVLSLYAQINTYTDESYTSLFTELDVAALTATITNLPWYSTRLLPALQRANAGASSNET.. 120
66 4.000e-14UniRef50_A7TL90 Uncharacterized protein n=1 Tax=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) TaxID=436907 RepID=A7TL90_VANPO  ali  13  39..SIRSQAAAEDVGFVYAFINDFNTRMADYTSYMQDNPQGLANYYYHLATEPEDLQSDIAATFPFTEFNTFITKFPWYSTLLSEGSVTTF.......... 132
67 4.000e-14UniRef50_G0WEU2 Uncharacterized protein n=3 Tax=Saccharomycetaceae TaxID=4893 RepID=G0WEU2_NAUDC  ali  26  20.......QTGYEVAEFNAILVDVQAHLQEYMSLAMNNPDGVLEVYEQLTTYTDETYTTLFSAINFAQVTTIMEQLPWYTTRLEPIISSYMEAHSITET.. 115
68 5.000e-14UniRef50_A0A1X7R982 Uncharacterized protein n=1 Tax=Kazachstania saulgeensis TaxID=1789683 RepID=A0A1X7R982_9SACH  ali  23  18...ATSDPTPEQTAELVVLLEDVSNNFSKYVSWFQSIPTGIVDVYMVVRTATDLSYTTMFTELDVTALEAMATAVPWYTSYLSSEIAAAIASVDAT.... 114
69 6.000e-14UniRef50_A0A1X7R3I9 Similar to Saccharomyces cerevisiae YER011W TIR1 Cell wall mannoprotein of the Srp1p/Tip1p family of serine-alanine-rich proteins  ali  27  21..........SQLAELNVILDDVKNNLSDYMGLVTAGPAGVLDIGMALASATDDSYTTLYSEVDFDAIAPFLTALPWYSSRLEAELATITG......... 108
70 7.000e-14UniRef50_J7RS41 Uncharacterized protein n=1 Tax=Kazachstania naganishii (strain ATCC MYA-139 / BCRC 22969 / CBS 8797 / CCRC 22969 / KCTC 17520 / NBRC  ali  24  13.AAVASAQTQEEITQLNVILNDVRDNLSEYMALVASMPQGVLQIGGALATATNSAFTSMYSDVDFAGLSSFLPRLPRYSSRLEPALRAADAPLGGSASNS 120
71 9.000e-14UniRef50_I2H7J0 Uncharacterized protein n=1 Tax=Tetrapisispora blattae (strain ATCC 34711 / CBS 6284 / DSM 70876 / NBRC 10599 / NRRL Y-10934 / UCD 77  ali  31  17ANAVSVDPTKAAMLAMEVYMTDIVHNMQEYLSIHKASPDESVPPVVTSAMMTMAEFTTFFSDIPLSEIEYMITGVPWFSSRLEGPILSIWSANGVT.... 117
72 9.000e-14UniRef50_W6MPQ6 Uncharacterized protein n=1 Tax=Kuraishia capsulata CBS 1993 TaxID=1382522 RepID=W6MPQ6_9ASCO  ali  17  21TEEAKTLAAEYDFDFLVAFLNDFSSNIARYTSYMVDNPRQLVQFYNDVYTYTDYGFTTLVDQFPFSEFQTFISEFPWYTTLLKEGDITAFAVPADYLTT. 124
73 1.000e-13UniRef50_G8YJT9 Piso0_002910 protein n=1 Tax=Pichia sorbitophila (strain ATCC MYA-4447 / BCRC 22081 / CBS 7064 / NBRC 10061 / NRRL Y-12695) TaxID=559  ali  20  19.....QSLDSSQMDFLTKLVDDVRGNQNQYMKYIKTGPKDFTSLAMQVRTYKDDSYTTLLESINMGELSSFVGKLPW....................... 95
74 1.000e-13UniRef50_A0A1E4RRQ7 Uncharacterized protein n=1 Tax=Hyphopichia burtonii NRRL Y-1933 TaxID=984485 RepID=A0A1E4RRQ7_9ASCO  ali  24  15AFTKASDVNSYDIAFVTALVSDYKGHAKDYINFIQTVPEEVTHLAIQAATYTNDAYTTLLNDLDVTSLENYATNLPWYS-RISSDVSEA........... 105
75 1.000e-13UniRef50_A0A1E3QRJ6 Uncharacterized protein n=1 Tax=Babjeviella inositovora NRRL Y-12698 TaxID=984486 RepID=A0A1E3QRJ6_9ASCO  ali  17  11.ATASLAENINTNGYVTALISDVESHQQEYMSYIQNNPQTILELFLVAQTATDDSYTSLVSDFPLSMVSSMVANLPWYSTRLAEDLSKGLAAIPTPSST. 113
76 1.000e-13UniRef50_E7KHT3 Tir4p n=3 Tax=Saccharomyces TaxID=4930 RepID=E7KHT3_YEASA  ali  27  19.......QTQAQINELNVVLDDVKTNIADYITLSETMPAGIMDIAAQVANPSDDSYTTLYSEVDFSAVEHMLTMVPWYSSRLLPELEA............ 109
