current user: public

If you have questions about the server, please let us know.

Query: gi|6319250|ref|NP_009333.1| Putative permease, member of the allantoate transporter subfamily of the major facilitator superfamily; mutation confers resistance to ethionine sulfoxide; Seo1p (YAL067C) [Saccharomyces cerevisiae], from S.cerevisiae

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .  590
# E-value Template Links and tools%idFirst MYSIVKEIIVDPYKRLKWGFIPVKRQVEDLPDDLNSTEIVTISNSIQSHETAENFITTTSEKDQLHFETSSYSEHKDNVNVTRSYEYRDEADRPWWRFFDEQEYRINEKERSHNKWYSWFKQGTSFKEKKLLIKLDVLLAFYSCIAYWVKYLDTVNINNAYVSGMKEDLGFQGNDLVHTQVMYTVGNIIFQLPFLIYLNKLPLNYVLPSLDLCWSLLTVGAAYVNSVPHLKAIRFFIGAFEAPSYLAYQYLFGSFYKHDEMVRRSAFYYLGQYIGILSAGGIQSAVYSSLNGVNGLEGWRWNFIIDAIVSVVVGLIGFYSLPGDPYNCYSIFLTDDEIRLARKRLKENQTGKSDFETKVFDIKLWKTIFSDWKIYILTLWNIFCWNDSNVSSGAYLLWLKSLKRYSIPKLNQLSMITPGLGMVYLMLTGIIADKLHSRWFAIIFTQVFNIIGNSILAAWDVAEGAKWFAFMLQCFGWAMAPVLYSWQNDICRRDAQTRAITLVTMNIMAQSSTAWISVLVWKTEEAPRYLKGFTFTACSAFCLSIWTFVVLYFYKRDERNNAKKNGIVLYNSKHGVEKPTSKDVETLSVSDEKLast
1 0.000e+00UniRef50_A0A0D9P4A7 Uncharacterized protein n=2 Tax=Metarhizium TaxID=5529 RepID=A0A0D9P4A7_METAN  ali  21  430.......................................................................................................................................DFRLVTVLACLYIISLVDRVNISTAAVAHLNSDLALTGARYSIVISVFFITYTVFQPLGTVLTRKIGPRWFLSSIAMAWGLVMIGNGFVHSWQTLAGLRVLIGVFEAGYFPGAVYLLSTWYTRFDMQKRYTVFYGVGCVAGALGGILAFGLSQ-MNGLAGLRGWRWIFIIEGILSCIGALVSYVFLVGFPEEASWNFINRQERDFIIRRVNRDRG---DAVTEPFSLGVFLAPAADFKIWIFAFI-FFCVTTVGYSINYFLPMILLGMGFSVAESQCLIVPPWVFTGLVMYAQAWLGDRYRLRXXXXXXXXXXXXXXXXXXXXHHAYPVRYTGVFFVVAGASGNTPPVLTYQANNIRG-HWKRAFCSATL-VGFGGIGGIAGALVFRSQDQPRYLPGIYASIACNVCILLCTGGLSIWFRYANQQVKRGKVVLE........................ 859
2 0.000e+00UniRef50_R8BVI1 Putative pantothenate transporter liz1 protein n=16 Tax=Dikarya TaxID=451864 RepID=R8BVI1_TOGMI  ali  27  4........................................................................................ATTATTGEVASRVDEAAPKVKLSLLSYIWDKDTHLKSPAERKLLRKLDMSILIVACLGFFMKFLDQTNIANAYISGMKTDLAMNGNEYTYAGTAYTVGYAIMQVPSTLIVQYIPPRIWLAIVEIGWGIFTFAQAGLRNSPQLYAFRFVVGLFESSFSPVVIYVMGSWYKRTELAKRITIFEASAVFGTTFSGYLQAAVYTNLDGVHGIAGWRWLYIVCGCMTVPIGLAILFVFPDNPYHNTAWFLTDEERALAIERVRAEGIAPPT----KVTWRTFTRILTRWRWYIFTLSYVL-YGCSSQAGAFFGIWLISA-GFTVQQANXXXXXXXXXXXXXXXXXXXXSDITENRFAFVIGPLILGIVPSTILAVWPPGVGVKEXXXXXXXXXXXXXXXXXX-XXETCRDDNEERAVVAASMNGFSYAVLAWLNILIFPQTMAPSFRRGFPXXXXXXXXXXXXXXXXXXXXXREQKRLEAGRSEVEDGEDIGSEERRMDEKS........ 500
3 0.000e+00UniRef50_A0A1Q5QB01 1,3-beta-glucanosyltransferase n=2 Tax=Talaromyces TaxID=5094 RepID=A0A1Q5QB01_9EURO  ali  20  421......................HAPKITFAPVDLGAGVPDKANTQFLLTRLFQVFRTHNTKKSRENMSIRETTSDIESEPCTKDDAY------IKTQYSTDVPSAAGILESLHSSSHAISHVIDHKAERALCRRFDFRLLPILAFMYLCNALDKANLGNAQTDGMGIDLGMSGSQYNXXXXXXXXXXXXXXXXXXXXXKRLSPAKVISGMMFSFGVFTLLSASVSNFSGLFALRWFLGMSEAAFFPLVIYYQTTFYRRAELGRRLAIFYAASNIASAFSGLLAFGVFQIKN--SSLQGWRYLFLIEGSFTVCFSLFAFFYLPRSPQEAR--FLSEDEKKLAFHRIQVDSSAVV---NEEFNLRHALGILKRPTTHAFFIIEI-CLGVPLQGVSLFLPQIVSRLGYSTVKTNLYTVAPNVTGAVMLLILAFSSDATRVRXXXXXXXXXXXXXXXXXXXVNTHIQLAYYACFMMTWGTSAPSVLLTTWYNNNVA-DEGQRVLLTSIGVPLANLMG-LVSSNVFRSQDAPKYMPALVTXXXXXXXXXXXXXXXXXXXXFDNARRDRRAGRKIHACDVPTERLRDGPK......... 970
4 0.000e+00UniRef50_A0A2P6MZ88 Uncharacterized protein n=1 Tax=Planoprotostelium fungivorum TaxID=1890364 RepID=A0A2P6MZ88_9MYCE  ali  19  5.........................................................................................EEDPRREEVQDHAFDDRSQVDADLLEKGKAESAEMSPEEKRLLAKLDRVIIPMTMLLYLVAYLDRGMLGNARLLGLEQDLDGQSSEFDWALSIFYIGHISFMIPGNILAKMVRPSYWIGAMTVMWGLCSTLQAVCTNFAGLATTRFFLGLFEAGFGPAVPLYFSFWYKRDEMGLRNALFIGSAAAAGAFSGLIAYGVQKI---ETSYPLWKXXXXXXXXXXXXXXXXXXXXMPDRPATSR--YLTESERKLAVQRI-------GGKSTLTLERDQALSAFRDYKVWMCGVLYM-GYNIALSSISSFLPTILSDLGYHGASAQIRTVPPYTCAFIIMVVSALSSDRFKERGLHLTFLGALGASGYLLLILVPTSGLRYFSTFLITMGVYPCIPLTLSWVSNN-AGTESKRAVSLSWTVIMGHTFS-ILGTHIYPASQRPTYLLGFGMCFASMTVATMTAFALHLMLKKENANKEILERQPEYEPGKGDR................ 496
5 0.000e+00UniRef50_C9SWB0 High-affinity nicotinic acid transporter n=5 Tax=Glomerellales TaxID=1028384 RepID=C9SWB0_VERA1  ali  18  23.............................................................................................................PGDGNELAQNSDALSAAEQKRALKKMDLRLVVFVGIMYCFSVIGRSALASASVAGMADDLQLVGNRFSVTIVVFFATYILFQPVSTIVARTIGPRLYFSAITLSSGLVVIGMGHAKSWIDMIVMRLLL---------------------AEVGSRFSWFYILVSVSYAFGGLLASGLTR-MDGLGNLRGWSWIFMIDGIITCLIGLAGLFLLAEFPDTTKPHFLSSRELAWVRSRVNADRG---DVAISKLTLRKLMRGGLDPKVWAFALI-FFNNAVVNFALANFLPIILKNMGFSVAKSQALVAPPYVFAAIVMHTVGWLGDRYRVRGPFLVAMMLLSITGTSLMGFHQRTGFRYSGVFLTAAGTTSAVPVTMAYQANNIRGQ-WKRAFSSALVVGVSG-FGGIFGTLVFRSQDAPAYLLGLTTCLACAVLNILIVLSLTIYFYFANLRADRGEVELEISEEVRTQ................ 465
6 0.000e+00UniRef50_A0A094JZF1 Uncharacterized protein n=2 Tax=Pseudogymnoascus TaxID=78156 RepID=A0A094JZF1_9PEZI  ali  28  134..........................TIDDINIYKLKYNISTETELRLLSITPAQQLGSCATLLIMSSPEKKISIEDITPTSHSHQHYGQATSSWEDPNGEPVTASPAPPAPRQKVWQYFSADDTPAERRLILKLDGLIIVFLFLAYWAKVLDQSATSTAYVSGMKEDLNLFGNELNYLNTVFQCGFIAMQIPMTMLMTRVPVNYFLPAADLLWGVFTLVQYKVTNVHQLYAFRFFVGVLGGFFFPAAMWYMGCWYKRSELSRRGAFFFIASQVGSMSSSYIQAGAYSHLDGRYGIEGWRWLYIICFACTIPIAALGFICLPGTPESPNFRFLTEADVELARARMASEHRQS----RQKITVKIVRDVFKGWHFWVLVIFAFFFSQADGVVSNSGLPLWLKQQDYSIEDINXXXXXXXXXXXXXXXXXXXXADAYDCKASLIGLTAALNIFACICLAIWDIPVGLKFFAFYLSGTADAIASIIYAWANEICAGNAEERALVIATMNTIGNAFGAWLPLLVWKTTDAPRYLIGYNWTIALDICMVAMLFVLCHYWNREQREVRETEKVEEGGAINSE................. 682
7 0.000e+00UniRef50_A0A0G2I0Z3 Uncharacterized protein n=16 Tax=Fungi TaxID=4751 RepID=A0A0G2I0Z3_9EURO  ali  23  2.............................................................................................TSVLSQTEKPSHEQGQVQNHVVSIVDNDPIDLEKEKKLLRKIDLHLLLPLWVIFMFGFLDRINLGNVAVLGIMEELQLRGNDFNIALQVFFVPYILLDIPSNIVLKNFSPSTWISLLTFFWGISCMCQGFVTNNSGLIACRFFIGVFEAGYVPGCAYLMAMFYKRHEFQKRFSXXXXXXXXXXXXX-XXXXXXXNHLQGRGGYSGWRWIFIIEGLISIVLAIPAKLLIADWPDQAK--FLTQEDKALLHKRNAADVGGFARM--DRLDSKAWKRILLDWKIIVGSMIYI-GITVSGYATALFIPSIVNSLGYNGIDSQXXXXXXXXXXXXXXXXXXXXTDRFKHRXXXXXXXXXXXXXXXXXLDGGLKVGVRYMAVFFVTSGCYVVQPVTIVWLANNLGG-HYKRAVGLAIQ-VGIGNIGGIIASNVFVRSQGPRYFVGYGVSLGMMIFCGVMSTIFAIGLARENRIREAGGRDDRLGSG---ELENMGDDDP....... 489
8 0.000e+00UniRef50_A0A1X2H2F1 Major facilitator superfamily domain-containing protein n=2 Tax=Syncephalastrum racemosum TaxID=13706 RepID=A0A1X2H2F1_SYNRA  ali  21  2......................................................................................................................PDLSIPPDQEKRVVRALDLRLLVILCLFYFTDFLDRVSIGSAKVEGLPEDLNAT-VQTGVAVSAFYITYITLEIPSNLLLKRFNASLWLSGCLFSWGIITLCTAFVTNFAGILAVRLLLGVAQSGYIPGVIYLISKHYKVEETGVRIACINATAFAAGILSGPIAYG-SMLLDGAHGLHGWQYLFLIEGAFTAAVGLISYWWLFDDIQRVK--WLTDDQKHWQKIRMQRDVG-----DSKSVALSDIRIALFDWKTYAMAFMY-LTNAVVLTSLLVFAPTVIDGFGFSRLTSLILPAAPNASGFVMALLGGYLVDRYGCRELIIMTGFFLTALGCTLLLVLVDAWSQYGCLFLCLAGVGFQSPAIFGWPGQIFCH-LTQRAVSIGAILTLGGC-GSVIASFLFPATDEPRY................................................................ 400
9 0.000e+00UniRef50_A0A2I0RKH4 Putative transporter n=7 Tax=Fungi TaxID=4751 RepID=A0A2I0RKH4_9PEZI  ali  18  1.............................................................................................................................................MVTLLYLLCFLDRANIGNARIQGMERDLALYGVRFNWALSVFYIVYCLVEVPSNIILKRVGPRFYIPLLVVGFGLVSMCTAWVNTFNQLCVARAFLGVFEGGTMPGIAFFLSAFYKRKELYFRVGIYVSAASMAGAFGGLLAAGLANIPRWSAPIHTWRNXXXXXXXXXXXXXXXXXXXXPQSPETST--WLTEREKFIASERLRIEHRASA---NQVVKPHHIKRALLNINNYI-CAAGFFCINITVQGLSVFMPTILRDLGWKATRAQXXXXXXXXXXXXXXXXXXXXSDKTKQRGLYLAAFTTLGITGFALLRADTSANVRYGAVYLCALGAFPGGPGFLSWGLNNAAGPAV-RAVSSGWIVTLG-TLGGIVATWTYLASDGPEFPTGHTINLSAQAVVLFLAIGGMLYCLYENRLRARGGRSNRLNGLSEEEIADLGYRHP....... 440
10 0.000e+00UniRef50_A0A1J9QDX2 Uncharacterized protein n=3 Tax=Ajellomycetaceae TaxID=299071 RepID=A0A1J9QDX2_9EURO  ali  18  324...........................EDTPPSSSFTTDSQLTPEEGSSGSRDGDVQSSNREQQLPGLQTNFDGDGNNKFLTEFRELEHHDYSIDAGGFGDDYISPNAAEAFDFTDETGSKSYTIDEEKGVVRKFDIRLTMFMALLYMLSFLDRSNIGNARIAGLEKDLKLTSPQFEWVLTAFYITYICFEW-MTLMYRVVPAHIYISICCFSWGLIAACQSLVSSFWSLVLLRALLGIAEAAFGPGLPFYLSFFYKREELAYRTGMFISAAPLATSFASTLAWAIVK-LSDDGPLAPWRAXXXXXXXXXXXXXXXXXXXXPDSPGKAR--YLTPRQRKVAKLRLKMSDGTKDKSRERRFDWKEIGRTLRDPKSYLTALM-FCSCNVAFSSMPVFLPTILKDMGYPAQTSQALSAPPYILSFLVVLLTASLSDRQRTRSPYLIAHALVSSAAYITLSSTLLILIRYXXXXXXXXXXXXXXXXXXXXTMDNQPAKEGK-GTGMAILNIIGQC-GPLVGTRLYPQTDGPWYVKGMAVCALFMLLVAVLAFALRMILHKENERALMGTAAVDADEIEMVEGEAAG........... 886
11 0.000e+00UniRef50_C4Y249 Uncharacterized protein n=10 Tax=Saccharomycetales TaxID=4892 RepID=C4Y249_CLAL4  ali  21  14...........................................................................................................EVEVSEGQIESVEEPFDVKAERRLLQKFDWKIMPLFCAAYFFSALDRSNIGNANVAGMAKDLNLTSHQYSNAVSLVYATYLPVMLPGVWLMRKFKPRYYMGGMIICWSIISIFTLFVRSYGSLVAMRLLLGFFEGSFFSCMTLIATDYYLPDEIGRRTSYYFVASALSSSFGGLIATGITKIPKGA--LKPWHYLYLIEGLLSLVCGICVLVFLPDSPVEMIH---SQEEMIVYKSRSER---RKTYDGSSHFDKKEFISAF-DFKI-ACSVVIQFCQDVCLYGFSTFLPIILKGLGFDSLKAQYLTVPVYIFAGLIYLFFAEISDRTKIRGXXXXXXXXXXXXXXXXXXXXDKAGVKYFACYLICFSLYIGTGVNESWIASNTA-PSFKRGTSIAINQSLGNISGAI-SPQVY--VHPPDYELGHKFTLGCLCVSSAVSIICTLYLKRKN---EIHQKILDSGVDDRKQARKTGDDSP....... 477
12 0.000e+00UniRef50_F9XPL9 Uncharacterized protein n=8 Tax=leotiomyceta TaxID=716546 RepID=F9XPL9_ZYMTI  ali  18  2.......................................................................SSIKQDTIFYDHHQHVNDLRQVPSDEEKHAALDRFATNVPLIDEPLDEDPEFTYKEQRKIIHRIDRRLILATGLMYCVSGLDRGNLPNAAIAGMTKDLELNGYRYSIVALVFFITYALSQPPATILTRILGPRIFLPALCCSWGIVMIGFGFPKVWTPLVPLRLLLGLFEAGMFPGSVYVISTWYSRYDQQKRFAAFFIFTMLTSGCGGILAVGLEQ-MDGLGGYAGWRXXXXXXXXXXXXXXXXXXXXXXDFPDRAHWHFLKENEILFIMRRIKKDRN---DGEAEPWNFRKWLSAGADPKVWSFALI-FFALTTSGYALSYFLPSLLRNMGFTINESQMLTAPQHVFAAILLALFAWVGDKYHIRGPMLLVNAAMGLTGCALVGYSQAVGARFFGTFLICGGSSGAIPTCVAYQANNIRGQ-WKRAFTSATLVGFG-ALGGIAGSLVFRTQDKPDYKPGIWACMACNGLIAVLVCVNTWHFRRENARADRGEKILEGEP..................... 501
13 0.000e+00UniRef50_A0A093UNH1 Carboxypeptidase S1 like A n=1 Tax=Talaromyces marneffei PM1 TaxID=1077442 RepID=A0A093UNH1_TALMA  ali  17  606.................................................KKDDNSTQSPPHENSAPAVMKHGCSTYALTSFPHPFARSLNANIVSIENDPDIDVKGKTETETDVESPVDIPQLTKTTERKLMSKVDLHVLPFLV-----------NISNAVLFGLQKDLDITGTKYNTALTIFFVPYIIFE------------------------------GLVQNWGGLMATRFLLGLFETGMFPGCFYLMSCWYTRGEAQKRFSFFFGSATLAGAFGGVLAFGI-GKMDGV---------------LTVIIAVIWFWTLPDFPETVS--WLSEDERAFIKAKLEKDTGKSAHA--QSVTWRDALRVFKDYKIFVGGLAY-FGLIVPAYGYAYFANSIIKSYGYSALTTQLYSVPPWAAAFGFSQLVAYFSDRLRHRYXXXXXXXXXXXXXXXXXXXXHNKHVQYGALFLVTSGTYSAMPVIVCWYAMNLGG-HTRRSVGTAWQVGFGN-IGGIIATYSFLSKDAPEYRNGFIICISFACLSMAACTVYLVGVWHANRQRARILAESSGHLAEDGDKTEDGDLAP....... 1081