77 1.000e-13UniRef50_I2GUV9 Uncharacterized protein n=3 Tax=Tetrapisispora blattae (strain ATCC 34711 / CBS 6284 / DSM 70876 / NBRC 10599 / NRRL Y-10934 / UCD 77  ali  21  13AASAYALSAEDQVSEMQIIMADVNANLADYVGLVMDIPDALFNLYTEMATATDDSYTKDMAALDMNQISAMLTVLPWYSSRLEGKVA............. 101
78 1.000e-13UniRef50_I2JRA6 Tir1p n=1 Tax=Brettanomyces bruxellensis AWRI1499 TaxID=1124627 RepID=I2JRA6_DEKBR  ali  18  9.SVAAIVASANAENLIVAMFNDIHSNLDQYASLASTQSSQFIPLYAEAQTYTDDSYTTLVNSALYESISEFVTALPWYSSRIEPELAESGASQ....... 103
79 1.000e-13UniRef50_A3M064 Uncharacterized protein n=2 Tax=Debaryomycetaceae TaxID=766764 RepID=A3M064_PICST  ali  22  28............VSFLTAFVGDFKAHPKDYLNFLQTFPPEVTSLAAQVGTYTDQSYTTLLDDVNVSELKDFATELPWY-TRIEAEVGTAAKTSAAETS.. 116
80 2.000e-13UniRef50_J7RFC4 Uncharacterized protein n=1 Tax=Kazachstania naganishii (strain ATCC MYA-139 / BCRC 22969 / CBS 8797 / CCRC 22969 / KCTC 17520 / NBRC  ali  12  27ALSARSMAADVDMPFFTAFLNDFGSNFQVYTSYMVQNPQAVVNYYYHLAPMTIDLKSDIISQFPFTEFQVFITKFPWY...................... 110
81 2.000e-13UniRef50_A0A0H5C210 TIP1 protein n=4 Tax=Cyberlindnera jadinii TaxID=4903 RepID=A0A0H5C210_CYBJA  ali  23  8.SLLPIALAADRDAELNALVADLAGHSSEYLQQVASGPADLLALAQQVKTFTDDSYTTLYPEVDMGEVSAYVTGLPWYSSRLASIFGADAAPATSTEEA. 108
82 2.000e-13UniRef50_H2AWW3 Uncharacterized protein n=1 Tax=Kazachstania africana (strain ATCC 22294 / BCRC 22015 / CBS 2517 / CECT 1963 / NBRC 1671 / NRRL Y-827  ali  17  42...ARQEAAKADMAFFMVFLEDFQINYDSYTSYMIDNPQAVANYYFRLSTVEANLLSDIAYTFPFTQFQSFITRFPWYSSLLADAGATTM.......... 135
83 2.000e-13UniRef50_A0A1E4T2U3 Uncharacterized protein n=1 Tax=[Candida] arabinofermentans NRRL YB-2248 TaxID=983967 RepID=A0A1E4T2U3_9ASCO  ali  25  21.....AELSGEELVAVEALFQDIGENQSEYYSYIVENPTDLIAIYTQITTYTDDSYTSLFDDIKPTEIESLMTELPWYSTRLGPAI.............. 110
84 2.000e-13UniRef50_A0A1E3P6H5 Uncharacterized protein n=1 Tax=Wickerhamomyces anomalus NRRL Y-366-8 TaxID=683960 RepID=A0A1E3P6H5_WICAO  ali  19  12.ATLATAIDQEEVAAVTALYGDINGHLSDYLNYIQQGPDGLLNLYQEAQTYKDDSYTTLLSTVDFNAVEGFVTDLSW....................... 91
85 3.000e-13UniRef50_G0VAZ6 Uncharacterized protein n=1 Tax=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) TaxID=1064592 RepID=G  ali  42  1............MIELMVYVKDIVAYRDDYLSMQKANPAMPYPAEMAAIMGDKSKFTTLFSTIPATEVDFMVTGVPWYSTRLSSLIAAALSSEGVV.... 89
86 3.000e-13UniRef50_A0A1E4T6G6 Uncharacterized protein n=1 Tax=[Candida] arabinofermentans NRRL YB-2248 TaxID=983967 RepID=A0A1E4T6G6_9ASCO  ali  23  10.SILATLGAANNDDLLTAIKGDIDGNLVQYVSYISAHPGALLALYEAAVTYTDTSYTTLVNDDELNAISSFATALPWY-TRIEAEV.............. 97
87 3.000e-13UniRef50_A0A1E3QLA0 Uncharacterized protein n=1 Tax=Babjeviella inositovora NRRL Y-12698 TaxID=984486 RepID=A0A1E3QLA0_9ASCO  ali  22  16.ATLTQGLARSDLIYVSAVFKDLRANVEQYAEHHRDYPEALMVPEIDAQYHTDDSFTSLIPRFPIADLKNMVVNLPWYKERLMGSLVKAMEDMN...... 114
88 3.000e-13UniRef50_A0A1Z8JMN7 Uncharacterized protein n=1 Tax=Pichia kudriavzevii TaxID=4909 RepID=A0A1Z8JMN7_PICKU  ali  28  58................KVLEHDLKHHKSEYVSYVEAH-TELESAFSRIDTYTDDSFTTILD------LSSFVVNLPWYSSRLESKLEKS........... 123
89 4.000e-13UniRef50_H2AY64 Uncharacterized protein n=1 Tax=Kazachstania africana (strain ATCC 22294 / BCRC 22015 / CBS 2517 / CECT 1963 / NBRC 1671 / NRRL Y-827  ali  29  15.TSIASAATLYQIAEIDALLEDVESNLSSYTGLVISHPDGVLSYAMAAMEATDSSYTTLIDDIDFSGVDRLITSVSWYSSRLLPLIESIYSEE....... 112
90 4.000e-13UniRef50_A0A1X7QZP2 Uncharacterized protein n=1 Tax=Kazachstania saulgeensis TaxID=1789683 RepID=A0A1X7QZP2_9SACH  ali  15  30....RSMAEEKDFKFFIAFLNDFDTNYPSYTSYMIENPQQVADYYNHLAPSTIDLELDIINSFPYTEFQTFVTNFPWYSSLLKQGDITTM.......... 121
91 6.000e-13UniRef50_A0A1L0C5A3 CIC11C00000001138 n=3 Tax=Clavispora/Candida clade TaxID=1540022 RepID=A0A1L0C5A3_9ASCO  ali  24  13.VALGMAAEQSEVNFLTALVSDFNEHKTEYVSFIKTYPADLTHLAIEIRTYTDDSYTTLLDNINVESLMSYATNLPWYS..................... 95
92 6.000e-13UniRef50_G8BXU6 Uncharacterized protein n=1 Tax=Tetrapisispora phaffii (strain ATCC 24235 / CBS 4417 / NBRC 1672 / NRRL Y-8282 / UCD 70-5) TaxID=1071  ali  39  23.........SAAIVELEVYMTDIVNNMDQYLAMQAANPAEIMSAYVQMARGNTISYTSFFSTIDESEVEFLMTGVSWYSARLAPSVSAALLEAGIDT... 115
93 1.000e-12UniRef50_A0A1E3NYQ2 Uncharacterized protein (Fragment) n=1 Tax=Wickerhamomyces anomalus NRRL Y-366-8 TaxID=683960 RepID=A0A1E3NYQ2_WICAO  ali  32  1.................VLFSDVKSHLNDYMSYVQNNPTELINYFTAITTYTDDSYTTLLSDFPASQIATLASELPWYSSRLETKLESAFTADG...... 82
94 1.000e-12UniRef50_G0V670 Uncharacterized protein n=1 Tax=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) TaxID=1064592 RepID=G  ali  20  57...ARNSAAAVDMPFFTAFLQDFEVKLAQYTSYMGEMPQAVADYYYHIAFSTADLEADIASTFPFTQFQTFITAFPWYLSLLSDASATTI.......... 149
95 1.000e-12UniRef50_A0A1V2LN51 Temperature shock-inducible protein 1 n=3 Tax=Pichia TaxID=4919 RepID=A0A1V2LN51_PICKU  ali  22  10.SIATLLASVHAEDLLVVLRSDIPNHLNEYLSYIQANTQELLTLFQQAQTYTDDSYTTLVDASQAAAITSFAEGLPWYSSRIEPSLNSTPAPSATSSA.. 110
96 2.000e-12UniRef50_H2B1H6 Uncharacterized protein n=3 Tax=Saccharomycetaceae TaxID=4893 RepID=H2B1H6_KAZAF  ali  29  22......EVTEYELVEFEALLADVEANLEDYISLAVTIPDGVLEVYEQMTTYTDDSYTTLFSEINFAQVTTVMEQLPWYSSRLIPIMSSYIAS........ 112
97 3.000e-12UniRef50_Q6BQS5 DEHA2E02662p n=2 Tax=Debaryomyces TaxID=4958 RepID=Q6BQS5_DEBHA  ali  18  13AASSQAALDSSQLEFLTRFVNDARSHTKEYLSYVQTIPKDFESLAKQIYATTGDGYTSEFDSAKVKTLESFATGMPWYDSRIAGS............... 101
98 3.000e-12UniRef50_A0A1D2VB21 Uncharacterized protein n=1 Tax=Ascoidea rubescens DSM 1968 TaxID=1344418 RepID=A0A1D2VB21_9ASCO  ali  19  13ALLSASTSNANSADAVTAVFDDINNHLTDYLSLVTAGPTAILSYYYVAQSYTDDSYTTLISDFPFSEFQTFVTGLDWYSTRLSSNLAIATGNGNAASATS 115
99 3.000e-12UniRef50_G3AZM3 Uncharacterized protein n=4 Tax=Saccharomycetales TaxID=4892 RepID=G3AZM3_CANTC  ali  24  12SVCAVQAADSEDVAFLTNLVQDYKSHTADYAKFIRTVPAVITSLALHVATYTDTSYTTLLDNLDIDSLEDFATELPWYSSRLLVADADASESGDASETDA 116
100 4.000e-12UniRef50_A0A1X7R2K1 Similar to Saccharomyces cerevisiae YBR067C TIP1 Major cell wall mannoprotein with possible lipase activity n=1 Tax=Kazachstania  ali  27  15.AVQASDPTPEQTAELVVLLNDVNNNFSSYTSWFRSIPNGIINAYFAVHNAKDLSYTTMFTALDMDALLDMATAVPWYSSYLSAEIASAISSVDAS.... 115