14 0.000e+00UniRef50_I1S2T4 Uncharacterized protein n=97 Tax=leotiomyceta TaxID=716546 RepID=I1S2T4_GIBZE  ali  20  4............................................................................ENERKQEDDVADNDHIERAETTATNDDAVFSKFPKMDKVDKFGAHAKTDPREIALVKKLDKYIIPMLWLMYLFNYLDRNAIANARLNNLEEDLGLEGTQYNTCVSILFVGYIAGQVPSNMLINRVRPSWYMAGFCLAWSVVSLVTFLAKDYGSMVALRFILGVTEAPFYPGALFILSMFYTRKELAVRLAIFYTGNMVASSFAGLIAAAVFAGLDQKHGLAGWQXXXXXXXXXXXXXXXXXXXXXPDHPLTTR--WLSEDERQLAYNRIYTD---TTDVREKTSVWVGLRESASDWRTWALCLMYNLHL--SSVGFQNFLPSVMETLGYNRTXXXXXXXXXXXXXXXXXXXXXXTSGRWNERTLHITICKCIVMVGFIIAVSTLNLGARMFSIYLFVGFSFGINNIILAWISATVGQTSEKKAVSLAICNTFGN-LAHVYTAYLWPSSHEPR................................................................. 447
15 0.000e+00UniRef50_A0A0S7DR26 Uncharacterized transporter C1039.04 n=1 Tax=Aspergillus lentulus TaxID=293939 RepID=A0A0S7DR26_9EURO  ali  21  3..............................................................................SNIMSDTTRDDTKTSTANESIHENSDNLKNYGSAPGVVEDVVRVVDHKAERALCRRFDLRLLPVLAVMYLFNALDKGNLGNAETDGMSKDLNFKSNEYNXXXXXXXXXXXXXXXXXXXXXKRYSPARVLPILMFCFGSFTLLSASTKNFGGIFALRWFLGMCEAPFFSLVIYYLTTFYRRGELARRLAIFYAASNIANAFSGLIAFGVFQIEG--SSIPNWRYLFIIEGGATVLFSIFAFWYLPRSVAEAK--FLSEDEKALAFHRIQVDSSAVV---NDKFRFRDALVIFKHPTTYAFLCIEI-CLGVPIQGVALFLPQIVQRLGYSTVKTNLYTVAPNVTGAVMLLLLAFSSDAARLRSXXXXXXXXXXXXXXXXXXXXDDVQAQYFATFMMTWGTSAPSVLLSTWYNNNVA--DEGRRVLLTSIGVPLANLMGLVSSNVFRARDKPKYMPALVTVAAFGATGACLAALLGCYMWFDNKRRDRRDG........................... 484
16 0.000e+00UniRef50_A0A2U3EPC9 Alkaline phosphatase n=1 Tax=Purpureocillium lilacinum TaxID=33203 RepID=A0A2U3EPC9_9HYPO  ali  18  2..................................ASPPWLLSATEGNDDGAAGDENDNEDSFAVMRSDMSGRGRKTAEDKAAIVDDGDAEAGAGVVIVSEDDAAAPASVSEEANRRIRRLLDRRVLP--------------LVCCLYVLSYLDRGNIGNAKTAGAKRDLGLDSSQWAWVLNAFYVCYVAFEW-TTMFWKFFPAHVYVSVLCLCWGAAAMSSGAARNMAHLVVARGFLGVFEATFGAGAPYFLSMLYRRKELGFRMSLLVGMSPLANTFASSLAYGITQI---RGSLAPWRLLFIIEGSLTVLFAPVAYFFLIDSPSTA--PFLSKEDKVLAVQRLQL----KDSTAKGGVKWKQVVAGFSDYKNYVHALIH-FCANYSFSALSNFLPSIVKDLGYDSVKAQGLTAPAYFAAFLVCVAASYASDRFGRRGXXXXXXXXXXXXXXXXXXXXQDAGTRYAGVWLAACGVFPALCINVTWVLNNQGGD-SKKGAGLAIFLTIGQC-SSFISSVVFPESDAPFYTKGCAIGCGLTGVILVCSLCMSFALSRENRRRDLMYGPVDPNVEVDVTNEGDAHRN........ 532
17 0.000e+00UniRef50_T0KRF9 Uncharacterized protein n=1 Tax=Colletotrichum gloeosporioides (strain Cg-14) TaxID=1237896 RepID=T0KRF9_COLGC  ali  18  2...................................................................................DVEKAGSIAHESIKEDVSQEQKDGAEHPMPQILRSLSAAEYRKTGRRATFKMDIIIMPTLMITFILNFLDRNNIAAAKLAGITEDLHLSETQYQTCVSVLFVGYIIMQIPSNMIIGKIKPGVYICCAMSLWGIVTAAQTVVKSFASLAVARFAVGFVEAVFFSGGLFYLSLFFNRRQYALRAALFYSGSQLGNAFGGLLAIAILK-LDGKYGLEGWRXXXXXXXXXXXXXXXXXXXXXPNSPDGIKS--LSETERAWVKFNYEKDQGQS-DDRSEVSARQGFVLAVRDPKTWLM--LATLYCIFTSAGVTNFFPPVVATLGYSRTVTYALTAPPFILCCATMLANGFHSDRAGERYWHVVAPLGVTLAANIIAVSTLNVGARYTAMMLMPASFYAGSTVLLSWIAGTINQPVTKRAAAIALIVSVCNTPNVWTP---YLYNGAPRYFAAFTVNLVAAGAAIVTATVTRMYLRRENRKMDDGKELGSSPPANGTSSET............. 490
18 0.000e+00UniRef50_A0A094C4B9 Uncharacterized protein n=4 Tax=Pseudogymnoascus TaxID=78156 RepID=A0A094C4B9_9PEZI  ali  20  819.............KPWIVRFLRKARGQIDLPPRVNITPITRYQTAPD---------YSISKGAEIGVAVSESGSDYSSKAVGLQKQHRGEAFAEGGS----TKFYEPIPEYEGRHRWDPTAEWTPAEEKKLVRTLDIRICSWVCLMFFSLQLDRGNITQALSDNMLDDLGLNTNQYNYGQTIFYLCFLCAELPSQLISKKLGPDNWIPIQMICWSIVAICQCRITGQSTFYATRALLGLIEGGFIPDSILYLSYFYTSKELPIRLSFFWGSYTLTGIISSFLAFGIL-HLRGVLGLEGWRWLFALEGIVTAIIGVASFFYLPPSPTETRDGWFTEREEIVMVNRVLRDDPGKGDHNRQGISFRLFWNALCDYDLWPAYLIGFTWGIPFQPVQAYLTLTL-RGVGFGTFETNLLVIPGSVLTLLQLLFWTWYSEKINSRXXXXXXXXXXXXXXXXXXXXXPSSPWAKYXXXXXXXXXXXXXXXXXXXXSRN-AGSVRTRTVGTALYNMFVQA-SSIVGSNIYQDDDKPDYRRGNKILLGIVAWNFALIIGTKYYY....................................... 1351
19 0.000e+00UniRef50_G7XYH1 Pantothenate transporter n=10 Tax=Aspergillus TaxID=5052 RepID=G7XYH1_ASPKW  ali  28  447......................................TAIEAHSDNWHLAKAAQRERTNKLLGLGRRRDSGIGELPVLEIKTGIIMAPSPATVEERAVDTSSGIVQANPKRRWVSYIWDTFDKSPEERRLLFKLDSAILTFASLGYFIKYLDQININNAFVSGMKEDLGLYGNQLNYMQACWTVGYVIGEIPSNMLLTRIRPRYWIPAMELLWTVLTFALSRSTSATHFYVLRFFIGLAESSFYPGMQYIIGSWYRKDELAKRSCIFHTSSGIASMFSGYLMDAVF-HLGGRGGLKGWQXXXXXXXXXXXXXXXXXXXXXPDVPEISSPFYLSEQEVKLAQKRMQFEGRK----DREPYTKSKLKKIFSSWHIYLLTIVYITFNNGAAGSQPVFQQYLKDSTNYSVGQINAYPTTTNAVQVVTTLIYAWTSDTIGRRWPCIIIGACINIICYVSLAVWNIPTGWKWTCYILSGAGYGLSGLCMAWAHEICTDDNEERALVVGSMNEMAYVFQAWLPLVVWQQVDAPRYRKXXXXXXXXXXXXXXXXXXXXRLQVWEGKRPKNVQAEVVDGGGRSESEGDD............ 988
20 0.000e+00UniRef50_A0A1E3Q0G8 Uncharacterized protein n=1 Tax=Lipomyces starkeyi NRRL Y-11557 TaxID=675824 RepID=A0A1E3Q0G8_LIPST  ali  19  8.....................................................................................................ETTAVPAIAPADGSQKRILLRFTKEEEKDLRRKIDRYLMPLITTLFVLAFLDRSNIGNARIAGLQESFNLSSNQFDWLLTAFYISYISFEWVG-FLWNVVPAHIYVTMCLFGWGLVASLQSVTFNYWTLFILRFLLGIGEASFAPGVPMYLSFFYLRKEMGFRTGIFMSAAPLSTAFAGTIAYFITSVADHT-PIDSWRVLLFVEGIPCMLMACIAWNYLPDRPSSA--YFLDLKDKIIVRRRIEVEGEQVSHSGSHGFKWEEAIEVLQDPKVYVTASM-FFLANIAYASMPVFLPLILRDMGYESITAQGLSAPPYLVAYVVVLLTTYLSDKRQSRAEFIIFHSSISAAGYLVLAISRDTLTRYXXXXXXXXXXXXXXXXXXXXXXNNQSSESGK-GTGMVMLNTIGQC-GPLIGTRLYPESDAPYYERGMIICSIAMFTVAILAIMLRRHLARLNA.................................. 462
21 0.000e+00UniRef50_R8BI14 Putative nicotinic acid plasma membrane transporter protein n=5 Tax=leotiomyceta TaxID=716546 RepID=R8BI14_TOGMI  ali  24  17.......................................................................................................ENADSSELALAEEGTSNIGIDPEAEKKLVRKMDMFILPVIFVTYVLSFLDRSNIGNAKVAGLPADLHLHGSQINMAVSIFYVTYILFEFPGTMLLKVVGPSKFIPILICSWSLVVTFSGFQKNVGSLVACRLLLGMCEAALLPSLNLYISMFWKREEIAKRSSXXXXXXXXXXXXXXXXXXXXXQ-LDGVGGYESWRWLFFIEGAISFAWGICAFFLYPDNP--SKAYFLNAKEKELAHIRLEPNA-------DSKVDWVQVKAAFTSPICWLSGVIQMF-ADVYNYSISVFLPTIIQGIGYKGLSIQXXXXXXXXXXXXXXXXXXXXXDRIQRRAPIMLSGSLLTVIGYSLLLGTKNADARYFACYLVVLGGNVLPCLNIIWINGNTAFQ-YKRGTALAMNQIIGN-IGGVVSGQIYLTNESPYYTTG............................................................. 432
22 0.000e+00UniRef50_A0A0U1LLB9 Putative transporter C1683,12 n=1 Tax=Talaromyces islandicus TaxID=28573 RepID=A0A0U1LLB9_TALIS  ali  15  358........................QLADSTSSDAGDTPSTSSSDPQFTPEASGTDEGSPSVRPQLGSPELPKLQTNLGKDNADAVLADETESSGSDDDDGYDSDKYFRPPPRQRNTSQIGPDYTPEEERGVVKRLDRRLVSFLAFLYMLSFLDRSNIGNAKIAGLSDDLKLSSSQYEWLLTAFYITYILFEW-MTLMYKVVPARIYIPLCVFAWGLFASCQALGASFWDMMCLRALLGISEAAFGPGVPFYLSLFYKREELAYRTGLFISAAPLATSFASSLAWLIVKIGD-SAPIAPWRXXXXXXXXXXXXXXXXXXXXXXDSPGTAR--FLTVRQRKIAKLRLQGTKLERHESSDEKFNWRAVRAALFDPTSYLVSLM-FLGCNIAFSSMPVFLPTIVKNMGYSSLAAQALSAPPFLVAFVSVLVTASLSDKSRSRSPYLIFHALLSAAAYLVLPTSLDTIIRYVCVYPAAAGFFSAITIIITWSMDNQV-THEGKGSSVALLNVVGQ-FGPLIGTRLYPDSDGPLYVRGMLVCAVSMLFVSGLAL............................................. 891
23 0.000e+00UniRef50_A0A0U1MAC0 Putative transporter C1039,04 n=4 Tax=leotiomyceta TaxID=716546 RepID=A0A0U1MAC0_TALIS  ali  17  5..........................................................................................KSTGTPSVQSAPLDPEKGANVTGTGDDSAEEYIDPKIERSLVRKFDLFILPMCALVYYTHTLDRANLGNAKTMGIQTDLGLVNNEFSLVLILFYIPYGICNIPAALLAKRFNPARVIPLMMGTWGALSMITASTKNFGGLLGVRIIIGIVEASYMPCVYLYYSLFYTRKELALRTAAWGFTGFIAGATSGLIAWDVSQ---WHRSLSGWQYXXX---XXXXXXXXXXXXXXXXXPRDTNSRWFTPEEQQVAQLRLRRE---SDREGVGKISWKAGLAVFGNWHVWAFAAMAFLC-GVGVASTSNFLPTMVKRIATSTPKANLYTVGPNLVAAAVQIVSAWLSDRYQQRALVSFCTLIVSMIGFILLATVHHTHVGYFITYLITFGTYMPELLMPLWLSSNLT-SASARAVALGL-FIGGQNIGGILSSALFRDEYQPVYKPALIAVATCQGLLLVGLLIMRQVYVTLNKKLKRGE............................ 470
24 0.000e+00UniRef50_A0A0C7C7A4 Uncharacterized protein n=1 Tax=Rhizopus microsporus TaxID=58291 RepID=A0A0C7C7A4_9FUNG  ali  26  2..........................................................................................................PDTYSVLINRDADDTVSDTEAEKKLVRKLDTRLLPFLSFMYLFSSLDRSSLGNAVLDNFEEDVGITPDQFNTCVTIFYVGFLIFQIPSNILLKRFTAKRWLPFLMLLWGTIACLHATVRNYTQLLIFRFLLGFFEAGFFPGVIYFLTLFYKKNEMATRIALFWGSTVAAHAYAGVLAYGILQ-LRGSGGLTGWQWLFLIEGIPTVLVSVIAYFYLPSSPSTWTV--LTAEERILAVSRLEHEDNRHTHADLDASNKKQAVKALTDWKVWMYMLM-FFCGSVPNTSVSNFLPSIVRGMGYDKLSANLMSGNIYA.............................................................................................................................................................................. 314
25 0.000e+00UniRef50_A0A2P4IVE8 Putative transporter n=1 Tax=Quercus suber TaxID=58331 RepID=A0A2P4IVE8_QUESU  ali  17  34...........................EDTDPEHQVDLDELEAYELQTWVKRADPGHVAQHTDSVGQDMSXXXXXXXXXXXXXXXNYGSE------DDVDTGRVTLRKYKRRRRASVQSFELYTPDEERRVRRKLDTRLVLFVAMLYLLAFLDRSNIGNCKVAGLTNDLHLSDEQFEALLTAFYISYILFEW-MTLCYKIFPPHIYISCCVCAWGVLASLQSLASGFGYLLALRALLGIGEAAFV-GIPFYLSFFFRRDELALRTGLFISAAPLATTFASSLAWAITRFGEGT-GIAAWRLLFLLEGFPACLVAMWAWYWIPDSPSTA--LWLTSRERKVAKLRMRQEQISKKHDHKQKFQWREVTKTLMDPVCYLTAIM-FFCCNVAFSSMPVFLPTIIHEMGFSTLQSQXXXXXXXXXXXXXXXXXXXXXDRIKSRSIPMMAHAFVAMLGYVFLAVAGSFQARYISVFPICAGFFSAVTIIITWTVNNQDSDEGK-GTGMAILNVVGQ-LGPLVGTRLYPDKDGPYFVKGMSXXXXXXXXXXXXXXXXXXXXMRKNQRMRREALLPGEDYKAD.................. 582
26 0.000e+00UniRef50_W3X9K4 Uncharacterized protein n=50 Tax=leotiomyceta TaxID=716546 RepID=W3X9K4_PESFW  ali  25  1............................MSGPALEVAAAKTAEQGQVPVLAAAVRGDTKVSGDSIHAATTAVSDGDNQSSTMSGKTAAGDATSPA-------------SGSGSGGWFHWHEPGTSKAEKKLIFKLDWFLLSYSCLCFFIKQLDGNNVTNAYASGMQEQLGFGGNELSWMNTYFNIGQIIGAPFANMIITVVRPRYWLPACLMTWSAFVLGMYRCETAAQFYVLRFFIGLFEGAAWPGITYTLGCWYRKSEMARRSALFVMSGVLGQMFSGYLQAALYTGMDGKGGXXXXXXXXXXXXXXXXXXXXYGLFCFPDTPHKTSAWYLNSWEREKAVERIDSEGRKPI----GKLDLSVFKRIFTSWQVYAFTLGYLWSLTVGSYVMQYFTLYLKATKEYTIPQINNIPTALGAVNFVTMLTTGFVSDKIGRRGPVCLAVGCVLIFTYSIFTAWNVPHRLLMAVFILNGVYGCYTPLLAGWVNECCGGDQQKRAFILGLMTSVGGAVVIPFQQLQFPSSQAPQFKQTHGWPSALAFVIALTCLGIPLLQRRMEKQAKRNEAEHE........................ 529
27 0.000e+00UniRef50_C6H3F1 MFS transporter n=5 Tax=leotiomyceta TaxID=716546 RepID=C6H3F1_AJECH  ali  19  1..............................................................................MAITNYAEKDAVVSADIGEEKMAHSEAVPEKDVAVNRDYAGAAPKTDPAEIRLVRKLDFRIMPMLVVMYFLNYIDRNTLAQARLDNLEKELGMEGYQFNTTISILFVGYVLMQIPSNMLITRIRPSIYMSSWMIIWSIVSACTSLVKSYSGMVVCRFLLGVTEAPALPNAHVSIT------EVAARIAVLYCAQILATGFAGLIAAGVFKGLDDARGLSGWR---------------------------CTTRWLNTSERELAHARIERD--KMGEESAKISALEGLRQAVRDKRTWIFCLMQNFHLAACC--FNSFFPTVVKTLGFPKTETXXXXXXXXXXXXXXXXXXXXSSGRHHERTWHITGGLSVAIVGFIIASSTLNTAGRYVACFIFPMGAYSVNSVVIGWVSSTLSQTREKRAVVLAMHNVAGQ-IGYIYGAYVWPNYDRPRFXXXXXXXXXXXXXXXXXXXXXRTLLKRENRRLKEVTGDTIVNYYGY.................. 467
28 0.000e+00UniRef50_A0A2A9NEH5 Uncharacterized protein n=1 Tax=Amanita thiersii Skay4041 TaxID=703135 RepID=A0A2A9NEH5_9AGAR  ali  21  1...........................................................................................................................................MSILILIYILNYIDRNNVAAARLQGFEEDLHLQGKQFATILAVLYIGYVLMQVPSNLLLNHIRPSLYLPLCMTIWGALSVSTGFVTSFWGALFARFLLGFVEAAFFPGALFMISKWYKRSELSTRMALLFSGSVISNAFGSLIASGILTVMDGRLGFAAWRXXXXXXXXXXXXXXXXXXXXXXDFPET-NAHWLSPAEQELARTRIADDAVSQQATGQKPQEASGFKLAMADWKVWWLTF--GLTAMVSGLSFHTYFPTLTATMGYNATITLLLCAPPWIVSSICILLLSIHSDKRQERFWHVAFSLSVGCIGFLIAMLSMNTLSRYVSLFLMAQ-MHGAFVCFLAWVSESVPHPVSKRAVALAFVNCVSQ-LGNVIGMYIWPLSWGPTYRKSYAICVTMAVLCMFTSYVYHV......................................... 412