101 4.000e-12UniRef50_A0A1X7R9W4 Similar to Saccharomyces cerevisiae YBR067C TIP1 Major cell wall mannoprotein with possible lipase activity n=1 Tax=Kazachstania  ali  26  20......TPTAEQTAELVVLLNDVNDNFSAYTTWFSAIPDGIIDIYMAVHTATDESYTTMFTGVDIDALLAMATSVPWYSSYLSSEIAVAIASVEATEVQS 117
102 5.000e-12UniRef50_G0WCL9 Uncharacterized protein n=1 Tax=Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) TaxID=1  ali  31  1....................................MPATILDIGLALATVTDNSYATLYSEVDFTGVQSMITKLPWYSTRLEPEILSEM.......... 54
103 7.000e-12UniRef50_A0A0W0DPL6 Cell wall protein n=2 Tax=Candida glabrata TaxID=5478 RepID=A0A0W0DPL6_CANGB  ali  14  23...AKSMAADADMSFFLAFLDDFNERYTEYTSYMITLPQEVANYYYHLNGVDYDLKSDIINQFPFTIFKSFITVFPWYSSLLSEGGITDMVLPGDFLST. 123
104 8.000e-12UniRef50_H2AY63 Uncharacterized protein n=1 Tax=Kazachstania africana (strain ATCC 22294 / BCRC 22015 / CBS 2517 / CECT 1963 / NBRC 1671 / NRRL Y-827  ali  22  15.ASIASAITPYQNAEFEAVMADVQSNIGDYISLVMTGPSGLMEYVEAVMASSTAEYSSLMNNIDFSAVDSMITGLSWYSTRLLPMIESYYSEE....... 113
105 9.000e-12UniRef50_A0A1B2JHL8 BA75_04806T0 n=3 Tax=Komagataella TaxID=460517 RepID=A0A1B2JHL8_PICPA  ali  21  24................TVFYNDVTENAQEYLSYIQANTTDLLSLYTELATYTDDSYTSIFTDFPASELSSFVVNLPWYSSRIEPQV.............. 99
106 9.000e-12UniRef50_I2H9X3 Uncharacterized protein n=1 Tax=Tetrapisispora blattae (strain ATCC 34711 / CBS 6284 / DSM 70876 / NBRC 10599 / NRRL Y-10934 / UCD 77  ali  25  25........SQRDVDEMNLIMADVNENLVEYANLLGEIPDALFDIYGAMDAATDDSWTTMYDNLDMAQITAMLTALPWYSSRLEQPLYSI........... 107
107 9.000e-12UniRef50_A0A1E3QXA4 Uncharacterized protein n=1 Tax=Babjeviella inositovora NRRL Y-12698 TaxID=984486 RepID=A0A1E3QXA4_9ASCO  ali  25  23.....TSDPDANPCYITAFVDDFKAHMGDYAPYTNQIPANLLSFAMMAETYTDNSYTTLLDNFDYAEVESVVTLFPFYSTRLAPALEA............ 106
108 1.000e-11UniRef50_G0VJQ6 Uncharacterized protein n=1 Tax=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) TaxID=1064592 RepID=G  ali  30  5.........................NLGDYMSLATTMPAGVLSIGMALAGATDHSYTSMYSEVDMAGVSSMLTQLPWYSSRLKAQIDSIVG......... 79
109 1.000e-11UniRef50_G0WEB2 Uncharacterized protein n=1 Tax=Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) TaxID=1  ali  27  25.....NDYTHPHIVELTVIFEDIKTHLNDYIPLCFLPGTGFSLFNIQKGILDITIALSILTDIDYALIHACIIKLPWYAHRLEPAINAALQ......... 119
110 1.000e-11UniRef50_J8PWJ5 Tir4p n=1 Tax=Saccharomyces arboricola (strain H-6 / AS 2.3317 / CBS 10644) TaxID=1160507 RepID=J8PWJ5_SACAR  ali  24  16....TSAQTEEEIDELNVILEDVKTNIADYILLSQNMPAGVLDIGFELASATDESYTTLYSEVDFAAVSSLLTMLPWYSSRLKPELDALLATIVTAT... 117
111 2.000e-11UniRef50_A0A099NV24 Temperature shock-inducible protein 1 n=2 Tax=Pichia kudriavzevii TaxID=4909 RepID=A0A099NV24_PICKU  ali  23  10.SIATLLATTKAEDSEKVLEHDLKHHKSEYVSYVEAH-TELESAFSRIDTYTDDSFTTILD------LSSFVVNLPWYSSRLESKLEKS........... 90
112 2.000e-11UniRef50_G8BXU1 Uncharacterized protein n=1 Tax=Tetrapisispora phaffii (strain ATCC 24235 / CBS 4417 / NBRC 1672 / NRRL Y-8282 / UCD 70-5) TaxID=1071  ali  38  23.........SAAIVELEVYMTDIVNNMDQYLAMQEANPSEIMSAYIQIAIGNTISYTSFFSTIDESEVEFMMTGVSWYSARLAPSVSAALLEAGIDT... 115