29 0.000e+00UniRef50_A0A1Y2AK71 Retrograde regulation protein 2 n=1 Tax=Naematelia encephala TaxID=71784 RepID=A0A1Y2AK71_9TREE  ali  17  3..................................................................................................TDRDEEEKGAEHNVSAVVDDTLPQWDEARKRKLYRKVDLHVLPSLIILYLISFIDRGTLANASILGIKTDLHLDTTKYNLVATVFLFTYSAFEIPANAVLQKVKPNXXXXXXXXXXXXXXXXXXXXKNYAGALVARIFLGVAEAGFFPGAVFLVSLWYPREQLQFRISVFFSMGSLAGAFSGLIAYGV-AHMEGKGGLRSWRWLFILEGIFTCALAPCILWILPNSPESSK--WLDEEEKAYLRS---VSVLAGGGGTHVPFQKEHLYAALKDVKIWLCGIMGM-GTTLPLYGFSYSLPTVLVQLGYKAEIAQXXXXXXXXXXXXXXXXXXXXXDKIGRRAPGVLVSFSLALIGLAAEWGLPKTGVRYGCLFFIPAGLYAALPGSLSWGSNNAA-PRGKRAMATALQLTVGNISAAI-GTNVFLGKEAPNYPXXXXXXXXXXXXXXXXXXXXXXXXNRENKRRDGMDINAIQATYSDAQLEAMGDKSPL...... 485
30 0.000e+00UniRef50_A0A2R6S5H9 Uncharacterized protein (Fragment) n=1 Tax=Phlebia centrifuga TaxID=98765 RepID=A0A2R6S5H9_9APHY  ali  19  122................................................................................................................................RTVWWKMDLYILPIATLIFFLSFLDRGNIGNARVAGMQKELNMTNNQYSIALTVTYVPYILIELPSNLLLKRVGPNKLLPAMLTLWGIVTIFQGFITTYAGLVICRFFLGLFEGGLLPGLALYLASFYPRQKLQFRISVFFASSSLAGAFSGLLATAIIR-MEGVGGKHGWAWIFILEGVFTVFCGIASFFLMSATPDTAS--FLTQEEKEFIDFELRRDGVRAQKSSDDEFSWAEVRKAFRQPHMLIMAIAGFLNGTTVIRLYVSFLPTLP-------------SVPAGLLHGLVSIITSFLSDLYGRRXXXXXXXCLVMLAPFIMVAGSEDSQVRYGSLFLLLPGTYCAAPPLSAWIANNAA-PHVRRATALAFLTTMTNSGGILSTWLLGSLSAAPKYTKASVTFLIFQVGILVCAQLNLGYLMMRNS---EKTVIRQSLLDRNEEQGGLGDES........ 588
31 0.000e+00UniRef50_A0A0D2GJ38 Unplaced genomic scaffold supercont1.3, whole genome shotgun sequence n=6 Tax=Herpotrichiellaceae TaxID=43219 RepID=A0A0D2GJ38_9E  ali  18  2............................................................................................SSEPKTMAAVPLHIEEGVKLESDIAEVNEQEKLATEKVLNRKFDFRILPCLFLLYFFSFMDRASIGNASIAGLNADLKLQGQSYSVALALFFICYLIVDLPAGLVFKIIGPRPFLCISIFLFGTCTICLGFVKTASQLYAVRCLLGLCEGGLTPCIAIYMGMFYPPDHLQRRLAVYYCAAPLSGAVGGLLASGLGKI--QVGSYRHWPXXXXXXXXXXXXXXXXXXXXXPNMPGQSR--FLTEEEREVARIRSKISRTVDVNHEQEKFTWAAVKLGLLDWNTILLSTISIGTY-CNIYAYSLFSPAIIKSFGYSTIQSQLLSVPPYIFGTICVFMTSIAADHVHIRGPFVLGPCCVEIIGWIIQMTCKGVAVRYFGLFLVAGSIYPIINSTTSWLIGNLQ-PHYVRATGMSFAVTLG-TTGGIISTFTYANA---KTNVANGVELAMTVMVVALSVLLMWLNHAENKLRARGGRDYRLNEGVSAAQLGSRHPD........ 485
32 0.000e+00UniRef50_J6F1T8 Uncharacterized protein n=2 Tax=Trichosporon asahii var. asahii TaxID=189963 RepID=J6F1T8_TRIAS  ali  16  9.......................................................................................SESPGSLDLEKKEEFQVEAVTSAAMNEDDIAFLASFDDKRKARMYRKIDIRLLPMLALLYLFAYIDRANIGNAKIEGLTVDLHLDGTKYNTCQSIFFVTYILFEIPGNIILEKFRPSFYLSALTILWGTCMTLHGVVQNYGGMIAVRLALGICEAPFFPSAVFLSSVWYPREMLNSRIALFYTASAMAGAFSGLLAFGIAK-LGGVGGIASWRXXXXXXXXXXXXXXXXXXXXXPDTAETSK--FLDADEKRYMALMGTAQDTSAGDGDHEKVSWSVFKSVITDWQLYLQGIVY-WSNTVPNYAMKFTLPTILKTMGYTNANAQLLSIPPYVVGATTACLAGFFSDRFRKRXXXXXXXXXXXXXXXXXXXXXXXEGPVYMSLCLVCAGVYPIGPGCNTWTANNLAGPA-KRAMGVAFVISLCN-VGGIIGGYIYLDREKPHFTTGYAASLGFAAAGVLAALTLEFAFTRINKKREAMSKEEIDAKYAPQQLAQMGDRSP....... 538
33 0.000e+00UniRef50_A0A1C1D005 Putative transporter n=2 Tax=Herpotrichiellaceae TaxID=43219 RepID=A0A1C1D005_9EURO  ali  19  1................................................................................MDSELSSDRKLSVGDRKVSITEDGVVPVTSVGDGRTMSASVAIDPAAERRLVWKFDLRILPTLAIMYLFNALDKSNLGNTKTAGLEEDLGLKGDDYNLILSIFFVPYVLSGPFVGMASKRFGPSRTLPLMMICFGFSTLMVVAVKNFGGLLACRWFLGMAEGGFFPSIIFYQTLFYRRGELARRLAIFYAASNIASAFGGLLSFGVFQIHSG--SLANWRYLFVIEGACSMLFSLFAFWVLPYNAQSAK--FLTEEEKQLAFYRIQVDSSSVVDEE---FNLRSALAIFKHPTSWIILAIE------PGRALA----------------SNLYTVAPNITGAVMLLVLAFASDYTRWRXXXXXXXXXXXXXXXXXXXXXTQINVAYFACFMMTWGTSAPSVILDVWYNNNIA-DENKR-VMLTSVGVPVANLMGVVSSNIFQNRDAPKYLPALVTTATFGAVGCLLTLLLGAWMVADNKRRNRAGGNKVSARDVPTELLRDG........... 478
34 0.000e+00UniRef50_J5TER9 Phthalate transporter, putative n=18 Tax=Trichosporonaceae TaxID=1759442 RepID=J5TER9_TRIAS  ali  16  1.......................................................................MATTQQQVPDSNASSGIDSEKQSIQYVEDRDMKNELEETGYIRTYADIDEGFDPKEVRRIVRKVDLHLIPILAAMYCISLIDRTNLSMARSANMNKELSLDGNYYSVATMIFFIPYIILEIPSQLGLRKYGVRXXXXXXXXXXXXXXXXXXXXKTPQQLIATRALLGIFEASLFPGAAFLIACWYPRKSMATRNTAFYFTSTAIGGLSSILAWGISQ-MNGTANMAGWRWIFIIEGLLTICIGVVAYFFLQDFPD--KATFLNEHERHVMVTRIQRDRG---DATPDPLTLRKALNYLIDPKIWLFSIM-FAGTTLASYSMAFFLPTILQQMGFSNALSQILYAPPKIWGIFPGIAIAWWSDKTHQRAAGIVLNAILLIIGTCMFLGNDQKVARYAGTWLAFGGATGNVPLIIAWAQTSIR-EQSKRGFNXXXXXXXXXXXXXXXXXXXXESEAKAGYPTGIWSTIGFNAFVAVMALVFKVWMTIQNRRADRGDVVLEGHPE.................... 500
35 0.000e+00UniRef50_A0A2J6TGA4 MFS general substrate transporter n=2 Tax=Meliniomyces TaxID=313358 RepID=A0A2J6TGA4_9HELO  ali  16  1..............................................................................MAIEPNLKYPSESRTSVDKPVGDVDLVENLPSQNVPHFYVPRTPQEAALDRSINMKLDFIVLPLLAFNFMLCGIDKTNIGNAATTSFAKDAHLKPNDISNAVSLLSVTFVTLQPLSTIIGRRVGVKYWISFMMVAWVSLCMAHAGINNREKLIALRLLLGAAEAGFVPSVFFYLSTWYPKYHLGFRLGLFAGMYSIAGAFSGLIAYGVFKIHSSK--YKSWQLLFMIEGGITIFAVLITFFALP--LKQTSAWFLSKAEREHSLHRMEVDQDGNAIKDTRMVSMRDVKAVLTDWKKLLTVVFNIL-ATLPVSAFGTFLPLIVKGMGYSGVQANLMSVSPFVVGAFGLFIFVYSSDHFHERSLHTVTSMALALIGLIVMYTSSDPHLRYGFTHVCLAGAFSAGPLIVGWLANNTPGP---RSLIIGI-NGYSNIAGIIAG-QLFKAQYAPSYGYPLKITMILIGVGMLGFLGMRGAYMYENRWRAKQIAGWDEEQRRAEDRGENG........... 504
36 0.000e+00UniRef50_W2S5F2 Uncharacterized protein n=4 Tax=Dikarya TaxID=451864 RepID=W2S5F2_9EURO  ali  20  1................................................................................MAVSKVPDSFPAEKELVHQEKVVTSDNPAETHYYEQFVNNGEWRSDFEKKLVRKVDWRLIPLLIIMYLNNFIDRAALGQARLSTLEEDLGMSGTDFNLSISILFVGYLTMQLPSNLLITRVRPSLYLGVTMAVWGAVCACTAAVQNLSGLIVVRIFLGVTEAPFFPGAIFLMSSWYTRTELTRRIAWFYGGVALANMFGGLIAAGVLSRMEGAMGXXXXXXXXXXXXXXXXXXXXXXXXXXXNFPKNTK--WLTEEQQAYAQWRLKQDAEEEDDSGSTSL-WQGLKLCLTDYRMYIFMLMQHL--SILSQTFQYLFPSIVQTLGYGRIETXXXXXXXXXXXXXXXXXXXXXADRFTDRSIHIMCLLGVSAIGNAIVGSTLNVGARFFGXXXXXXXXXXXXXXXXXXXXNSFIRPMVKRSSAIAICNAIGNCAS-IYGTYFYPSAHEPGYTPGSAANAGVCVVVALLALSLRFIHKWENKKLGRVEREGFSGEE.................... 488
37 0.000e+00UniRef50_A0A2H3I719 Major facilitator superfamily domain, general substrate transporter n=1 Tax=Penicillium occitanis TaxID=290292 RepID=A0A2H3I719_9  ali  22  11....................................................................VEGHHAHEAKVLSTERIQSHDDVSNVAVPAFITRNVEPDVVAIVSRMSQSR----RSETEKRVKLKIDMFLFPLLLLFYILNYLDRGALPFVRLVGIEDELNLTGVQFDTCLSILYVGYCLFQIPSNLILSKLKPSLYLPACMIIWGVVSGTTAAANNYTSLVTIRFILGVVEAPFFPGAIFLISSWYTKKEMAMRCAWLYAGNFLSNAFGSLIALGVTETLAGAHGLSSWRXXXXXXXXXXXXXXXXXXXXLPNYPHNTR--WLNPEERAVAIYRLVEDRGEMTDFEDADIGWEGFMQAVRDYKTWIIAANHIF--ITTGAGLVVFFPTVVGTLGFSTRITYVLSAPPFLLAVVTTIYTCHRADISGQRSYXXXXXXXXXXXXXXXXXXXXNTGARYFSLFLITSVMWVSYNCNLAWISDCMPRPIQKKAAAIGIVSMLGQA-GNIIAGYIYPKNQSPRYXXXXXXXXXXXXXXXXXXXXFREVLRRENKRLDQRDQNELGNQYTNEAGKK............. 514
38 0.000e+00UniRef50_A0A1C7LLZ0 Putative transporter C11D3.18C n=2 Tax=Dikarya TaxID=451864 RepID=A0A1C7LLZ0_GRIFR  ali  19  8........................................................DNAIQKPRPDGTVSRSSSLGLPKWSQRSSVYQAKGSTPSSQVGGDVEKQYNRAPSASAEGGDYKTRFPHIDEAKVIRKIDCRVVLVLCLLYLLAFLDRVNISNAAVFGLKTDLKLGGNEYNIALVVFFIPYIVFEIPSNALLKHFKPHVWLSICMFLFGLITILQGLTQSFSGLVAARFFLGIVETGVFPACFYLIAIIPKALLILVRV---------------YLARGRIRRSPGQCYREGWHWLFILEGAFTCVVAAMLYFAIPDFPEEVK--WLTAEEKEFVKARLYEDVGDSRTH--EPLNVRSVLDVFKDYKIIVGGFMY-FTILVPAYGYAYFAPTIIQGLGHSSIRTQLLSVPPWGCAFVLSMIVATASDYFKHRXXXXXXXXXXXXXXXXXXXXHHNTKLQYAALYLAAIGMYSAMPITVCWFNTNLGG-HRRRAVGTAWQVGFGN-FGGIIAVFTFLAKDAPKYIHGYSICIAFLCLFVLVNVVYFFGVTFENRMRDRLQA-SGASVLSEDEKKCMGDLNP....... 528
39 0.000e+00UniRef50_A0A137PFB0 MFS general substrate transporter n=8 Tax=Conidiobolus coronatus (strain ATCC 28846 / CBS 209.66 / NRRL 28638) TaxID=796925 RepID  ali  19  34.....................................................................................................................DIDFSEKSEEEKGLLFKMDCRIIPYISLLYLFSFLDRVNIGYARLYKMEEELHLNQFQYGWSLSIFFISYVIFEVPSNLLLKKYSPSXXXXXXXXXXXXXXXXXXXXKNFAGLMAGRFFLGMAEAGLFPGVLYYLSFWYTRRDIGFRLALFCSSANLAGGLSGLLAY-TMSKIDGTXXXXXXXXXXXXXXXXXXXXXXXXXXXXPNSPSTAK--WLNQTEKFYVVQRLLEDHR---DPTNKSFCKKQFLESFVDYKVYFHMIIH-FGLITPLYCVAQLLPTIISQMGFSKLTTLLLTAPPYMVAVITNILLCRHSDKKMERGMHLCVPILVSITGFMMMIFIKSKYGRYAGSCVTVIGVFTAGPISLTWMTNNMVGS-TKSATASALLVSYGN-IGGFISGMMFRSSEAPRYTHSLIANIGFLVSSLIAILLYRFLLIRENSKLDTKLKDPNYD...................... 480
40 0.000e+00UniRef50_A0A163HHQ1 Metal ion transmembrane transporter n=1 Tax=Didymella rabiei TaxID=5454 RepID=A0A163HHQ1_DIDRA  ali  22  1................................................................................MTKFSRDADTPPASASEQDNEKSVAPSKIEDGTAQATASAASIDPEMEKRVRRKLDRNLIPLVSALYLLAFLDRSNIGNARIAGMEVDLDFQDGHYDXXXXXXXXX-XXXXXXXXXXXKVVPPHYWAAFCVFTWGLVSTVQAAANSWGAMMALRFIMGASEVAYGPGIPFLLSFFYLRSELGLRSGLFLSAAPLANTFSGALAYAITS---GKPALAKWRVLFLVEGLPTVVMAVVAFFFLPDSPEKAR--FLNEEEKEVARARGVRQAGAAT--RLGAINIREFSTGLADPKGWILGLMYFSC-NVGFSSLPVFLPTILKEMGFSSVHAQGLTAPPFFVSFLTVIATTYVADRTQQRXXXXXXXXXXXXXXXXXXXXSHSVGARYXXXXXXXXXXXXXXXXXXX-XXXNNQGSDTRRGAGIVILNVIGQC-GPVLGTRMYPKSEGPYYVKGQSVCAAFLFFCCFLALTLRTLFVWENKKLDQKYGTVGQQRLAMQEAAARGEGEDL...... 496
41 0.000e+00UniRef50_A0A0G0ATU5 Major facilitator superfamily transporter n=1 Tax=Trichoderma harzianum TaxID=5544 RepID=A0A0G0ATU5_TRIHA  ali  18  5.............................................................................................EKPIEEQRDDVETVSFANERDEYKHLLTKFDTKRQKELLRKIDWRLLPVLTVFYLISFLDRSNIGNARLQGLEADLHLTPSQFNWCLTIFFFPYGLFEVPSNLGLKFTKPSIWLPEIMAIWGVALMCMGWTQSYSGLLAGRFFLGVAEASLFPGVTYLCTTWYLR---------------LAGSFYGLLAYGI-GFMHALASIP----------------------FIYDTPDDVK--WLTDEEKRFIKLRLQFDGHESGYKEPE-FKMKYLKQAFGDVKVYLGCIM-FFTISTGTYSLSYSLPTTINLLRYTAANAQLLTISIYAFACIMCVLNAIVADKIQKRFQXXXXXXXXXXXXXXXXXXXEKPGVIYFANFLVASGLFPTIPGIVCWISNNWAGQ-WKRSIGMALEFTLGNMIGGVVGSNIFLSREAPEFRTXXXXXXXXXXXXXXXXXXXXCLLLWANRADERLIESIPAGDRQDEERKDDGDKS........ 458
42 0.000e+00UniRef50_A0A1Y1ZR09 Major facilitator superfamily domain-containing protein n=4 Tax=leotiomyceta TaxID=716546 RepID=A0A1Y1ZR09_9PLEO  ali  23  11....................................................................................................EKESAFPVAEKVEIINDTAGTNIDAEAERKLLRKLDLRVLPPLFVLFLLSFLDRTNIGNAKIQGLTEDLKMKGSDYNIALFVFFVPYILFEVPSNLIIKKXXXXXXXXXXXXXXXXXXXXXXXXXTFGGLVALRVILGFFEAGLFPGCVYLISMYYKRHELQWRXXXXXXXXXXXXXXX-XXXXXXXXKMDGIANYSGWRWIFILEGLLTVVLGIVAKFWVVDWPETAT--FLTGDERALLIARLSADSG---DAVMNRLDKRAAKRIFGDAKVWLGTLAYFGIVNTG-YAGSFFIPTIIKELGYKSSAAQVRSIPIFVVATVTAVLTAWLTDRARHRYTFCMVGLAISSVGYIMLLAQAHSAGVKYFXXXXXXXXXXXXXXXXXXXXXNLMSGHYKRSVSSALQVGLGN-IGGIVASNVFLTREAPRYRTGYGVSLGMLWICGAACTALFVLVKRENGKRERGERDYRLQGQ---DADNLGDDHP....... 486
43 0.000e+00UniRef50_A0A1J9SM77 Fad-binding domain-containing protein n=1 Tax=Diplodia corticola TaxID=236234 RepID=A0A1J9SM77_9PEZI  ali  17  781...........................................................................SRSSYTKGADMQHAKSGSVEDVEKIETTTPLPDDLPLPECLAHLNSDELRQLEKSLVRRLDCTLLPVVLLLFLLNIIDRNNIASAKIVGITETLNLTNNQYNTCLLLFYVGYVITQVPSNLIIGKVRPSLYICSITSAWGVISMCQGFTKNFAGLAVTRTILGLVEAPFLPGVFVLMSCWYKRSELPVRIAILYGGNMLATAFSGLIAAGITSRMDGKAGRPSWEXXXXXXXXXXXXXXXXXXXXXPDYPLQSPHRWLSPPHQSLAEHRIRAENAGIPDTDPSSALW-GLQQALLDPKLYAFTLQQM--SLITAQSFNNFFPSIVSTLGYPPTTTLLLTAPPYLLAFLASLLVSLHASRRSERGLHIAACLAVALLGNLLAMLAPGVPARYAATFLMTAGAYAPYNLCVAWLSASLPRPRAKRGAALAVVNFMGAGVAHFYTSYMFPDSQKPRYYAGGGVMSGACVVAAAVAAGIKWHL....................................... 1256
44 0.000e+00UniRef50_Q2UJ11 Uncharacterized protein n=9 Tax=leotiomyceta TaxID=716546 RepID=Q2UJ11_ASPOR  ali  21  17.....................................................................................................ENPKDQDLRSVPTALLDWSPEERRQREKALVRKIDTRLLIIMLVMYILNYLDRNNIAAAKSAGLQDDLNLKGEEYQVCVSILFVGYLLMQVPSNMILNRSGPSIYLPGCMVVWGIISCLTAVTKDFGGLLAVRFSLGFVEAAYFPGCLYFLSAWYTRKELVERTALLYVGSLISGAFSGLISAGITSGLNGARGIAAWRWLFIIEGSLTTFVALLACFIVPDLPRTTS--WLSNDEKVLAAWRLEEDIGEDDWVDSEHQSMHGAKLAITAWRLYIIRCRNHFFSKVRDPLLKNFIASVMAGLGKDNIDTLLLTTPPCLIGTIIVLIHAWDADGTGERYLHLCLPPTFAIASFILYMAGNNFAARYVAMSIMPGSIYASYVVALGYISNSN...................................................................................................... 421
45 0.000e+00UniRef50_A0A2I2F3N0 MFS general substrate transporter n=4 Tax=Aspergillus TaxID=5052 RepID=A0A2I2F3N0_9EURO  ali  19  25.............................................................................................................PSSDAVDEFADEKATQALNRRLVRKMDAAFLSVMVLVFFFKRVDKSIIAKAKLSSFERDLNLHGTQFNTAVSMAAAGYLITIIPSNLLLTRARPSIYLPCCASLWAIVAMATAAAQNYPQIVALRFLLGLCEGPYSPGCIFVLSCWYTKEELALRNAILAIATPLSSAFVGLISAGVFSKMEGVHGWAGWRXXXXXXXXXXXXXXXXXXXXXPDYPESSTGWLLTPVERRWAIERMRRDRV----AHPKSTVLAGMKSALLDYRVWLLALVS--CCHRSATGYSTFYPSIVKAMHLNTYVTLLCTAPPYLLGAIVSCLVSWSSDRFHDRSGHMMGTMTVVTIGFIIHIAVENRPVQYFASFLYIPADSATNALPRALIATAAGQTPEKRSCAVAIVEVI-TSLSEVWSSYFFQNNDAPRYIKGMVILVAFSVVCILSAGLMRWILWRDNRRLQAR............................. 476
46 0.000e+00UniRef50_A0A072PW12 Uncharacterized protein n=2 Tax=Exophiala TaxID=5583 RepID=A0A072PW12_9EURO  ali  18  16....................................................................................THHEEEQIVSNSGHWDENSPVKNEESQAMQEHRATVGRFSPQDQKRIIQRIDWRIMPIVGAMFCICLLDRANLGAANIAGMAQELGLNGMRYSIITLVFFPTYIVFEIPATLLIRWVSPRXXXXXXXXXXXXXXXXXXXXHEWQVIAGLRAILGILEAGFFPGCLYFLSTWYTRYEMHKRYSMWYFIASTLTSCGGILAYGLMQ-MHGTAGLAGWRWIFIMEGVITAAVGLAGYVFLVGFPESKKRYFLSDAEVSFVLARINLDRN---DAEITSFNLREFLLHTFDLKLWLFGLIYCFTLVVG-YSFAYFLPIILYKLEFSLAAAQCLVAPPYFLGGLVMLGQGWLGDKYKTRAPIILFNCLLTLVGLPVMTWSRGASSQYVGVFIAVIGANSNIPAAMAYQANNIRG-HWKRAFSSATFLGGVGGVGGIAGALVFRSQDAPTYLPGIYACITTQVLTAMIVIYLSWRFRRDNKAADVGAKVIEGD...................... 502
47 0.000e+00UniRef50_A0A0C3PBS4 Uncharacterized protein n=2 Tax=Pisolithus tinctorius Marx 270 TaxID=870435 RepID=A0A0C3PBS4_PISTI  ali  17  12...........................................................................................................EVKGTSPKLLDNSPERDSSAERQLRRKIDSRLLPVIVFLAIMSSIDRIVISFARLEGLQSDLHLTDIQYDTVLATAYALYCPALVPSNMFLHRTRPSIYIGCCAVLWGITSGLTGLTKDYHSILACRVLLGVPEAAFYPGCSYLLSRWYTRKELGLRSALLLSGSMMALAFGGLLAAAVLATLQDKFHLAAWRWLFFMEGTATVLVGILSMWLLPDYPHNTR--WLNAEERRLAQLRLAKDVGEADMDSEEASIFEGLRLAMKDTKAYLFMFLAFVLSLAA--SFLNFFPTLTATLGYSTTITLLMSAPPWVLPTILGTVNAWHSDRTGERXXXXXXXXXXXXXXXXXXXXXXXXXXRYFSQYLMTI-RFTSDMLFIAWVANAIPRPPGKRSVVIAL-TIGGGNAGILAGSYIWKESWSPQYRXXXXXXXXXXXXXXXXXXXXRTMQIRENKRLEHLEVD-ELEKDARERIEKAAELEGMTFDDA. 490
48 0.000e+00UniRef50_F9F2Y7 Uncharacterized protein n=5 Tax=Hypocreales TaxID=5125 RepID=F9F2Y7_FUSOF  ali  22  2................................................................................................DTKDHKEDGIIDDTYAEGTGEETVLEVDHIAERQLCRKFDVRLMPVLAIMYLFNALDKGNLGNAQTVGLSDDLNFKPNQYNXXXXXXXXXXXXXXXXXXXXXKKYGPARVLPILMFTFGSMTLLAACTQNFGGMFALRFFLGMAESGFFPLVIYYLTTFYRRGELARRLAVFYAASNIANAFSGLLSFGVFQI---DSKIFVWRYLFIIEGSASVLFSIFAFWYLPRSAAQAK--FLGEEEKALAFHRMQVDSSSVVQ---EKFNFKDSIKIFTYPTTYCFLLIEI-CLGVPIQSVALFMPQIIQRLGYGPVKTNLYTVAPNVGGAVMLLILAFSSDFLRIRXXXXXXXXXXXXXXXXXXXXXXDVQAQYYACFMMVWGTSAPSVLLSTWYNNNIA--HEGRRVVLTSVGVPLANLMGLVSSNIFRENEKPKYPTALITTACFGACGCLIAGVLGGYMVLDNMRRNRRAGRKTTAADVPTKRLRDGPAVP....... 484
49 0.000e+00UniRef50_A0A1A5ZZV9 Uncharacterized protein n=3 Tax=Tremellales TaxID=5234 RepID=A0A1A5ZZV9_9TREE  ali  19  1....................................................................................MTTEIAPIEMEPKAAIDHLDIVEKTPSNLDGTTDNGPSYTSEESKKVRRKMDFYILPVLCLMNICAFLDKANIGNANTAGMSKDLGITKSQYNFLLTIFYVVYTVCQ-PEMLLLKFIPPKLFLTAIVTLWGLTSTLQGVTSSYGGMIACRVVIAALEAGGGPAIAFYFTMLYPREEFGLRWAIFQASSCIANAFAGAAAYGLVQA---KTSITPWKLVFIVESTPTFLSAALIFLFLPSAPD--RCAWLNTRENEIARERVER---SQSKESHGGYSIAGFKAALSEPWTWIIAIIHY-CGGMAFNSLSVFLTAIIRDMGYTSINAQGYSAPPYIVAYIIAITVAFYSDRLSIRGXXXXXXXXXXXXXXXXXXXXGPRGVRYFAAYITVIGVYVGQPLMFSWCATN-ADTTSKRAASLVLFLITGQ-LGSITGSNIY--NDAPRYHKGNSICAGGLFLSCILCFGGTFYLKYRNKKKDEKFGVP--EPGVIVEPTSDGSDHP....... 486
50 0.000e+00UniRef50_E4UVS6 Uncharacterized protein n=142 Tax=leotiomyceta TaxID=716546 RepID=E4UVS6_ARTGP  ali  18  24...............................SESMLTPGSSSTAWANEDVTSTSMSGRGVGLKRLETDIPNEDDRLDISPARAEEADDERDGEDDEVEDSRNERYRDNPGREVEDDLESLNSYTAEEERNVVRKFDKRLTMFLSFLYMLSFLDRSNIGNARIAGLMEDLNLSSGQYEWALTAFYVTYICFEW-MTLMYKILPAHIYIPICVFSWGVLASMQCLVTSFWQLVFLRALIGVSEAAFSPGVPFFLSFFYKREELAFRTGMILCAAPLATSFAGSLAWFIVWVSEN-GPIAPWRALFLYEGFPSIIVAFIAWSYIPDSPGKAK--YLTPRERKVAKLRLKT-GKPKHEIKKARFDWGEVGRTLCDPKSYLTAFM-FLSCNVAFSSLPVFLPTILHDMGYSKLTSQALSAPPYLFAFVVVLMTASLSDRHRSRXXXXXXXXXXXXXXXXXLPTSVHILIRYXXXXXXXXXXXXXXXXXXXXXXDNKPAGEGK-GTGMAILNVIGQC-GPLIGTRLYPDTDGPWYIKGMTVCSLFMLLVAILAFSLRILLQRENRRAARETALDREEDSMLRADEQDGATERL...... 595
51 0.000e+00UniRef50_A0A163IRP8 Uncharacterized protein n=1 Tax=Absidia glauca TaxID=4829 RepID=A0A163IRP8_ABSGL  ali  20  195...............LYWR-IKSSESTYDLSKEQNLSVDTGNRSTFDKTLPPFVYLTASLTLWDHQNGYLAISTSRAMAQDLRQEINMSKDDVQVVKIKSDLSSLHEFVQSTETQSIHEEEDDLIAREKALVRKLDRRIMPILTLLYICQRLDLSNIGNAKVAGLQKDLSLDDSQFSWVISIYTLGVMAMQIPSNMMMERSRPSIFLSAIVSVWSVVSIMTCFVKDFKTLVVARFFLGIAESPYFPASVFLLTTFYKPREIAVRNAVFYCGNWLSGALGGAFAGAIISGMEGVGGMRGWRXXXXXXXXXXXXXXXXXXXXXXDYPSNTK--WLTEQERDLAIRRL------GHAAPKEKFSWDGFKAALLDYKVWVFIII--FMAIQTGGQMNYFMPTFIQNVGYEGAMVQXXXXXXXXXXXXXXXXXXXXXDRFQVRSVFIAFCMCVALVGYVIQVTSENHAVLFFSLFLCGGGVWSSLGVSLAWLGDCVPGPRQKKAVAFALLNCISQ-LANFYAPQLY--DDPPRYLKANIVILTYMGVGVVLCFGLRLLLNRANHRLDDKYGKPLVSKNT................... 739
52 0.000e+00UniRef50_J4UH45 Uncharacterized protein n=3 Tax=Trichosporonaceae TaxID=1759442 RepID=J4UH45_TRIAS  ali  18  1..............................................................................MSQRPEPELAVTTLEPSWPEDEKAGHGSFSTESKGDAGDVVAQPRDDAELQRALRKVDRRLIPPLAILYLFSYLDRGSLANASIFGFKEDLGITTQKYNLIATVFFFTYGGMEVPGGIILSYVRPSXXXXXXXXXXXXXXXXXXXXQNFGGAIAVRLMLGVTEASFFPSALVLVGNWYPRMQVQTRISAFYVIGVFSGAFSGLLAYAI-HYMDGVGNLASWRXXXXXXXXXXXXXXXXXXXXXPDDP--TRSKWLTASERDA----ILANRAAEGQASKQHFEWKYLRQVVCDYKVWMCTWLA-GSVNIVVFGFSYTLPTILVQMGYKAANAQLLTIPVYCAACICTFIAGLYSDRRQRRSDMIVVGFSVALAGLIMLYCLPIPGVRYFACCVLMSGIYMAFPGSLAWNSNN-AETAGKRNISMALQLTLASLATA-AGTNSYLAHEAPQYTTGFGFSMAMCASSILVALGLVWLLKRENRKLDEREREIVASGEPFDE................ 492
53 0.000e+00UniRef50_B8N655 MFS transporter, putative n=1 Tax=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) TaxID=33295  ali  20  8....................................................................................................PDPAGDPEAKKDVIEEEAPMDERTLKLDRQTVLRLDLILMPMTLMLYLLAWLDRANVGNARVFR-----PFHTN--CSAITVTYVPYVVSELPSNLLLKIIGPRLLLPTLCTLWGMVTTLQSQVHNYSGFLACRFFLGLLEGGLFPGIVLFLSNFYRRHELQVRIALFFSAASLSGAFSGLLAAAI-QQMSGLRGMKGWQWIFLLEGLFTVCFGLFSFLVLPNGPE--KVITFRSEHTERCIARLQQDGNK--FETETKVSFKEVFSVLKDLHVWIACLI-LFCNGACLFGLAYFSPSIVQALGYSSTKTQLMTVPPYACGFVVTMITAYFSDRYHQRGIGAFITSGIALIGAALAI........................................................................................................................................ 351
54 0.000e+00UniRef50_A0A0A1TD75 Uncharacterized protein n=38 Tax=leotiomyceta TaxID=716546 RepID=A0A0A1TD75_9HYPO  ali  21  24........................................................................SNYSSSFDHSHKTTMASSTGGFTSEKAASKDGHISPIDHGSSVDGDQFYE-DPKAAQRLLRKCDLRLIPILGSLYLVSFLDRSNIANARLFHLETSLNMPSNGFNNCLWIFYLPFVVVEIPSNLFLNKIKPNHWLAGAMLILGIVSMCQGLTRSYEGLLVCRFIMGIMEAALPPGAALLIGQYYKRSEFYIRFSYFICFALLGSAFSGLLAYAIY-NLDGLHGYEAWRXXXXXXXXXXXXXXXXXXXXXXSFPQDA--IFLTAEERAMLLARLRHDRG------TERLDFKGIIRVFSDWKVWSFTIIY-FCADMGAASISSFTPTILAELHWTAQRAQVMSIPIWMVGIVVTLSTSYASGKLSLRWPFVLVGAIFALVGFCIQYAQINPGVRYFSLYIIAFGSFMQFPILIGWLNSNLRGRPQQ-AIASAVQLGVGNCA-NFVASNVFIKTQSPRYPVGFATXXXXXXXXXXXXXXXXXXXXXHNRQFDTRRSRTKDDDQE................... 517
55 0.000e+00UniRef50_F4RS67 Uncharacterized protein n=1 Tax=Melampsora larici-populina (strain 98AG31 / pathotype 3-4-7) TaxID=747676 RepID=F4RS67_MELLP  ali  17  31................................................................................................................................RSIVKKIDLHALPVLSLLWLACFLDRTNVGNAKVGGMDDTLGLVGLQYNIGLAIFYASYIFAELPSNYLLKQVGAKXXXXXXXXXXXXXXXXXXXXKNYSSLLACRFFLDSFSHIFLIPQMMYLSTMYQRNELQLRVGVFYVFAPLSGAFGGLLAYGI-EHMEGVGGLKGWQWMFVWEGIGTVLVAIFGVCYMPKNLATAS--FLTPEERHFAAS---EEKVKSGEDKHEEFEMREVIRGFKEPQVWMTGFGYM-GLSVCIYSFALFLPTIVLGMGHSGLDAQLHSSFPYLPASVLVLIMAFIGDRLQLRXXXXXXXXXXXXXXXXXXXXXDSNDARYAGVFLIAAGIYPATPSILCILPNNVAG-LTKRGTVTALHLMISNC-GGFVATFIYTREQAPRYKKGHSIALAFLVFAWTMFFLNSMYCRKENKARSNHKRDS--NLMKYDQLVKDG........... 485
56 0.000e+00UniRef50_A0A1Q3EQT0 MFS general substrate transporter n=2 Tax=Agaricales TaxID=5338 RepID=A0A1Q3EQT0_LENED  ali  22  7..............................................................................................ADEEKAEITETTASVDESDPDAKFGGREARLALERKLLWKIDLRILGVLVPIYILNYVDRNNAGAARLRGFETDLHLKGQEFATLLSILYVGYIIMQIPSNMFLNYIGPSLYLPGCMAVWGVKTALQGITNNFVGALLTRFFLGFVEAAFFPGALFLLSKWYKREEIGRRTAILYCGNLISNAFGSLMASGILSGMQGTLGHAAWRWLFYIEGSLTVFVAICAMFILPDFPTTTK--WLTPSERTLAVQRMKEDAGVGDQGETEGGQSSGLVQALSDWRVWWMSLA--MTAQVVSLSFNAYFPTLSATLGFNNTVTLLLCAPPFAFASLAAFFLSRHSDQTKERFWHVASSFGLGIVGFIIAIGTMNTAARYVSL............................................................................................................................ 390
57 0.000e+00UniRef50_A0A0B4IGF3 Major facilitator superfamily domain, general substrate transporter (Fragment) n=85 Tax=leotiomyceta TaxID=716546 RepID=A0A0B4IGF  ali  18  1.................................................................................MASRLEDAEKQMVEHRDLASASNEKLESQLAEAGDADSDYGFTKVEQRNIIRRIDRRLVLTVGFMYCVSLMDRTNMSAANIAGMSVELKLINNRYNIANLVFFVTYIIFQPPSTILVRAIGPRXXXXXXXXXXXXXXXXXXXXQNFSQLAALRAVLGLFEAGFFPSCVYLLSTWYTRYEIGKRYSVFYVVGCLASACSGILAYGLMQ-LNGREGLTGWRWIFIIEGALTCGLAIGAYWLLVDFPDSTRKTWLNLRERQWIVSRVQRDRG---DAKVEPFNLGKFLGGGTDWKVWVYAMI-FFNTTTISYALAYTLPIIVSNLGFSVGAAQCLVAPPYAFAGIVMFTMGWLGDKYRIRXXXXXXXXXXXXXXXXXXXXHSRAAVRYFGVFLVTAGANSNVPATMSFQANNVRGQ-WKRAFCSATL-VGFGGIGGICGSLVFREQDKTGYKPGMYACIACALLNVILVCVCDLEFFRQNKKADRGEKLLESEDSV................... 490