113 2.000e-11UniRef50_G3AHR4 Uncharacterized protein n=1 Tax=Spathaspora passalidarum (strain NRRL Y-27907 / 11-Y1) TaxID=619300 RepID=G3AHR4_SPAPN  ali  25  16.TANAANASPQDIHFLTELVNDFQSHKLEYLSFLGTVPMDLAPLATHVLTYTDDSYTTMLTSINFAALTSFVTRLPWHT..................... 98
114 2.000e-11UniRef50_Q6CJN7 KLLA0F17182p n=3 Tax=Kluyveromyces TaxID=4910 RepID=Q6CJN7_KLULA  ali  17  30.SSAKQEAAAADLQFFIEFLDDFNVNLVSYTSYMMTLPQDVANYYYHLKSVTETTQLDLATSFPFTEFKTFITAFPWYSSILSEASATDF.......... 124
115 2.000e-11UniRef50_Q5A6M2 Repressed By RIM101 protein 2 n=5 Tax=Candida TaxID=1535326 RepID=RBR2_CANAL  ali  22  18...VASDAASSDVQFLTALVGDYQDHKTDYIKFFATVPGDLSTLATKVLTYTDDSYTTLLDSLNVSNLEAYATSLPWYS..................... 98
116 2.000e-11UniRef50_G0WBR2 Uncharacterized protein n=1 Tax=Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) TaxID=1  ali  28  12TAGAAMAISEDDVVELEIVMDDVKSNLVRYMNLLTSLPDNIMDVYMAMN-SDPEGYTTAFTELDMTQISNMMTWLPWYSTEIEPKIESALSSLH...... 108
117 3.000e-11UniRef50_G0VFL4 Uncharacterized protein n=1 Tax=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) TaxID=1064592 RepID=G  ali  28  352SVALANTITPAENAELQVVLADVNDNLGNYMNLLTSLPDNIVNVYMGMG-ADPVSYTTLFTELDMGQISAMLTWLPWYSS-LEPKISAAMAP........ 445
118 5.000e-11UniRef50_I2GZZ0 Uncharacterized protein n=1 Tax=Tetrapisispora blattae (strain ATCC 34711 / CBS 6284 / DSM 70876 / NBRC 10599 / NRRL Y-10934 / UCD 77  ali  16  23TQVARSKAADVDYSLFLEFLNDFNTRFQVYTSYMGQLPQKLADYYNHLAPSSIDLKSDIIKTFPFDEFNTFITAFPWYESMLSSVSLTAVKVPADFLTSN 128
119 8.000e-11UniRef50_C5MIN5 Uncharacterized protein n=2 Tax=Candida TaxID=1535326 RepID=C5MIN5_CANTT  ali  20  15.....AAQTNPNVEFLTRVVSDLASNGNEYISYFRNGPINLGIIRTAQQLTQDDSYTTLAADSGFSDLSAMITPLPWFNERIAGNISSVPTETNTAQTTS 117
120 8.000e-11UniRef50_A5E0N4 Uncharacterized protein n=3 Tax=Candida/Lodderomyces clade TaxID=1535325 RepID=A5E0N4_LODEL  ali  21  16.ATSVHAAGEQEVAFLTALVGDYQSHRTEYIKYFATIPGALSTLATQVLTYTDDSYTTLLNGVNVGELESYATNIPWY-TRIEAA............... 104
121 9.000e-11UniRef50_A0A1E4SH02 Uncharacterized protein (Fragment) n=1 Tax=Suhomyces tanzawaensis NRRL Y-17324 TaxID=984487 RepID=A0A1E4SH02_9ASCO  ali  20  23..........QDVEFITKLVNDAKAHQDDYLDFYGTVPSEFLKLARKVQTYTDDSYTTLIDNINVAQLESFASQLPW....................... 95
122 1.000e-10UniRef50_Q12218 Cell wall protein TIR4 n=12 Tax=Saccharomyces TaxID=4930 RepID=TIR4_YEAST  ali  25  19.......QTQAQINELNVVLDDVKTNIADYITLLDQMPAGIMDIAAQVANPSDDSYTTLYSEVDFSAVEHMLTMVPWYSSRLLPELEAMDAS........ 113
123 2.000e-10UniRef50_A0A1E3QPK1 Uncharacterized protein (Fragment) n=1 Tax=Babjeviella inositovora NRRL Y-12698 TaxID=984486 RepID=A0A1E3QPK1_9ASCO  ali  17  5....VAQAVAYDASFISYFLLDFDFNNDRYTSYMKDNPQTLIQYIVDQQGQTD--LTKALDAFPFTQFRTYITAFPWYNSLLGKGSITEFKVPGDFTAA. 101
124 2.000e-10UniRef50_W1QK24 Putative secreted protein n=2 Tax=Ogataea TaxID=461281 RepID=W1QK24_OGAPD  ali  26  20TTTVASADASANAGVLQVFLNDFASRFDDYTSYMNSFPGSLVQFYMEQASTNQAAVTSMLSDFPMSEFKTYISVFPWYSSLLSAGGDSTI.......... 121