58 0.000e+00UniRef50_E3QLZ8 Major facilitator superfamily transporter n=7 Tax=leotiomyceta TaxID=716546 RepID=E3QLZ8_COLGM  ali  19  4........................................................................................PKETRTAACNRSSYAAGNDESNRVGVDTDSDCYEFSFEEQKNIMRRVDIRLLTTVGLLYCFSVIDRSNLPSAAVAGMLEDLDMTGNRYSIVSLVFFTTYITFQPISVILSRTLGPRTYFTSITMLCGGIVLVMGFLTNWSQMVALRVILGALDSGFFPSCVYLLSTWYIRYEVGKRFSVFYMIVCFASAFAGILAFGLTR-LNGAANLKGWSWIFVIEGMITCIIGIVGYFLLVGFPDAQKPTWLSEKETAWVISRVQDDRG---DAKLPAFGIKMFLRGGGDVKVWALAVIY-FNNALVNFSLSFFLPIILKNMGFGTGKAQILTAPPYIFAAIIMYSTGWLGDRYMLRGPIIIGDMVLSIVGICLMGFHEDVAVRYFGVFLVTAGAVSATPATMAYQANNIRGQ-WKRAFCSAFV........................................................................................ 417
59 0.000e+00UniRef50_M2MVN5 Uncharacterized protein n=5 Tax=Dothideomycetes TaxID=147541 RepID=M2MVN5_BAUPA  ali  21  2........................................................................................................................DPDRVAAEKALVRKIDLYLLPTIWIMYLLSYMDRTNIGNARVAGMTTDLKMDSNQYSVALIVFFITYVLFEVPSNLLLSKTKPSVFLPVIMTLWGVATCCMSLVKTYGQLVALRTIIGMLEAGFAPGILLILSSWYKKNEQSKRXXXXXXXXXXXXXXXXXXXXXXTGGLEGAHGLRGWRXXXXXXXXXXXXXXXXXXXXXPDFPANSKK--FTERERELAISRLEADDVHGRTEDSPHLTLQALGQSVRNWRTWLFVAGYM--VIVGSSTLSYFYPTLVKGLGYTSHMAQYMVVPIYAVAFVCVAVTGYFSDMFRQRGXXXXXXXXXXXXXXXXXXXXXNFKARYVLLVFMAAGLWSSNGLALSYAASTFGSPQETRAVSLALVNALGN-LAQIYGAYLFPTKDAPKYLLGFGVISGMCAFGIIMYIAAHILLRK..................................... 435
60 0.000e+00UniRef50_UPI000455CED8 MFS general substrate transporter n=2 Tax=Coniophora puteana (strain RWD-64-598) TaxID=741705 RepID=UPI000455CED8  ali  20  81..................................................................................EAVEEVISRPPPLPRTRNRGSPSGFEFGDYGESQRIPGLGDAKALEKKLVRKLDAR-MAILVLIYILNYIDRTNISSARLQGFEQDLHLEGQQYSVVLSILFVGYIIMQIPCNMFIEWIRPSVFLSLCTVLWGVISALTGICTNFAGALAVRFFLGFVEAAFYPGALFLLSRWYTPSELGARVAVLCCGSYIGNGWGALLASGILARMGGVLGHAAWRWLFFLEGGITVLFALCACVLLPDFPHNTR--WLSPAERALAIERMERDDSSPDPSEKRTSTLHGLRLALSDWTAWWFAVAAFF--QFLAQSFFIFFPTLAATLGFGTTATXXXXXXXXXXXXXXXXXXXXHSDRTKRRFEYIVFSELAGIVGFIIAMSTMNTAARYISLFLMAQ-VYAGLVVFNTWTCNAFPRPPAKRAVVLALVNGVSQ-LGNVVGPYV......................................................................... 535
61 0.000e+00UniRef50_A0A1Y2E9Q3 Major facilitator superfamily transporter n=4 Tax=Xylariales TaxID=37989 RepID=A0A1Y2E9Q3_9PEZI  ali  29  16....................................................................................SEVKTSAHNVHDSGSDAIDVPIAKSPKKTWRSYFWDTFDKTPEERRFLFKLDAVVLSFACLGYFIKNLDQVNINSSFVSGMKEDLGLYGNQLNYITACWTAGYVIGEIPSNMLLTRIRPSIWIPACEVTWSVLTILLAKCTNATQIYVLRFFIGLAESAFYPGMQYIIGSWYRRDELAKRSVIFHTSGNIGTMFSGYLMAAVYR-LSDVQGFRGXXXXXXXXXXXXXXXXXXXXXXXXDVPEITRAWWLTKEEIEIAKRRMRLEGRAN---RGGSYTKAKFRKIFGSWHLYALTLLYIFFNNGSGYSQPAFALWLKST-GHSVTQVNTYPTIASAISIIFALIYAWTSDTLGARXXXXXXXXXXXXXXXXXXXXXDIPVGWKWACYILGMIGGGISGLTFAWAHEICGEDNEERAFVVGSMNEMAYVMQAWLPLLIWQQVEAPRYQKGFITMVFFAAGMALTALTIRYLHRREKAQKVKGEEAAEVEE..................... 501
62 0.000e+00UniRef50_C8VJW1 Major facilitator-type transporter hxnP n=74 Tax=leotiomyceta TaxID=716546 RepID=HXNP_EMENI  ali  19  5..................................................................................................ATDIEKVPSAGTPDEPKAGETNVYVDTEAEKSFVRKVDFFVLPMLCLMYFFDCMDRSNLANAKTDGLEEDINLKGNEYSLLILLFYIPFGLFDLPWNLLIKRYSARIMLSAVTVVWGICALCQCAANNFGGLLAIRIILGVFEAGFFAGSTFYFTLFYTRNEMGFRLAVLQSFAVLASAFSGLISFGLFQI--NHSAVKGWQXXXXXXXXXXXXXXXXXXXXXXDTAQSA--WFLTQRERDAASARLLRD---TSAEIETKLELKAAFQTWSDWKFPIWAVI-TFSYPVAYATAMNFFPIIVARLGYSVVKTNLWTVAPNLVGAVVLLVVAKSSDIFRERSLHIIFSLTVSLVGMLILASSHNKGVSYFACFLLASGAYIPTCLVHAWHNNNNTNENS-RAANTGFFVGLGNIAG-VLSAATFRTEYAPKYVPTLVATCACNGVCILATAFMGTWMRLENRRKDKEQGARIVAGQVETRMLADGEKSP....... 489
63 0.000e+00UniRef50_A0A0L1JA20 Uncharacterized protein n=1 Tax=Aspergillus nomius NRRL 13137 TaxID=1509407 RepID=A0A0L1JA20_ASPNO  ali  22  337.................................................................................................HENAQKVEQSEQDVIYQTYVSQSPEWHRKMTRQLLRKVDVHLLPCLIVMYLLNFLDRNNLSQARLGTLEKDLSMKGTDYNLATSILFVGYLLMQLPSNLLLTRVRPSLFLGITMAIWGVISACQAATHSFTGLVLARFFLGFVEAPFFPGAIMLMSSWYTRQELSHRIAWFYAGSSLANAFGGLIGAGVLSNLDGAHNISGWRWLFIIEGL-----------LLPNYPATTS--WLDETEKLYAQWRLIHDAGEADEAKSNNL-REALWLVFSDKRIYLFILLQ--HTSLLSQNFQYFFPTIVQTLGYGNIEXXXXXXXXXXXXXXXXXXXXXXXGRTNDRGLHIISLMLVSVVGCVICTATTNIGAKFFGXXXXXXXXXXXXXXXXXXXXNSFPRPLVKRSAAIATANMIGNTAS-IYGSYMWPSSAGPRXXXXXXXXXXXXXXXXXXXXXXXXXHARMNRRLDMAQESDQGE...................... 793
64 0.000e+00UniRef50_A0A2S7Q6W0 Uncharacterized protein n=3 Tax=leotiomyceta TaxID=716546 RepID=A0A2S7Q6W0_9HELO  ali  18  4..........................................................................................HEQSNDIAKQKPGGHIMHGSLSDESLSSPATQLSPIDEKALVRKIDRRLLPMLFIIYVAAFLDRVNISNALTMSLPKDLKLVGNQRNVALCIFFVPYILFEIPSNIFMKRFKPHIWLSGCILAFGIIMLAQGFVKSYSGLLATRFFLGLCEAGIFPGSFYLISIWYKREESLQRFTVYWCSVLTASAFGGLLASAI-QKMDGLRGLHNWQXXXXXXXXXXXXXXXXXXXXXTDFPEDAK--WLTEEERTFIIDRV------GGIEKDQTITSADVLKFFKSLKN------VLGGVVVPVYSFAYFTPTIIKTYGYSVVETQLHTVPPFVAALVLCLITAYASDRLKXXXXXXXXXXXXXXXXXXXXXXXXHSFAEYAGICLVAMGIFTAGIAVVCWYVMNLQG-HVERAIGTAWMIGFGNA-GGIIATFSFLSTDAPFYHTGYSICIGAMCLGAAACLLYGVLAVYHNRTLREANGEKE........................ 494
65 0.000e+00UniRef50_R1GKT3 Putative pantothenate transporter liz1 protein n=3 Tax=leotiomyceta TaxID=716546 RepID=R1GKT3_BOTPV  ali  28  2............................................................................................ATPTPQDAVPQDAPPRKKSFRSFIWDTDTHLKSPAERLLLRKLDYSILTIGCLGFFLKYLDQGNLTNAYVSGMQEDLSMHGNEYTYAVTAYTCAYAVMQIPSTLIIQRIRPSLWLAAMEVAWGAFTFAQAGLRSSTQLYAFRFFVGFFESSFFPCLLYVLGSWYTRTELAKRIAIFHMTAPLGSAFGGYLQAAVYENLDGHHGLAGWRWLYIVCGCMTVPVGLATFFFLPDTPYTTRAWFLKQEECELSIERVRKAGKAPPA----KVTFKTFTRILSRWRWYAFVLGYVL-YGSACQASSYFGIWLKSE-HYSVVDRNIIPTGTNLISAASVIMWGFLSDYTGSRFAFVVGPLTYGLIPNGILAFWPSSIQLKEFAFLTCG....................................................................................................................... 377
66 0.000e+00UniRef50_W3XNF8 Uncharacterized protein n=1 Tax=Pestalotiopsis fici (strain W106-1 / CGMCC3.15140) TaxID=1229662 RepID=W3XNF8_PESFW  ali  20  11.............................................................................................DEKTPVPKDGSAHESNTTETDSHDVASSQIDTDLGSKVTRKIDIALLPLLGMMYLLAFLDRTNIATAKLNGFEADLHMPSSGYNTALWVFYLPFVLLEVPCNLILGRVRPAYWLGGIIFILGITSMCQGLTRSAGGLYACRALMGAVEAGVQPGAALLMAQYYRRVEFAPRFSFFICCALIGNTFSAFLAYAI-SHMDGVHGLEGWRWIFILEGIVTGCFGIVLGIFTPSWPE--KAHFLNESEREVLLRRLEIERGKE-NLDMQNVNW---IKCMLNWKTWAITLV-FFCCDMSAASTVSFSPTILSQLGYSGNRANXXXXXXXXXXXXXXXXXXXXXXRINNRSGVIAFGAAMSIVGWAIQRAQVQPGVRYFGLYMIYWGANIQMPNCVAWFHSNVVGRPEK-AVGMAIIAGFGNSC-NFVASNVFITSEAPRYPTAFSTGLAIQSLGFVSCLTLAGFFFIQNKKA................................ 471
67 0.000e+00UniRef50_A0A2T2P794 MFS transporter n=1 Tax=Corynespora cassiicola Philippines TaxID=1448308 RepID=A0A2T2P794_CORCC  ali  16  4..........................................................................................KENTNNTIHIEDSVDLKPDIEEIGELAQQRDAAFQSLEKRIVRKYDIWVLPLVWVLFILSYLDRGNVGNAKTAGAQTDLGLSSKQWSWVLLSFYITYTVLEW-LVLCWKVFPAHIYVAGLCIGWGLAATLTGIVQNLAGLIACRVVLAIFEAGFGAGVPYYLSLAYKRRELGFRLSILLGSSPVANCVAGAMAYGITQI---NSNLTPWRXXXXXXXXXXXXXXXXXXXXXMDHPSTAK--FFNEEERTFAVERME----TRDTTKKSKLSKEQLLAGLTDYKNYCHACLH-FCCNYSFAGLSNFLPTIVHNMGYNSIDAQGLTAPPYLGAFITSILVAWLSDKYGSRGWLLSFS------------ASTSNGVRYLGVWLASCGVFPALAINMTWMLNNNAGD-TKKGVGMSILAIVGQ-SSSFVASVVFPNEDAPYFVRGCAIGCGLTGIMVPIGIILHFVYKAENSRREKEALEGHSHGPIDVSALGDKHKD........ 480
68 0.000e+00UniRef50_A0A1Y2GR92 Major facilitator superfamily domain-containing protein n=2 Tax=Lobosporangium transversale TaxID=64571 RepID=A0A1Y2GR92_9FUNG :_  ali  19  2.......................................................LSEKKQTQIEDTNFAHDIERKSSPSVTSTLDGAAQADSADNKL---------RAIGEQDPYYVHDLIWTAEEEKQLVRIFDLKILSWIGVMFFFLQLDRGNMSNALTDNLMVDIGVDLNTITLGTAIFVLFFCFFEIPSNMIIRRVGPHRWIPLLMVLWGLATATQMFIKDRVSYFITRALVGTFEAGYIPGIAIYLTTYYKREEMALRLSIFWSTLAIASSCAGILSYFIL-HMRGIAGLEGWKXXXXXXXXXXXXXXXXXXXXXPEGPTATRGYYLTERQELIAITRLIRDDPSKADPSKKVVPKADIWRAVRSPRIWPHILIGFFGLLPSVP-LQGFAPLILKMLGFSALKTNLMAIPGYLLSLIIMSAVSYSSDRFKERAFHGAFATVCCVAGLALLPLGTNKINLYICLIFSMGGSTCWHPVNAAWIAGNTA-PVGKRTIALA-MYIMSVNLTAIVGTSVFRAEDAPRFIKGMWVLFGSLIITISLFIFQRYYLIYINKKRARTTKDWTTDDKHYNKTTKDVGDERLDF.... 531
69 0.000e+00UniRef50_A0A1J7JSG1 MFS general substrate transporter n=5 Tax=sordariomyceta TaxID=715989 RepID=A0A1J7JSG1_9PEZI  ali  15  2..........................................ATVLTKEKAVVTTQETNSSTTSLDSNSPPAPLDEKRFWFQRVNSYDPDAIATQTSVFDDPETAEKYQPRADWHRFDPQARWSWGEEHRLVRKIDVRIMIWACIMFMSLELDRANLGQALTDNFLSELKMTTNDYNLGNTVFKLAFLCAELPSQLVSKWVGPDRWIPAQMVLWSIVASSQYCLTGRESFLVTRALLGILQGGFIPDVILYLSYFYKHHELSLRLGFFWTAMSIADILSAIFAYGLL-HMRGVSGQSGWRXXXXXXXXXXXXXXXXXXXXMPAGPCATKKGWFSEREEKIIVNRLREDPSKSSMHNRQPVTPKLLWQSLKDYDLWPLYILGLSFQIPMTPPAQYLTLSLKA-LGFDTFQSNLLTIPYTVLHMITMMVITYLAEIVGELTFVSLSGQIWALPFLIYLTVANTGSVSRWVIYAVTTAYPSAHPIQVGWNSRN-SNTVRSRTVSAACYNMFVQASG-IISSNIYRSDDAPLYRRGNRQLLAINCMNIVLYLLVKVYYVGRNKQRDRWESMSEDERLVYLATTKDEGNKRLDF.... 560
70 0.000e+00UniRef50_A0A0D1E2F7 Uncharacterized protein n=18 Tax=Basidiomycota TaxID=5204 RepID=A0A0D1E2F7_USTMA  ali  15  5.......................PRLAKDAPPVTISAPNAAVDITQATSQNVSGTSSFTDEDKGSTSDINWSHSSPSNTESLVDDSIAPLSRSHDEKVAQHWRQLYESTKYENRHRFDPSFEWTVEEENRVIRKVDFRILAWSWVMFMSLDLIRKNINRAIADNFLSDLGMNQNDFNNGQVIYLLAFLSAELPSGLISKKLGADVWVPTQIVSWSIISASQAALTNKAGFFVTRALQGLAQGGFLPDQILYISYWYTGKELNTRLSWFYTVLGLSQIVGSLLAAGFLE-LRGLNGVAGWQYLFGFEGLITGVIGILSFFMLAPSPTKTKGFWFNEREEKIIVNRVLRDDPTKGDMNNEGLTSSAVWQALGEKDLWPVYLLGLVVFIPYSPPQTYLSL-ILRQLGYTTLKSNLLAIPSQFFFALNTIPYTWLSARLNERSILASLSNVWNISFLIPLYSTNHYNWVRYALITVLTSVPYCHPFLIGWVSQN-SQSVRNRAVSLCLYNMSVQ-VGSILSTRVYTNGDKPYYRKGNLALISLAALSIVLCWLVKLYYIRRNKQKLRWDSLSADEKLQYKLTTKDKGAKRLDV.... 582
71 0.000e+00UniRef50_A0A094E7N2 Uncharacterized protein n=3 Tax=Pseudogymnoascus TaxID=78156 RepID=A0A094E7N2_9PEZI  ali  21  574....................................................................................IDSDVTSGEESTHVDQVECKGATDSEKASSMNEQATIVYDEVESKRILRKVDMRLLPCLTLLYLLSFLDRGNMGNARTLGMQKDLGLSGPQWNICLTIFFFPYCAFEIPSNVVLKLLPANLWVSILVVCWGTCMTLMSLVSNYKGLLAARFFLGFAEAGFFPAATYLLTCWYRRAELQGRLSVFFSAGSMAGAFSGLLAYGI-NYMHGIAHLAGWQWILMLEGLVTVLVGFACFFFLPNGPATAT--FLTPDERTFLIERLKSDNGGASGDTNEPFQWKYMKDALTDWKIYISVLIY-WGNAISTYGFIYTLPSVITELGYSAANAQXXXXXXXXXXXXXXXXXXXXXDRYESRSNXXXXXXXXXXXXXXXXXXXXHPGATYGMLFVVAGGLYPLICGVISWNANNLAGS-WKRSIGMALQISIGGMGGA-VGSNIYLSKEAPHXXXXXXXXXXXXXXXXXXXXXXRWKLNKINKERDAMSLEEIHSKLV................... 1062
72 0.000e+00UniRef50_A0A094B057 Uncharacterized protein n=3 Tax=Pseudogymnoascus TaxID=78156 RepID=A0A094B057_9PEZI  ali  19  3..............................................................................DEVSKAATYGAQVDKPTSEAVENFEKAAPNDNAMGISSLA-DPEYRARVEKSLKRKLDSR-CALFVLIYIMNYLDRNNIAAARLKGLQDDLHLDNNEYSTCLSILYVGYILMQVPSNMIINKIRPSXXXXXXXXXXXXXXXXXXXXTNFTGMVLIRFFLGFIEAAFLPGALLILSKWYTRRELTTRNAILFCGNLISNAFSALIGAGVLSNMQGVLGHAAWRXXXXXXXXXXXXXXXXXXXXXPDLPHNTRG--FTKEELELAQLRMTEDVGESDTDSEGQGAFDGLVMALKDTKMYI--LMMTLTAYVVGLSFNAFFPTLTKTLGFGYVPTLLMSAPPWVFSCIFSLVVAWSSDRHQEKFWHIVGPICVGLVGFVISMSTLNVAARYVALFL-QAASYAGFIVMYSWISSSFPRPPAKRAVAIAMVNAFSQ-LGNVAGSYVWNL-EANGFRKSYGIVTAMFGVAIVGCLIFRIVLSNLNKKLEEQQRALDTEPDLAEKQEDM............ 497
73 0.000e+00UniRef50_UPI000D77CD87 putative pantothenate transporter n=1 Tax=Jaminaea rosea TaxID=1569628 RepID=UPI000D77CD87  ali  19  6............................................................................................................................EERSKRLCRKMDLHILPVVALLYLFCFLDRANIGNARLAGMEKSLHMEGLDFNLLLSVFYMAYIVFALPSTMLCKVVGPRFWLPSIAIGFGISSLATAFVHTLRAAWATRFFLGASEAGALPSISFYLSRWYRRDELAFRLSXXXXXXXXXXXXXXXXXXXXXKI-DHIGWLRDWRLIYFCEGIATVGVGAVAFFLLSDSPQTA--GWLTPEEKMLAVTRMLQDKGTASQTTDHRIRLPQVKRGIFCVTTLSLCFA-FMMNNIIVQGLAFFLPTIIRTLGRTIIQQQLLTVPPWIAGSISTLVVPYLSMKTRHRXXXXXXXXXXXXXXXXXXXXXHDAKARYTASFFVCIGSFLIGPILQGWASGNQTEDSS-RAAAIGTTVTAGN-IGGFIACWTFLLRDAPDYHSGNAINLACACGIVVSVACLGAYLWRENGRRDAGDRDELLVGLSEEDKENLGHLHP....... 466
74 0.000e+00UniRef50_G9P0J2 Uncharacterized protein n=26 Tax=leotiomyceta TaxID=716546 RepID=G9P0J2_HYPAI  ali  20  27..............................................................................................................................EQKKILRKVDWRLVPLLSFLYLVSFIDRGNLGNAKVAGLGEDLHLSGTQYNIAVTLFFIPYSLLEVPSNIILKLTRPXXXXXXXXXXXXXXXXXXXXXQNFSGLLAIRIFLGVAEAGFFPAATYLLTVWYTRYEVQSRMVFFYAAVSLAGAFSGLLAYAI-QKMDGVAGLEGWRXXXXXXXXXXXXXXXXXXXXXPDSPSTA--PFLTTEEREFIVLRLEQDTGSGRGTNNDKVNKQQVIAGLTDWKVWAAVFMY-WATSISSYGFTYTVPTVILELGYTAADAQXXXXXXXXXXXXXXXXXXXXSDYYRQRXXXXXXXXXXXXXXXXXXXXXXHPGLTYGMLFLATSGIYMSLVPTLCFVANNLA-PSSKRAVGMAHLICMGN-LGGIAGSNIFLAKEAPHYWTGYGFILGIDCLAFITCLTLRHILMGINKKRDQMTEEDIREKYGNVDLLELGDRSP....... 485
75 0.000e+00UniRef50_B0DRI2 Predicted protein n=1 Tax=Laccaria bicolor (strain S238N-H82 / ATCC MYA-4686) TaxID=486041 RepID=B0DRI2_LACBS  ali  18  23.............................................................................................................QPTSNHVEPPRPTFDKRSTAKLLRKLDWNLIPFIALLYFLALLDSTNIVNFRVTVLQRDLKMKGLDYSVALALFFPFYAVAAIPSNLFLRKIGPSRWLCIITMATGLCMTLMGTVKTFGTLLVARSVLGFAEGGIFPGIIFYVTFWYRRYESGLRMAIIFSAATLGVSFNGLLGHLI-SYMGGIGGRPSWAWTFILEGLATILVAFLAKFLIHDGPETAR--FLKAVEHTQMKERLVQDHPSLSNEHHS----RYITSAFKDWKIYVHILIAI-CIYTPLYSIFRFLPTIVKNMDYFNDYTQXXXXXXXXXXXXXXXXXXXXSDKTKRRGAYMMLFCVPAILGYVLMISTRDSHVQYAGAFLVISGVYPNVPIGVAWNANNIGGS-TKRAVGIAMQIGFG-HLGGVISAFL------PILAQGHIVSIGMLTLSFFLCLFMHRYLLRENSRRDAEMMAQGLTLESYSEEQKFQEHEKGDDASF. 490
76 0.000e+00UniRef50_A0A0L0NA09 Alkaline phosphatase n=2 Tax=Ophiocordycipitaceae TaxID=474942 RepID=A0A0L0NA09_9HYPO  ali  17  159........................................................................................................DETAIRGASEEPGHGAVHVSEEANLRIRRASDRRVLPIVCCLYVLSYLDRGNIGNAKTAGAQDALGLDSTQWAWVLNSFYICYVAFEW-TTMFWKIFPAHIYVSVLCVCWGAAAMSSGAARNMAELVVTRCFLGVLEATFGSGAPYFLSMLYRRRELGFRMSLLIGMSPLANTFASSLAYGITQI---RGSLEPWRLLFIIEGSLTVLFAPVVYFFLIDSPAKAK--FLTDEDRMLSIERLQLRDSTAED----GVKWKQVMAGFTDYKNYVHSLIH-FCANYSFAALSNFLPTIVKDMGYDPVAAQGLTAPAYFAAFLICVLASYVSDRFGRRGXXXXXXXXXXXXXXXXXXXXRDAGARYAGAWLAACGVFPALSINLTWILNNQGGD-SKKGAGLAIFLTLGQC-SSFISSVVFPQGDAPFYTKGCAIGCGLTGLIVLLALGMHVALSCENRRRDRLYRPVDPGAEVDVTEEGDNHRD........ 629
77 0.000e+00UniRef50_A0A1Y2EJM3 Major facilitator superfamily domain-containing protein n=6 Tax=leotiomyceta TaxID=716546 RepID=A0A1Y2EJM3_9PEZI  ali  22  46..........................................................................................................................IDRATERALCRKFDFRLLPVLAVMYLFNALDKGNLGNAETAGLSGDLHFADGQYNXXXXXXXXXXXXXXXXXXXXXKRFGPARVLPILMFCFGSLTLLMASVTNFSGVFALRWFLGISESAFFPLVIYYQTTFYRRGELARRLAIFYAASNIANAFSGLLAFGVFQIKSHLVD-HPWRWLFIIEGSATVSFSVFAYWYLPKSAAEAT--FLNDEEKKLAFHRIQVDSSSVV---NEKFDLRESLKIFKRPSTYGFLLIEI-CLGVPLQGVSLFLPQIVQRLGYGSIKTNLYTVAPNITGAVMLLILAFTSDGFKIRXXXXXXXXXXXXXXXXXXXXXXDVRVAYFATFMMCWGTSAPSVLLSTWYNNNVAHEGER--LTLTSVGVPLANLMGLVASNVFQKRDAPKYLPALITTAAFGATGCLIAASLGMYMIFDNNRRNRQQGVSLTAKDIPTRKLRDGPKVP....... 504
78 0.000e+00UniRef50_A0A2T3AF22 Putative pantothenate transporter n=1 Tax=Coniella lustricola TaxID=2025994 RepID=A0A2T3AF22_9PEZI  ali  26  4......................................................................PKEEAAGVVAVDALQASPSPSVDDDNYNHASPSEKSKKPLGKRIKSIIWDTLDRSPEERKFLAKLDFFILTWASLTYFSKNLNTNNNTANYVSGMKEELNVVGNEYQTFTTMWTIGYVISQIPSQIICTKVRLSWWCPSWELFWVIVTLATSAVKTPQQLYGCRLLVGLAEGTFYPAVHTVLGGWYTKKSLAKRACIFFASAFVGSMFSGYLQAALYTGMDGVGGLSGWRWLFIFDGVITLPMALWGYYALPDLPSNTRVRWLKPEEKALALDRMQR----AGKQLEEPFTLRGLKRVMSKWHFWVYTTYYTFFICSENIG-TYMNLWLKSLDRYSVSQIDTYPTVINAVTIITTLIYGWTSDALQVRAPIVYFSLLVCFFAAVNLAVWDGPFGLKWASYYLTGFAQGSGPVFLTMVNEHCAGDSLERKIILGSTNSVAYAFNAWIPLLSYNTTYAPRFLAGNITTVAMILCAASTLTLAIVLQRRDYLKLASWHHQSHTDDNNYGRGHGSDGERGLDTGEEE 531
79 0.000e+00UniRef50_A0A1Z5TVE9 Uncharacterized protein n=1 Tax=Hortaea werneckii EXF-2000 TaxID=1157616 RepID=A0A1Z5TVE9_HORWE  ali  21  1..............................................................................MTVTDNKASDIDGKTPSVELNRTSSITSDSKGNTIITGEDGETAISEKAERALVWKFDLRVLPLLAMMYLFNSLDKSNLGNAKTAGLEEDLGFAGNKYNXXXXXXXXXXXXXXXXXXXXXKMYGPSRVLPCMMFTFGTMTLLVVAVYNWSGLMALRWFLGMAESAFFPLVIYYQTMFYRRGELARRLAIFYAASSIAYAFGGLLAFGTFQI-DG-GSIFHWKYLFVIEGSLTMCMAVVAYIFLPRSAATA--WFLNEDEKKLAFYRIQVDSSAVVE---EKFKLGQAVKIMKHGTSWVILAIEV-CLGIPLQSVSLFLPQIVARLGYSTIKTNLYTVAPNISGAVMLLILGYASDLTRWRFPFIALGFLFTFCGMVIYAAIDVLQVAYFACFMMTWGTSAPSVLLDVWYNNNIA--DENRRLFLTSIGVPVANVMGVVSSNIFRTEDAPDYIPALATTXXXXXXXXXXXXXXXXXXXXDNKRRDRQQGERLRARDVPTERLREG........... 499
80 0.000e+00UniRef50_A0A072P9R9 Uncharacterized protein n=1 Tax=Exophiala aquamarina CBS 119918 TaxID=1182545 RepID=A0A072P9R9_9EURO  ali  19  2..........................................................................................ALDSVRKELTEEDQVEVASKTGPGEEESFDSHVDPKFDRNAVYKLDLLLQPVLFGTFILLLLDRANVGNARVAGLQESLHLTDSQYQISLMVTFIPYVLIELPSNYALKIIGPRWLLPGLCVCWGIVTTFESLIQNYAGLIACRFFIGLCEGGVFPGYVVVLSEFYRRHEIQKRIAILYCGAALAGAFGGLLAAAI-QQMDGLAGLDGWRWIFLIEGLFTICWGFATLWVMPSSPRDVLT--FTPEQKEYYVKRMAADKQTNEDD--DKVTPHDVLACLIEPHFLMMAVMS-FCVGTVAQGVSYFTPSVVLTFGYSRTTTQXXXXXXXXXXXXXXXXXXXXXDRYRRRGLVAIVTAALGVLGCILNYSGTSLQVRYPALFFLIGGIYSCAPTVLAWLPNNNAA-YGKRSVAVAIGFMVSN-SGGILGVWIYPTKNAPRYXXXXXXXXXXXXXXXXXXXXXXXXXKSLNKKKVENREELLRGIEHDQQVKALGDHHP....... 492
81 0.000e+00UniRef50_K0KJP9 Putative transporter SEO1 n=7 Tax=Wickerhamomyces TaxID=599737 RepID=K0KJP9_WICCF  ali  44  47..........KDYSAWYWKLIPHERHVEDWADDYE-----------------------------------DDKLSIHSESTVVEYEYRDEANRPWWKFFDEYEYRYNKQTREQKKWYKFFDSNASVTEKKLLFKLDLLIVTFAVMSYWSKNLDQSNVSNAFVSGMREDLNMVGNDYSNTVALFNAGTVIFQIIFTWLFPRIDMHLMFFLSDVGWSLVTLCTGFVRNPAELKACRFLVGAFESGYFIMIHYLLGSWYKPDELGRRGGVFYCGQMLGQLTSGLLQAQIYQNLDSAGGRAGWRWMFIIDGAATMTIGFFAFYMVPGTPNKCTSLFLTDDEIRLSRYRLKKANIKPPSKEPPKFDKKLWINILSSWRIYVLAVLDYLFWNTGNSGYSNFALWLKSLKRYSIPRINRFTSIPPSLGIIWILAVCGSADMLKSRXXXXXXXXXXXXXXXXXXXXXDVPEPALWYAFYTNFFSISVSSVVYGWINDIMRYDPQERSIVLCFVNIFANQSTAWTGPLVYKTVDAPRYHKGYIYSASNSAALMIWSWVTLWFYKRQEKRDAKTNGIILYNSKTGD................. 578
82 0.000e+00UniRef50_A0A0C3CX41 Uncharacterized protein n=3 Tax=Leotiomycetes TaxID=147548 RepID=A0A0C3CX41_9PEZI  ali  19  3.....................................................................................DSQAKVASSFHEGKDFKSATRNKADTAIAEGYHGDFVVDKTMEKKLNWKCDFKLLPPLIGLFVITFLDRSNIANAKIEGMTTDLKMKANDYNMSLWILNIPYICLAVPSNMLMKKVKPSVYLSGIMFCWALCTIGLGCTKTFKGILACRFLMGVFEAGFVPGCAYLISRYYKRRDFSVRYXXXXXXXXXXXXXX-XXXXXXXEHMDKVGGYAGWRWIFIIEGCITIACVGVGLLCIPPYPKDST--FLKPEEKQYLLAMLKKDAGPSRPDHYNSLV---IKECLFDPKIWLGYLIYLFGADNAASSIVSFQPTILKSLGYSNSAAQVHTIPVYIVALCSLLICSYLSGRVSHRYSFLIFGAAIGIIGWSILAQVKAVSARYFXXXXXXXXXXXXXXXXXXXXSNNMGGNA-KAAFATGVMIGLGNC-GNLVSSNVFITDESPRFKTGFGTGLGLNMLGVVASSALELYCLMANRRRDAGKDNAKLDNSSDV-LGDLGDDHP....... 522
83 0.000e+00UniRef50_A0A178ZPW2 Uncharacterized protein n=8 Tax=leotiomyceta TaxID=716546 RepID=A0A178ZPW2_9EURO  ali  18  15...............................................................................................................EYESKEPPPPEVDQAAEKKLVSKIDRVIVPLVMVTYLLCFLDRTNIGNARLYGLEKDLHLHGTQYQTAVALLFVTYVLVEIPSNLMLKYFTPSRXXXXXXXXXXXXXXXXXXXXSFGGLVVCRLLLGLVEGGLFPGLTIYLTMFYTKTELALRIGYLFVSSAIAGACGGLLAYGI-GYMDGLAGQSGWRXXXXXXXXXXXXXXXXXXXXXXDSPDTA--WCLDEGERQLLIARLRRQPGF-----HEELDRKDSLLAFKDWKTWGFAA-GQFGVNAMLYSYSIFLPTIIKGLGWSPTQAQALTVPVYVCGAISYLLVARLSDAHQLRGPYQIAAASTSIVGYGLLIARVGPAVHXXXXXXXXXXXXXXXXXXXXXXXXNNPR-YGKRTTASAIQISVCNCSG-ILAPFLYPAEDAPYYTMGFSVNIALLGYGILFYGFMTLYLSRVNKRRMDGKEDYKVAGMSDAEIEALGDRSP....... 479
84 0.000e+00UniRef50_A0A2U3E3S0 Uncharacterized protein n=2 Tax=Purpureocillium lilacinum TaxID=33203 RepID=A0A2U3E3S0_9HYPO  ali  18  721................................................................TPARLVLASPVPSSACISSRRIDMEPVKSPSVEVKEAPSRGPPRQDDGVAEALRSYVPG-SDEEKKLVRKIDAYFLPMLWAMYILNYIDRTNIGNAKIAGMSKDLDLTDDGYAWVLSVFFFGYLICEVPSNMILTRSKPSIFLPTIMLVWGATSALMSISKSYGALLAFRFILGCLEAGFFPGVLFLLSCWYTKQEVGKRFAIFYTASVVSGAFGGILAGAITSDLHDAHGIAGWRXXXXXXXXXXXXXXXXXXXXLLDYPATSKR--LTPEERLLATVRIVHDGISNGSAGRRHLSWQAFLAAISDPRTYLFVVL--FMLDVGSGTISYFIPTITLSLGYNTVRAQYMTVPIYAVAATCCNLTAWSSDRHVERRWHVAGPLAVGCVCAVVCVAVQTAVVRXXXXXXXXXXXXXXXXXXXXXXXXXXXXPPEKRAIVIAMVNAFGN-FSSVYGSRIWPSTDAPGYR............................................................... 1181
85 0.000e+00UniRef50_A0A0E9N7W3 Uncharacterized protein n=2 Tax=Saitoella complicata NRRL Y-17804 TaxID=698492 RepID=A0A0E9N7W3_9ASCO  ali  16  1....................................................................................MEQPYDLQTKLHAHHIEEADPGSVSNAGVGEWVEPPSHVT----RAIVRKLDWRILPVMSLLYLFSFLDRTNIGNAKIDGLTEDLKLTSLEYNLCLTVFFFTYAVFEVPSNLCLKKYGARKXXXXXXXXXXXXXXXXXXXXNYEGLLSARLFLGLAEAGLFPGVTFYLTNVYKREEQSLRIGIFFSAATIAGGFGGLLAYGI-GKMDGVGGWEGWRXXXXXXXXXXXXXXXXXXXXXXDSPRTAK--FLTEEEATIVENRVKYD-GSAGTPMSDHYEWKFVVQALTDWKVWLSLLTYY-GTMTPLYCIALFLPSIIRGLGYPTTTSQLLTVPVYVAGCLGVLIFCYFSDKYRMRSPFIVLGAVLNLIGWGVAYGSNNIHVRYXXXXXXXXXXXXXXXXXXXXXXSNIGGQ-TKRATAIGMQIGIGGLSGCI-SSNIFYAKDAPNYRPALLIALGLSALALVNACLYWFCLLQAN................................... 490
86 0.000e+00UniRef50_Q7S2T6 Uncharacterized protein n=52 Tax=Dikarya TaxID=451864 RepID=Q7S2T6_NEUCR  ali  16  39.....................................PTPTDEKKPSSYGTVIPPSPSPDTKNFPSSSSSDLSESSEYADLTRNPFLDPVVAAHWRKVYEEAD-------YECRAVFDPSVTWTEEEEKAIIRKIDFRACAWAIVMFFALQVDRGNLSQALADGMLDDLGLNTNDYNYGNVIFLVSFLCAELPSQLLSKKLGPDRWIPIQIVLWSVVAISQCSLNGRGSFFATRCLLGLIEGGFIPDIVLWLSYFYTSRELPIRLSYFWTTLSTTSIITSLMAFGLL-HMRGINGWAGWQWMFLVEGLITLCIGLASFFMMPASAVQTKTWWFTDREVAIVVNRVLRDDPSKGDHNREAITPKRLWETLKDYDLWPLYAIGLVAY-IPQTPVNYYLTLTLRRLGFSAFNTNLLVIPSSVVHIITLLLLTRLSDILKERTFVAMLQSLWTLPCILALRFWPGNAWGTYALMSVLLSYPYCHAILVAWTSKN-ANNVGARSVSAALYNMSVQ-LGNVVANFIYLDYDKPYYHDGNTKLVVINLLAIGVFLFTKAYYVWRNKQKDKWNGLTEEQKAEYIKTTKVQGSRRLDF.... 589