125 3.000e-10UniRef50_I2H9X8 Uncharacterized protein n=1 Tax=Tetrapisispora blattae (strain ATCC 34711 / CBS 6284 / DSM 70876 / NBRC 10599 / NRRL Y-10934 / UCD 77  ali  31  18.NAATVDPTRAAMLALQVYMTDIRNNIAQYMSLQKESPDQSVPPAVTKAMMDMAAYTTHFSTVPLSEIEFIITGVPWFTTRLKTQILNVWS......... 112
126 3.000e-10UniRef50_A0A1E4SKG9 Uncharacterized protein (Fragment) n=1 Tax=Suhomyces tanzawaensis NRRL Y-17324 TaxID=984487 RepID=A0A1E4SKG9_9ASCO  ali  22  1..ASVHAADSLDVALLTAFVSDFRQHPQQYIGFFATVPSGITDLAKTVITYTDLGYTTLLDNVNVNNLRSFAEQLPWY-TRLASDSDVPASTSGTASVAT 102
127 3.000e-10UniRef50_A0A1X7R4S1 Similar to Saccharomyces cerevisiae YER011W TIR1 Cell wall mannoprotein of the Srp1p/Tip1p family of serine-alanine-rich proteins  ali  24  13.ASMANALSEAQTAELNAILSDVQNHLSDYMGLATSGPAGVLNLGMAIA--EGKETSALYDSVDMAAVETWLPALPWYSSRLSSEIDAAL.......... 106
128 3.000e-10UniRef50_J7SAC3 Uncharacterized protein n=2 Tax=Kazachstania naganishii (strain ATCC MYA-139 / BCRC 22969 / CBS 8797 / CCRC 22969 / KCTC 17520 / NBRC  ali  34  724.TTLFFYDPRVQAVELSVYANDIAHHQSEYDSYNELRTSMRYPQAVASAASDIANWSNIVTMVDTVSVCGLISGVPWYSTRLQQSLDAAFRARHIVVV.. 826
129 4.000e-10UniRef50_Q6FUQ8 Uncharacterized protein n=2 Tax=Candida glabrata TaxID=5478 RepID=Q6FUQ8_CANGA  ali  29  56.................................LADMPSGLIQLGMAVGTATDDSYTSMYSDVDFAGVDKMVTMVPWYSSRLKPLIDSLYAAENPAPSTS 122
130 4.000e-10UniRef50_A0A2V1AEC9 Uncharacterized protein n=1 Tax=[Candida] duobushaemulonis TaxID=1231522 RepID=A0A2V1AEC9_9ASCO  ali  24  13AASGVKAANSDDAEFLTKLVSDYDSHKTQYLAFAKTAPSELTELATQVATYKDDSYTTLLDNSDYSALKDFATELPWYS..................... 95
131 1.000e-09UniRef50_A0A1V2L3W4 Temperature shock-inducible protein 1 n=1 Tax=Cyberlindnera fabianii TaxID=36022 RepID=A0A1V2L3W4_CYBFA  ali  16  8.ALAASFVAADKNSELEGLLADLKANLNDYLSQVSTPPPQLLSLAQEARTYTDNSYTTLFDQVDINEVK............................... 78
132 1.000e-09UniRef50_G3B1H6 Uncharacterized protein n=1 Tax=Candida tenuis (strain ATCC 10573 / BCRC 21748 / CBS 615 / JCM 9827 / NBRC 10315 / NRRL Y-1498 / VKM  ali  27  25SSESTVSVNSLDVEFLTKLVSDVSNHGAAYFMFSRTIPKYFGSLVDELGSYSNDDYTTLLADFPITSVEHFATKLDWYSSRLA................. 113
133 1.000e-09UniRef50_I2JTV3 Tip1p n=1 Tax=Brettanomyces bruxellensis AWRI1499 TaxID=1124627 RepID=I2JTV3_DEKBR  ali  23  20........DARQVESLEVLFLDIEDNINGYIQYLMLNPDGLIALFTQIATYTDDSFSTLFSESEYDEIQSLETALPWYSTRILPKI.............. 105
134 2.000e-09UniRef50_A0A1X7R5X6 Similar to Saccharomyces cerevisiae YOR009W TIR4 Cell wall mannoprotein of the Srp1p/Tip1p family of serine-alanine-rich proteins  ali  28  23..........EDLAELTVIFSDINKNGDSYTNWIIDMPMDVLPILMGVETATDSSYTTYLDQLNDADVSAFATSVPWYTSYLSSEI.............. 105
135 4.000e-09UniRef50_A0A1V2LBL8 Temperature shock-inducible protein 1 (Fragment) n=1 Tax=Cyberlindnera fabianii TaxID=36022 RepID=A0A1V2LBL8_CYBFA  ali  25  632...........KTAELNAIMADLKAHQADYLAQISAGPSDLLSLVQQAITYTDESYTTLYGNVDLNVVESYITKLPFYS..................... 702
136 6.000e-09UniRef50_A0A0J9XEG3 Uncharacterized protein n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XEG3_GEOCN  ali  20  84...............VTSFYADFVSNLNNYKSFFLTHTENVNDKFSSVITYTDNSFTTVVNSELSSQLATIAKQFPWYSDWVKANQASGSSASVSPTANS 175
137 9.000e-09UniRef50_H2ARK3 Uncharacterized protein n=1 Tax=Kazachstania africana (strain ATCC 22294 / BCRC 22015 / CBS 2517 / CECT 1963 / NBRC 1671 / NRRL Y-827  ali  24  17STISASSLSPEDIAQLELAVSEYKANAASYMMWGLTMPDGLANIFLTAVHYTDDFYTTLFSNIAMSDMQAIAEALPWYSSEI.................. 106
138 9.000e-09UniRef50_I2JX75 Tir3p n=1 Tax=Brettanomyces bruxellensis AWRI1499 TaxID=1124627 RepID=I2JX75_DEKBR  ali  28  30...................................SFPTGLIDIYTAMTTYTDDGYTSLFKTIPFSEIXALATALPWYSTRLLPAAEADASKIG...... 91
139 1.000e-08UniRef50_A3GGZ8 Uncharacterized protein n=1 Tax=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) TaxID=322104 RepI  ali  25  19....AVSLDSSEDTFLTKLAEDAALYPEQYAQFFRTAPSALEDFAKDVATFTDESFTTLVQNLDVSAIESFATNFPWFSSRLE................. 103
140 1.000e-08UniRef50_A0A0H5C188 Uncharacterized protein n=1 Tax=Cyberlindnera jadinii TaxID=4903 RepID=A0A0H5C188_CYBJA  ali  17  29.SSATSRALASDASFIYDVMLDINHRYTTYLQYMDSNKMQFPDDIVQYMVQTISKESSLFESFPFDDFKTMITAFPWYSSLMSAADLSTF.......... 124
141 1.000e-08UniRef50_G8BVX5 Uncharacterized protein n=1 Tax=Tetrapisispora phaffii (strain ATCC 24235 / CBS 4417 / NBRC 1672 / NRRL Y-8282 / UCD 70-5) TaxID=1071  ali  16  43.AEAKTLAASADYEFILTFLENIDNELGSYKSYLDANPQKVLNYYYHLASSSINLTSDFANEFPFTVFQTFITQFPWYSLMLSEASISTF.......... 137
142 2.000e-08UniRef50_Q07988 Cell wall protein YLR040C n=17 Tax=Saccharomyces TaxID=4930 RepID=YL040_YEAST  ali  15  37.TLARSAAADADMAFFMEFLNDFDTAFPQYTSYMMQNPQPVADYYYHMVASTADLQSDIAQSFPFTQFQTFITAFPWYTSLLNKASATTI.......... 131
143 6.000e-08UniRef50_A0A231VRF3 Uncharacterized protein (Fragment) n=1 Tax=Rothia sp. Olga TaxID=1979525 RepID=A0A231VRF3_9MICC  ali  35  1...MAITEDKIQNLELSAYVRDILGNMGQYLSFRQANPDQPYPTQLNQIVMNNDGWTSSLTGIDPNTVEMM............................. 74
144 6.000e-08UniRef50_E7LRH4 Tip1p n=1 Tax=Saccharomyces cerevisiae (strain VIN 13) TaxID=764099 RepID=E7LRH4_YEASV  ali  30  1................................................MTYTDDAYTTLFSELDFDAITKTIVKLPWYTTRLSSEIAAAL.......... 42
145 6.000e-08UniRef50_H8X4L2 Uncharacterized protein n=2 Tax=Candida TaxID=1535326 RepID=H8X4L2_CANO9  ali  17  26........TDQQEALLTRVASDIRSYPSEYADWFKTQSDLDLLSLRRLSTYTDDSYTTIVENSEMSDVENVVTRLPWYNSRIADSEVPSVTTDDSNESGS 122
146 7.000e-08UniRef50_Q75A99 ADR019Cp n=2 Tax=Saccharomycetaceae TaxID=4893 RepID=Q75A99_ASHGO  ali  25  21........DKLESSSLDVLFSDAQAHTQDYMGFFKPVGTHDPPRGLKEAFFKAGNFPTEADAIDFETVKNGVKDLPWYNDRLAKPLAAIGGAAEQPAKT. 115
147 1.000e-07UniRef50_A0A1V2LK84 Uncharacterized protein n=4 Tax=Pichia kudriavzevii TaxID=4909 RepID=A0A1V2LK84_PICKU  ali  17  26SAGEKTAAVVEQEDFIKAIMRDALASQDKYASVMMEVPPELLQFLLALDNVEITDFPTFADHFPFDEFATFVTNFPWYSSYLTENGLTSFKQPSDFST.. 129
148 2.000e-07UniRef50_E7NJL8 Dan4p n=2 Tax=Saccharomyces cerevisiae TaxID=4932 RepID=E7NJL8_YEASO  ali  82  24.........................................YPSEIAAAVFDYGDFTTRLTGISGDEVTRMITGVPWYSTRLKPAISSALSKDGIYTA.. 80