87 0.000e+00UniRef50_A0A225A7K8 Uncharacterized protein n=1 Tax=Talaromyces atroroseus TaxID=1441469 RepID=A0A225A7K8_9EURO  ali  16  489....................................................................VQASERDMNLIKVESAHIATTQHENHVDLALTKNHDAAELGQSATDRYGRPLIQFDPVAEKRLVRKFDLYIIPTVSLLYLFCFIDRANIGNARLAGFEEDLGLEGNDYNIVLSVFFSSYILFEIPSNIACKWIGPGKFIPALTLGFGICSLGTAFVHNIHSACGVRFLLGIFESGLLPGIAYYMSRWYRRSELVFRLSTXXXXXXXXXXXX-XXXXXXXXRLHSLGSLRTWRMIFVIEGVITCGLALVAFFTMTDRPSSAR--WLKDEERHLAIARLRSERVGTTEVL-EKLDTKKVLRGIFSPVTLTTGFI-FLLNNITVQGLAVFAPTIVRTI-YSVISQQLHTVPPYVVGACFTLFFPYLSWRMDRHXXXXXXXXXXXXXXXXXXXXSENPRVHYGASFLVAAGAFSFGALCNANASANVISDTS-RSSAIGTTVMLGN-IGGLISTWSYLAFDAPGYHIGNGLNLACASATFLLSIGLLMWMKWDNAKRETMDVDLHVEGKSLGEIQAMDWRNP....... 1001
88 0.000e+00UniRef50_U5H023 Uncharacterized protein n=4 Tax=Microbotryum TaxID=34416 RepID=U5H023_USTV1  ali  20  5.......................................................................................................................TPEEQKAFEKRVVGKIDMRIMPLIILSYLINYLDRSNLGNARTLNLVETLKLSGMRYNIVVAIFFITYVLFEFPSTFLMKKFTPSRWLSRIMVTWGIVTICSAAVKSYTGLIIARLALGVAEAGFFPCCLYLFTFWYKADERATRMAWFAASVAVSGAFGGVIATGV-SYLSGEGNLXXXXXXXXXXXXXXXXXXXXXXXXXXDWPETAT--FLNEEERAFAMARL---GDGAPRSTDAHFNRADFFATIKSWQFYAFAVAYFFMAN-SLNAFGYFGPTIIKNLGYHGAKAQLMTVPPNIVAFFVILANAMHSDRTRERPKHIIAGLLFVGLGYILLATVKTTGVRFFAVCCIASTNAAVMP-FVAWRASTVQGATST-AIATAFTVAFSNSAGA-VAPFLFIAKDGPDYTKGNWTC......................................................... 418
89 0.000e+00UniRef50_K5WSS0 Uncharacterized protein n=8 Tax=Agaricomycetes TaxID=155619 RepID=K5WSS0_AGABU  ali  17  2.........................................................STKSTSSTEIKEVDVSKTAHDEQASDGTLHQSGLGPPQRGHF---FSPLDPTWAEAVHRDAETVQYTAEEERRVRRKIDNRILPLIIISYLCNQFDRTNVGNAVIDAFNDNYEITTNQWTIALSIFYVGYCTLEMPANVLQRHIGANRFFFLSLTFWGLSSLSLTYAKGYAALLVLRVLMGIGEAGYYAGVIYYMSFWYTRSEMALRITL-GMTGTVPGVIGGLLAFGLVRA--HTSALAGWQFLFLIEAIPTLIMGTCDLFFLPAFPFAAS--FLTQREKAIAQARLNCDH--KPQSHGGMTGWQGFKAIISDPNAWLFMTTY-ASFNVGVATISYFLPTLIRDLGFSSINAQGLTVAPYAVGWFMVIIQAWHSDRTRDRGYHIMFSAAISFTGYIILATSKSVGAAYFALFLVVGGNFSLFPLVMSWATNTFS-PTSKRGVGTAFIVSISNCISIASPQIYFDSED--NFRKGHAIAASCLFISILAAFTAR.......................................... 485
90 0.000e+00UniRef50_B8M635 MFS transporter, putative n=1 Tax=Talaromyces stipitatus (strain ATCC 10500 / CBS 375.48 / QM 6759 / NRRL 1006) TaxID=441959 RepID=B8  ali  19  238.......................................................................................................TKGKENSLSTHESLEDADNLDKTAIRKLVWKQDLRIVPLSAFIYLLCYLDRSNIGNAKILNLLTETHMTNYQYTVALMVFLIAYALFEVPSNYLLKKLRPSRWIAFLMLSWGAITMGLGGAKNNAQVTGIRFILGVFEAV---------------SERSIRXXXXXXXXXXXXXXXXXXXXGV-GHLNQSHGLSAWRWLFIIEGAPSCFSALLIFFLLPDYPETS--HWLSAQEKDLAKRRLRVEGSQG---HAKGMTWEDAKSVLTEWRLYAHYAVY-FGISTPFSSLSLFTPSITAGLGYEGLRAQLMTVPPYAVAYVVTIAVAGSADYFNARGIHSAIFSFIGAMGFLASAVLPPDAHRYGCLIVAASGSFSCIPPLLGWLSSNL-NTTASAGLAIALNISFG-APGQIAGVWIYKSSEAKKYPTGHWTNAGLLLFVTVGCILLQIYYMYMNKRLRRLPG........................... 685
91 0.000e+00UniRef50_A0A146HST0 Tartrate transporter n=2 Tax=Mycena chlorophos TaxID=658473 RepID=A0A146HST0_9AGAR  ali  20  411.........................................................TAVHTSEKPASTNSDATAKSSITAVPLEDIDLDLPSPMAVRAHTYQSTTSDVEQTPSQIIR-----RQEAEKNLLRKLDMRLIPAIFVIYVMNYVNRTAITAARLKGLEHDLHLTDIQYNVVLSILFITLSLAQPPSNMILNKVRPSVYIGCCVIAWGLASALSGVVTNYAGILVCRLFIGLPEASFYPGAVYLLSCWYTKKELAIRTAILFSGLDIANAFGALVAAAILERMEGVCGIQGWRWLFMIEGCTTIFLGFLVMWLLPDYPRNTR--WINDHESRLAQARLAKDAGEADQDTEAGSRFEGLKLACADPLTWLFSLM--LFTQHLGRSVGQFFPTLAKTLGYSTTTTXXXXXXXXXXXXXXXXXXXXHADRTGERFHHISIWILAMMVGFVINLCTMSVAARYCAMFLMAIGDAGC-AMTLVWVSNSIPRPPAKRAAAIGITNGIGNV.................................................................................. 855
92 0.000e+00UniRef50_A0A094FXU5 Uncharacterized protein n=1 Tax=Pseudogymnoascus sp. VKM F-4517 (FW-2822) TaxID=1420911 RepID=A0A094FXU5_9PEZI  ali  15  17.............................SPSDHGSLKSTDVKHAIDLAPPPLSPLATQENQRMEAVLGDAILRFIGIRKGTKKDEYDLDAVATQPSIWDSENVEEYKKAYENWSAFDPSARWTWREEKAVRRKVDWKIMTWVCIMFFALNIDRGNIKNAVSDNMLDDLNLSKNDYNLGQTIARVGFLVAELPSQLISKRIGPDRWIPIQICIFSIISAMQFFLKGRASFLVTRYLIATFQGGFIPDTILYLSYFYTGKSLPIRLAWFWLFSALADIGVSFAAVGLLS-MRGFRGYAGWQWLFLIEGAFTFLIGVASFFLMPQSPAKTKSWWFTEKEEKIIVNSVIRDDPHKGGMNRQGLSVKQIWESVKDYDMWPLYALGLLFGLPKYPVDQYLTLSF-RSLGFTVVETNLLTIPSTIGYCLSMLIITAVSELVNNRSIVSMAEDAWLLPCFVALIALPDPPWAYFAIATVLLSFPYTHPIQVAWTSRN-AGTVQNRTVSASLYNMWVQVSGMI-GANIYQSEDSPRYFKANKGLLVICVWMCVIYPSTYFYYKWRNSKAKKWDALTPEEQDHYRTNTADVGNKR....... 587
93 0.000e+00UniRef50_O43000 Pantothenate transporter liz1 n=4 Tax=Schizosaccharomyces TaxID=4895 RepID=LIZ1_SCHPO  ali  32  19.............................................................................................................................KVEQKLLIKIDWFILSYCCVSYFINYLDRSSINNAYLSGMQEDLKMHGNELQDINVVFTCGYIIGQLPGSYALQRVPARXXXXXXXXXXXXXXXXXXXXHSVRALMILRFFMAVAEASTFAGTHYILGAWYKESELCKRAGIFSASGLVGTMFAGYLQTAVHSSLNGKGGLSGWRWLFIIDGILTIPLSLYGLFLFPDVPETTKAPYFTEQEKELSFKRL------PARPKKKPLTLKAIKDIVRSWRIYGLCILWIFSGETQAIAVNLMGQWMKWSNKFSVAQINNYPTVITAVGVVSTLGASVISDKLNPRWPFGLFLCVITTVSATILLAWNVPDGAKFFAYFASGCTYAGQAVWFSWANDICRDNDQERGVVVFLMNMCQNIWHIWWAPIMYPNTDTPRFIKGLIGLLVVGGIVFVSSCIVSYMQIRD-KRIKRSIQDAKDFDDVFTEHESL-ELKKIGKNDEE 481
94 0.000e+00UniRef50_A0A165F170 MFS general substrate transporter n=1 Tax=Calocera cornea HHB12733 TaxID=1353952 RepID=A0A165F170_9BASI  ali  19  15.............................................................................SALEMPTLNRDLDPTDVPREPDVTRPLLADAAERDSTDLYGDLDHVDSAAEKQLITSLDLRILPILGLMYMCSALDRGNLGNAESGGLSKDLHLQGRQFSMIVSALNVPYACLTVPGVMLARRIGAHVAMPLYMMCWGTFVLLNAAATNFTGMVLARFFLGAFEAGFAPTLISYLTSFYTRDELGQRVCAFYSMLAVAGALSGTLSYMIFQI--ESPSLRGWQLLFLTEGALTIVVALLSVAILPKGIKGCSFW--SNDQKSLAKRRILRDSSSKVEEEYSHI---QFFAPLKEPKLYMFLLIG-FCYGTTGAVAGTFLPLILGRMGLSPVQTNLLTVGPNVLGALCAVVTARSSDRFRERSXXXXXXXXXXXX-XXXXXXXXXXTLSYMGCFLLAAGAFPPSVLFHTWHNCNDT-SHDSRAFRTGLL-TFATNSGGILAANIFIPSDAPRYATAIGTSVVLETLGIGLVVILRFWMVRDNRLRDEREGIHRTSKDTPT................. 502
95 0.000e+00UniRef50_A0A074WEQ7 MFS general substrate transporter n=244 Tax=Fungi TaxID=4751 RepID=A0A074WEQ7_9PEZI  ali  19  2..................................................................................................ADIEKHVNHDGDSPKAASSISSADYTHINEKSLLRKLDWRLLPGVSLLYLVSFLDRSNVANARLDGLVDDLDMTGNEYLTGLTVFFVGYISLEVVWNLILKKIGPRXXXXXXXXXXXXXXXXXXXXXNKVGFFVIRTALGIAEGALFPGVVFYLSMWYKREERTYRVALFFSAASLAGAFGGILAYGI-GYMRGTAGXXXXXXXXXXXXXXXXXXXXXXXXXXXDWP--AKSTFLAPDEKAFVTARLKAD---SDASNSEEFEWSEVFKAFKDPKVWLYCA-HFHTLSLPLYTLSLFLPSIIKSLGYKASSAQLLTIPPYALATGLTVLYAITAERFRRRNVFIMTSSLTGIIGYIILLSTRHPAVSYVGTFFAAAGIYPSTALALSLPAINVSGQ-TKRATATAMQITIGN-LGAVLGTQLYRTETAPRYVLGHSFALAYLCMNVCVAGLTWW......................................... 450
96 0.000e+00UniRef50_C5MCR0 Uncharacterized protein n=46 Tax=saccharomyceta TaxID=716545 RepID=C5MCR0_CANTT  ali  15  25...................................................EDKSSLNSLNMDKGYIEITAESKKESASIEEDQLVNNPFLDPKVAEYYDN---LYQSCNYESYSAFDPNFEWTESEEKKVIHKINYRVALTSCFLFISLQVARGNFAQAVSDNLLNDLGLTTNDYNTGNTIFTVAFLLAEIPSQLISKALGPDIFIPVQICSWSVVALCQAALSGKTSFYITRALIGALEGGFIADLVLWLSYFFTSKELPIRLSWFWTTLALVQVGTSLLAFGILR-MRGVAGMAGWRWLFLLEGIFTLCIGISGFYLMVPSAVQTKNWWFTEREEKIVVNRILRDDPTKGSMNNQGLTLKQLVKSLHDVDIFPIFAIGVMAYIGTMTFNSYFVL-LNRQMGFSTFDTNLLMIPPQVLHIICLLLITWTSERLNERCFVAVVSPIYAATIMGIIRWWPGSGIQQWPTYVLNMGQPYIHAICVAWVSRNSNG-VRTRSISSALYNMAVQ-LSNIIGQNIYRQDDLPLYKRGNMQLFCFSLATIPIILLTKVYYVYKNKKRDEWSSMTEEEKENYRMNTKDEGTRRLDF.... 565
97 0.000e+00UniRef50_A0A0F4GCW3 MFS pantothenate transporter like protein n=28 Tax=leotiomyceta TaxID=716546 RepID=A0A0F4GCW3_9PEZI  ali  31  8..................................................................................................................RVAIWGVPPATKAESRLLRKLDGFILSYVCLMYWVNYLDRANLNNAYVSGAREDLNFRGTQLNQINTIFYGGYLLGQIPNNLILQKVPPRIWLPLTCFCWGMLTLGTAFVSHPWQIMVIRFFQGFFESSCFVGVQWILGSWYKPDEIGKRTAIFTSSGLAGTMFSGLMQGAIFKTLNGKAGLAGWRWLFVIDSLITFPIAIYGFLFFPDTPSSTTARYLSPAERTIAVERLPEVSKA-----RGVLGWSLIRRVVLSWHWWGFVLLWIAGSNTMYSSNAIMQLWLRSTGDYTIPQVNYIPTSVSGMGIVATLLLGWYSDYGSRPRWHVSILLSFTAIISGALMLRPPTPAAKFAALILNGCQFAGQTVSFAWANDLTRKDDAKRSXXXXXXXXXXXXXXXXXXXXFYNTTQGPDWTEGNWAMIGMV..................................................... 429
98 0.000e+00UniRef50_A0A1Y2G3J0 Major facilitator superfamily domain-containing protein n=1 Tax=Leucosporidium creatinivorum TaxID=106004 RepID=A0A1Y2G3J0_9BASI  ali  17  5......................................................................SPAVVSHAPQASTSSPDLDLERKHSRRSEEWLVAQPLDAKYEGRHRYDPVAEWTEEEEKKVKRKIDIRVMSWMCLAFFCLQLDRGNISYALADGMLADLKVDTNTYNNGQTIFYCSFLFAELPSQMAVKYLGPERWLPVIMTCWSIVALCQAFMVNKAGFFVTRCLLGLFEGGFIPGAILFLSYFYTRKEMAIRLAAFWGTLNIANIVGACIGAGLTS-MRGIHGRPGWSWLFLVEGAVTAVIGITTAFYLPGSPTQTKGYWFNEREEVIMVNRILRDDPSKGTHFRSPIGLQDIKAGLLDPSMTLLYWIGLISYIPTGTVGAYLTLTI-KELGFSTLKTNLMSAPAAAMTIILMSLVSWYSDKINSRALVALLGASWQIAPFIAVNFTEPTWWGRYVLGLVCVGYPYWHPILVSWVSEN-SNSVKGRACSTAFYNIFVQ-MGNIVASQIYRADDKPLYRRGNKXXXXXXXXXXXXXXXXXXXXMRMNKKEEAWSKLSTEEQEDYIVNGPDIGNKRIDF.... 529
99 0.000e+00UniRef50_A0A0D2HXU9 Unplaced genomic scaffold supercont1.2, whole genome shotgun sequence n=1 Tax=Cladophialophora bantiana CBS 173.52 TaxID=1442370  ali  20  8..........................................................................................SVAEVASLSSTEKAGDFKHAEEKVTGHVAEQEINPRVVRKIVRKIDARLVPILGLLHAVSLIDRGNLGGARIAGIDEATNLDGSRASIVILVFYIGYIVMEIPSNILIKKLGAANWMSFLAVCWGVVCIGIGYSKNWQTLAVCRVILGLLEAGIYPGAVYLCGSWYPRYEVQLRIAIFAMIGMFLSGFGNILAYGLTQIAQQPE-VNGWKWIFIVEGCLTLGVAVLVRLILVDFPHSKRNKFLTQDEKIIVHDRLVADRGL---HETEKVTWKVVGATFADWRVWAMQVPSHFSACTSNYSYTFFLPIILRGMGFSQEASFLLTAPPAFVSALIAIGTAYVADRLKFRXXXXXXXXXXXXXXXXXXXXCSNPAGRYTGVFFGQIGGNALAATTLAWMANNMRGDA-KRAVATAIQVMMGG-VGGVYSALVFRQQDTPNXXXXXXXXXXXXXXXXXXXXXXXXXXRRANRQADAGTRVIEGAAE.................... 487
100 0.000e+00UniRef50_A0A1Y2BB27 Major facilitator superfamily domain-containing protein n=2 Tax=Naematelia encephala TaxID=71784 RepID=A0A1Y2BB27_9TREE  ali  19  7....................................................................................................EDTVTQIHESATIATLEQPAYQLDDVQYKKLIRKIDRRLVPCLALLYLISYVDRSSLANASILGLKKSLNIDGKGYNLIVTSFFFSYSVFEIPSQIVINYVRPXXXXXXXXXXXXXXXXXXXXXQNFGGAFAARFCLGIVEAGFFPAAMLQVALWYPREELQKRVGAFYATGVLAGSFSGLIAYGIT-HMDGDAGLESWRXXXXXXXXXXXXXXXXXXXXXPDSPERAK--WLTTDEKEQVIA--ARTYSGAGAQESQEWTMHHLKEAATDVKVWLYVWLSI-CINISSIGFSYTLPTVLLQLGYSAANAQLMTVPIYAVAALCVVTAAYFSDRIQQRSFGCLCGFTVGLIGLVVLYCMPKSGVRYFFCMWVLGGLFAIYPSILSWNSNNNAG-RGKKNMAVTLQLAIGNLSTA-AGNNSYLASEAPNYKTGFGLGIALCASGILVTLLLSYILRKENARKA............................... 463