149 6.000e-06UniRef50_A5E6S9 Uncharacterized protein n=1 Tax=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) TaxID=  ali  23  32SSAQATSSQPDEVVLLTRLVSDVATNANEYIHFFETQTQVPIPLNLQITTYTDDSYTTLAENLAMGSVESLVTVLPWYESRIVS................ 121
150 1.000e-05UniRef50_E7M248 Tir4p (Fragment) n=2 Tax=Saccharomyces cerevisiae TaxID=4932 RepID=E7M248_YEASV  ali  38  4....................................................DDSYTTLYSEVDFSAVEHMLTMVPWYSSRLLPELEA............ 39
151 6.000e-05UniRef50_A0A0W0C936 Cell wall protein AWA1 n=1 Tax=Candida glabrata TaxID=5478 RepID=A0A0W0C936_CANGB  ali  50  23TTTLAPTDFRVNMIELQAYLADIKGHMMQYLSFQGANPNQPYPSQM...................................................... 68
152 1.000e-04UniRef50_K0KPX0 Cell wall protein n=1 Tax=Wickerhamomyces ciferrii (strain F-60-10 / ATCC 14091 / CBS 111 / JCM 3599 / NBRC 0793 / NRRL Y-1031) TaxID  ali  14  30...ASSQALQTDGELFYAFLSDFNYNFPKYKTFMMTYPANLQNYAFQIQSITDDEEMIQVKSFPFSEFNTMFTKFEWASSLLSENGLS............ 121
153 3.000e-04UniRef50_A0A1V2L3A9 Uncharacterized protein n=2 Tax=Cyberlindnera fabianii TaxID=36022 RepID=A0A1V2L3A9_CYBFA  ali  15  41...........DGKFIFDVLVDLNSRYTQYITYMDNNPEGVANYINRI--LTISSEGSLLASFPFSEFQTLMPAFPWYSSLLSEAGVTTF.......... 126
154 3.000e-04UniRef50_A0A1E3QPN0 Uncharacterized protein (Fragment) n=1 Tax=Babjeviella inositovora NRRL Y-12698 TaxID=984486 RepID=A0A1E3QPN0_9ASCO  ali  22  131AAPTAGGDPDANPCYIVALVNDVKANLDAYLPYEAQIPSALLNLALAAETYTDDSYTTL......................................... 189
155 4.000e-04UniRef50_G8JSR4 Uncharacterized protein n=1 Tax=Eremothecium cymbalariae (strain CBS 270.75 / DBVPG 7215 / KCTC 17166 / NRRL Y-17582) TaxID=931890 Re  ali  21  81....................................................QEEYSSLLKGVDRHALNSFMEALPWYSERILPQLQKSNSTEDSPAVA. 127
156 1.000e-03UniRef50_E7NKL2 YLR040C-like protein n=1 Tax=Saccharomyces cerevisiae (strain FostersO) TaxID=764101 RepID=E7NKL2_YEASO  ali  16  2..............................MQNHLTLPQPVADYYYHMVASTADLQSDIAQSFPFTQFQTFITAFPWYTSLLNKASATTI.......... 63
157 1.000e-03UniRef50_G2W8N9 K7_Pau7p n=1 Tax=Saccharomyces cerevisiae (strain Kyokai no. 7 / NBRC 101557) TaxID=721032 RepID=G2W8N9_YEASK  ali  90  23TTTLSQSDERVNLVELGVYVSDIRAHLAEYYSF................................................................... 55
158 0.003UniRef50_A0A1E4T655 Uncharacterized protein (Fragment) n=1 Tax=[Candida] arabinofermentans NRRL YB-2248 TaxID=983967 RepID=A0A1E4T655_9ASCO  ali  23  2...................................DFPQDLLQFYVDLSDETGTEFPTFLSRFPFTEFQTFASALPWYTSLLKEAQASTF.......... 58
159 0.004UniRef50_A0A1D2VRG7 Uncharacterized protein (Fragment) n=1 Tax=Ascoidea rubescens DSM 1968 TaxID=1344418 RepID=A0A1D2VRG7_9ASCO  ali  16  15.....SIVSAYNVDVITAFFSDLEQYGDDYLTYIATIPADVLSYYYSARTLQGEDLTSALEGFPTNDFVTFVTQLDWRSRIYTENIVATVT......... 104

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Robinson-Rechavi M, Godzik A. Structural Genomics of Thermotoga maritima Proteins Shows that Contact Order Is a Major Determinant of Protein Thermostability. Structure (Camb). 2005 Jun;13(6):857-60.