101 0.000e+00UniRef50_UPI000D77AB89 MFS general substrate transporter n=1 Tax=Pseudomicrostroma glucosiphilum TaxID=1684307 RepID=UPI000D77AB89  ali  17  2......................................................................TSSPELPSRLSGTEHAGRGLSVFDDNCNSGDAAQHTFDAKTEKGLAEPLAHLEDKRRTAAIMRRLDIRILPVAALLYFFSFVDRTAIGNSKVAGMDKDLGLTEGQYELALSCFFITYAMLEVPSNLCLRRFGARKWLPLTALPWGLLMILTGTVQDYRGLIVCRTLLGVFEAGIAPGLALMLSLVYPQSAIQLRIALFFAAASLGGAFGGLLAYGLSKI--QTVGFDGWRWIFTIEGILTMLSAIPAYCFLCNGLEDAKGI--SDDDRAYMKERIIHDGSQGGVIEV-KFKVQYIWDAFKDFKVYILACXXXXXXXXXXXXXXXXXXXXNTSFGYDHIKSQXXXXXXXXXXXXXXXXXXXXSDRHQARILYYIIAMTIALIGCLISFKSDDPKVRYAGSFLAVPGVFAAAPCHIALGSQNLAH-KTKRGTGLAILMTFSAIVPT-TSSALFPTNEAPRYPTGHKVCISCGVLGIAFAIAYGYALKWENDKKRQMRESGEAERLTREELIDLGDKSP....... 510
102 0.000e+00UniRef50_A0A1E4S104 Pantothenate transporter n=2 Tax=Cyberlindnera jadinii TaxID=4903 RepID=A0A1E4S104_CYBJA  ali  25  2...........................................................................................SKRTEQVQVTSDEIVLKDEPSFWRKVFPKVEYKSPREKKFVRKVDLFLLTWTTVAYFMKSIDQSNVSNAYVSGMKEALNFQGKDYNWLDTYFKIGYSISLIPSQILMNKVKPAYLLSTFEIIWGVLVALCSIPKSPQGLYPLRFFIGFFEASSWPGIIITLMNYYTKEELATRIGIFQASYYAGNMFSGFLQSAIYKTLNGVHGLEGFEWLFIINGLMTIAVGLTGYFFIPDTPQNGSKIWMNESDVEIAVERMQRVGR----ETTRRFRFKEFYEVFLDWRLWLFLAAY--CPKAWCAAFSYFNLWLKSMAHWSVEQVNLIPIGGNAISMVSVIFWAKVSDLTQSPGYVLGIQLLIDFFSNIVLAIWPSNNGIKYAAFFMIPISDGVTSLLISLLAEVYALSPEKRAIATGAAVVLVYANNAWLTLYLWPANQAPNFKWGYKMSILFVGVSFFSSISYVIFVYKLNRIRASENGVIEVSDPEFAEEDSD............ 500
103 0.000e+00UniRef50_A0A1E3QAB3 Uncharacterized protein n=3 Tax=Lipomyces starkeyi NRRL Y-11557 TaxID=675824 RepID=A0A1E3QAB3_LIPST  ali  31  18........................................................................................................PEKTKWQRLKEGVQWYRPGTTTAEKKMLFKLDCAILVFGCLSSFSKTLDNSSLTNAYVSGMQRDLNLGGNDLNYLTAVYYASYLSFMIPGSFLLTRLPIQRVLPTMEILWGVCTFGCAWAHSLRDLYVCRFFLGACETVAFTGLIYVIGSWYLREEMGVRVALFNISGPLGSMFAGYLQTATYTRLQGRHGIEGWRWLFIVCFCITIPCALIGYVFFPNSPNNTKPFWLSQEEIDLANKRLQEEGIRKID---KKIKWKELIRVLKDWPWYFFVFGWCLYDQNQYFSTTPFSLYLKKSVKYTIPQVNNYPTVPKAVSIVTTILGCYYSDKTGDRFTPCLIATVLNVVAAAILLGWNVSEGWRLFAFFVSGISSSMNPFQMSWASDVVKEDPEARSLITASMNCIGQVFLAWVPIFTFPIPQAPRFTR.............................................................. 444
104 0.000e+00UniRef50_A0A135LFL4 Major facilitator superfamily domain, general substrate transporter n=1 Tax=Penicillium patulum TaxID=5078 RepID=A0A135LFL4_PENPA  ali  15  5.................................HPSAAGNNASSTASSTSSNPQFTPVSYGSDEDRPVPGPAKSPIGPLRLQTNFDDHLDVGDPLSDFENDGDYNTRGETEGKLQRSGLGPRYTIEEESDVVRRFDRRLVPFLALLYLLSFLDRSNIGNAKIAGLQDDLQLSSSQYEWLLTAFYITYILFEW-MTLMYRVVPPHIYISLCVCGWGLVASFQCLATSFGGLVVLRALLGITEAAFGPGVPFYLSLFYRRHELAFRNGLFISAAPLATSFASSLAYLIVRFSSD-GPISPWRTXXXXXXXXXXXXXXXXXXXXPDSPGRAR--FLSRRQRVVAQQRLEESTADYQQSYGSRFNWREILKTAADPKAYMAAFM-FFSCNVAFSSMPVFLPTIIKDMGYSSLQAQALSAPPYLVAFVVVLLTAYASDRSRSRSPYLIAHALISSLAYLAIAVWLHISIRYICVYPATAGFFSAITLIITWSMDN-RVEKEGKGASIAILNIIGQC-GPLLGTRLYPETDGPWYIRGMATCSFFMVVVAILAVGLRILLQRMNRATAETTYTIVQAGPADQGEERD............ 555
105 0.000e+00UniRef50_A0A194X9D7 MFS general substrate transporter n=8 Tax=leotiomyceta TaxID=716546 RepID=A0A194X9D7_9HELO  ali  18  2....................................................................................................DKSSINTDTDGASPTEAIHVETPDPETSKRLVWKLDLIVLPLLAIIYFTHSLDRANLGNAKTDGFEKDIGLKDNQYSLILILFYIPYGTLNIPATVLAKRYSPAVVIPCLMFCWGTIAASTAAVHNFGGILAARICLGVVEAGFFPSAIFYLTMFYTRTEIAKRISLFYMMGFVANAFSGLIAYSVFQ---WHRSLYNWQYXXXXXXXXXXXXXXXXXXXXPRSI--AKSNYFTEAEKQCSKLRLQAE----SEIEGDSFSWSATLTPLLDWHSWMYGFMA-LCYGCAAASISNFLPTIVKRITVNTVKANLYTVAPNLSGGVFIVLICWLSDKTQQRALCAIGAVAISMIGFICLGTVDITHLGYFFTFLLTFGSFTPAVLVPAWLSSN-SISTSGRATTVGLVAGLQNIAG-IISSESFRSQDAPIYAPALIISGCFEGAMCVTAAFAYLYYRTINRRLDSGKMQFVRGME.................... 465
106 0.000e+00UniRef50_A0A146HEU7 Uncharacterized protein n=2 Tax=Mycena chlorophos TaxID=658473 RepID=A0A146HEU7_9AGAR  ali  21  79..............................................................................................RNEAMEKGLDVEHGTQEYETKSVVSLASYDSRNDAALVRKQDRRIVPLSAGIYLLCYLDRANIGNAKVLNLLSETHMTDYDYTIALMVFLVAYAIFEVPSNYLLKRLRPSRWIAFLMFAWGAITMGIGGTKSYAAVTVARFLLGAVEAGLFPGLVYHLTFWYRTEERSMRXXXXXXXXXXXXXXX-XXXXXXXGHMNGASGLSAWRWLFIVKGLPSLLSSVLVWFLLPDYPETA--VWLSPDEKTLAASRLRDQASLGS---SKPMTWVDAKTTLTDWRLYGHYAIY-FGISTPFASLSFFAPSIIAGLGYTSLNANLMTVPPYAVAYVFTILVAWSADRTNSRGLHXXXXXXXXXXXXXXXXXXXXXXHRYACLIVATTGSFACIPPLLGWLSSNI--DTTAAAGLAIALNISVGAPGQIVGVWIYKADQAARYPTGHWTNAGLLLFVAVGCAVMVGYYRAANKRMGEGEA........................... 550
107 0.000e+00UniRef50_A0A1Y2LN51 Uncharacterized protein n=2 Tax=Dothideomycetes TaxID=147541 RepID=A0A1Y2LN51_EPING  ali  17  2.....................................PSTIRPLRMVVDERASDSTTDSASPRPTPSRSSGSSENLPMLNEPNAYELQPISHSVPASPAEKEDEDGDYARSTRRLSFDSYELYTPDEDRRVLRKLDRKLVGFMALLYCLSFLDRTNIGNARIAGMQRDLQLSSKQFEWLIWAFYITYIGFEW-MTLMYRIVPPHIYISICIFSWGLIACLQSIAPTFSVLVALRALLGIGEAAFSPGVPFYLSFFFRRRELAFRTGLFISASPLSSAFAGALAWLITK-LASHTPLSPWRLLFLLEGFPSMLVAVWAFSFVPDGPG--SVGWLTARERKVAVLRLRQEKEGAHXSRPPALNPSEILHTLLDPKPHLTALM-LFSANVAFGSTPIFLPTILHSTAHSALTAQALTLPPYLLAFLSVLATAHLSDRAQSRSPXXXXXXXXXXXXXXXXXXSPHTLLHYFALFPAVAGFFSCVTLIITWTLNNQR-DATARGAGIALLNLVGQ-FGPLVGAGLFPEEQGPWYVEGMAVCAGFMGAVAVLAGVLRAVLAREN................................... 543
108 0.000e+00UniRef50_A0A0J0XPR0 MFS general substrate transporter n=31 Tax=Tremellomycetes TaxID=155616 RepID=A0A0J0XPR0_9TREE  ali  19  2...........................................................................................SEKLEAGVPEKQVHVGETNEYLLQLESMPADERAALEKRMLRKIDIRLLPWMTLLYLLSFLDRVNIGAAKLNTLEADLNLTGNMYNIASLVFFVSYVAFEIPSNLVLKKLRPXXXXXXXXXXXXXXXXXXXXXXTYGQLVALRFCLGLAEAGLFPGLNFYLTGWYRRGELNKRVSFFFAGAVLAGAFGGILGYG-FAKMDGVGGKAGWCXXXXXXXXXXXXXXXXXXXXXHDWPDRAR--FLTPLEREFVLLRLRQDTGLGTAGN---FSWRVAASALKDWKTLCFSLCYV-GAAQCIYSQSLFAPSIVAVLGWTRPQSLLMSVPPYVLAFITTMGTAYLSDKWMKRGVFNMFWSSLACIGYIILLTTTPKGAQYFAVFLTTMSIAPLISTTISWAGGSF-GSHYRKAVALGMIFSTGN-SGGIWASLVYRNQDAPPYQPGHGXXXXXXXXXXXXXXXXXXXXRRANKQREELYGPAPDESETHEEILELGDRHP....... 514
109 0.000e+00UniRef50_C7ZIF1 Predicted protein n=46 Tax=Fungi TaxID=4751 RepID=C7ZIF1_NECH7  ali  15  8....................ITHSPAGSDTPSEHGSLESQKRPTATYGALAPTAPALASQENQRMEGALGDAIRFLRIRKGPKGDEYDPDSIATQPSIWDSENLEEYKQLYENWSAFDPNFRWTWKEENAVRHKVDWKIMVWVCVMFSALNIDRNNISNAVSDNMLDDLGIDRGDYNIGQTISRVGFLVAELPSQLISKRIGPDLWIPIQICLFSLVSAMQFFLSGRASFLATRYLIATFQGGFIPDTILYLSYWYTGKRLPIRLAWFWMSSQLVDIGVGFAAVGMLS-MRGILGYAGWRWLFLLEGAFTFCVGVASFFLMPQCPAKTKSWWFTEKEEKIIVNSVIRDDPQKGGMNRQGLSVRQIWECAKDYDMWPLYALGLLFGLPKYPVDQYLTLAF-RGLGFSVIQSNLLKIPNIVGSCITMLLITAFSELVNNRSFVAMAEDFWLLPCFVALIALPNPPWAYFAIATVLLSFPYTHPIQVAWTSRN-AGSVQNRTVSASLYNMFVQVSGMI-GANIYQPDDAPRYFKANKGLLVICIWMCLAYPGTYFYYRWRNRKAKKWDAMTAEEQHHYRTTTTDEGNKRLDF.... 588
110 0.000e+00UniRef50_A0A0L1J591 Uncharacterized protein n=6 Tax=Aspergillus TaxID=5052 RepID=A0A0L1J591_ASPNO  ali  20  5..............................................................................................SEPKPDVESPRQGSNMIAPQENDTGSSFLEGESEKHLLWKIDIHILPMVVLLYLFSFLDRVNIGNARLYGLEEDLGLVGNQYQVAVSILFVTYCLFEVPSNLVLKKLRPSRYIASISVIWGIIATLTGITQNYGGLIACRLLLGVVEAGLFPGLITYLTLFYSKRELALRTGYLFSSAAAAGAFGGLLAYAI-GFMDGISGLRGWRXXXXXXXXXXXXXXXXXXXXXXDDPDTA--YYLNEEEKALVVRR--RMRYVGQTASAQKFHWADVKEGALDWRIWAFSIAQ-FGIDTMLYGYSTFLPTIIKGMGWSTPEVQALTIPCYALGALAYLVTAWVSDRTQRRGLFICIFCAISVVGYGILISDTSSGVHXXXXXXXXXXXXXXXXXXXXXXXXXXPR-YGKRTFATGLQLTFGNISG-VMSPFLYKNNEAPRYVRGNXXXXXXXXXXXXXXXXXXXXXRQKNIRRVQGLEDEKVAGMTEEEIEELGDKSP....... 489
111 0.000e+00UniRef50_UPI000D7ED388 MFS general substrate transporter n=1 Tax=Acaromyces ingoldii TaxID=215250 RepID=UPI000D7ED388  ali  20  27............................................................................................................................SEEERQLRWKLDLQIVPLSLVIYTLSFLDRTNIGQARLQGLQEDLDMSFHDFQVALTILYVPYIIFELPSNLIIRKVGPARLIPLLLTIWGMVSCVQGTVRNKTGLYINRAFLGLVEAGVLPGLSVYLSFFYTPREMQLRQALYFSGASLSGSFNGLLAVAI-GELGGRRGIAKWSXXXXXXXXXXXXXXXXXXXXXPNSINNA--WWLTEAQRDLGRRRLALARHPDLDAVGEKFSWSEVLRAFTDPFVWLM-FCAGFCSATSIYGLSFFAPTIIKSLGLTSVQSQLLSVPPFFAGFLFSVAFAFFSDRLQWRYLSGASAFTLASVGYLIALCTSTGWAQYAGLMVLCAGSFSIPPMLLTWALTNVWG-YYKRATAAAFLICATNSAG-IAGTWLFSPQEAPRYFRGFGTNLALNIMGIVFLSLAELW........................................ 467
112 0.000e+00UniRef50_C7Z3G0 Uncharacterized protein n=70 Tax=leotiomyceta TaxID=716546 RepID=C7Z3G0_NECH7  ali  22  4....................................................................................................SEKIIDDEVGRLSENIQDSNLFLDPQSEKKLVRKLDIWIAPVMTIIFLTAYLDRANIGNAASAGMTEDLGMTSGEIGDAVTLFYVTYVAAEVPCSLVLKKFHPSRMIPLLIFCWSCVLIGTGFMHNVGQLYASRLLLGLFESGMFPCLALYLSTFYSPGEQALRISYLFVSAALSGSFGGLFAYALLK-MDGVGGLEGWRWLFIIEGCASILVAGFTYMMLPDDFEHAR--FLNEDEKSMMRVRAEINARYNGKPD---FDWEEVMRAVRDPKLYISC-WSQFMADICSFGLSSFLPLIIRSFGYGVVTTQXXXXXXXXXXXXXXXXXXXXSDRWKQRALFMMPAALVTAVGYAVNIGVPIKGVLYFSTFLIAPGVYMIVGLNCAWLLNSHA-PYYKRAMAIGMNQSIGNTAGIVVG-QIFRTKQNGKYLM.............................................................. 433
113 0.000e+00UniRef50_I1S354 Uncharacterized protein n=99 Tax=leotiomyceta TaxID=716546 RepID=I1S354_GIBZE  ali  17  3..........................................................................................AGVESDRYSPTKEEEGIATNSDGPVNDTSVPYVSEETENRILKKLDRRIIPMVCWIYLMNFMDRVGIGNARLYGMEEELNLGPNQYQLAVSILFVTYCLFETPSNLIIKKMQPARYIAGLCFFWGIVACFTGFVTNLGSLIACRLLLGTFEAGLFPGIMLYLTTFYHKKHISLRNAYFYSISAISGAVGGLVALGIGELDNGAGGWRAWRXXXXXXXXXXXXXXXXXXXXLPNTPGTAKC--LTPEDRQALID--LRSAEIGQTASGQEMHKEDVIAAIKDWKIWALSIAQYCSHSV-LYSFSVFLPTIIREMGWSPKQIQGMTVPVYVVGFATYLICARISDRTQQRXXXXXXXXXXXXXXXXXXXXNYNQAMSFAGCXXXXXXXXXXXXXXXXXXXXNQPR-YGKRAFASGIFITIGNSAG-VAAPFLFSKQDEPHYRPGYAATIGMLFLAVCIHTTVYLHFRRLNKRKLSGQEDWRMEGKTEEEIAEMGEHNP....... 498
114 0.000e+00UniRef50_L2G1S4 Major facilitator superfamily transporter n=18 Tax=Dikarya TaxID=451864 RepID=L2G1S4_COLGN  ali  25  6.................................................................................SHEVNSAMSPAASDIGVGAHEAHNVSFGKKILYHLWDADQHLKSPQERALVRKLDFGILICATLGWWMKYIDQSNITNAYVSGMKEDLNIKGNEYTYMLMCYTIAFAIMQIPANMIALKVRPRICLVVCELGWTAFTFAQAAAQTSNQMYAFRFMVGLFESPFSPIIIFLLGSWYTKTELAKRVAVWHVTGFFGQATSGFLQAGIHKGLDGHLGMAGWRWMYIICGCMSLPIALSVWFLLPDYPHNTTAWYITEEDKQLAMQRSAKLGRV---EITGVMDLKLVKRMFGNWRWWVLCLMYIFYGNSC-QANNYFAIYL-RENGYSVTQRNVIPACANLVTMVTDFSWGFMSDLTGNRPMWMVGPLLTTVVGSSILTAYPASDGARVAGFFLVACGY-VTAVTWTWANEVNNGNAEERALTISSMNGLFYATNSFLPILIFPQTMAPTFERGFPSILSFALAAVVLVLVADFLHKRQLRQEAAAVANQPASEAEVADPVDAQEKE........ 504
115 0.000e+00UniRef50_A0A284QYL9 Related to nicotinamide mononucleotide permease n=1 Tax=Armillaria ostoyae TaxID=47428 RepID=A0A284QYL9_9AGAR  ali  18  4....................................................................................................HSDTKDSRITGGDSMVEHGAKQWTEAEERRLVQKIDFRCMPALVILFILNF-------------------------------------IMQIPSNLIMNTIPPRLFISAVVMLWGGISALTSLCHDFSHLVVCRFFLGFVEAAFYPASVYYLSRWYTRKEIGLRIAFLNAGNMLAQGLGGLLAAGILSGMEGTRGIRGWRWLFIIEGSITIAFGCLIPFILADYPSTTKS--LSERERLIAQGRLVKDVGIVDNPDEEERTFRGLLQAITDVKVWGLAFMYF--TYLMGLSFGQYLPTITATLGFSTTITLLLTFPPWAFATLFALANSWHSDRTGEKFGHIALSYGFALLGYIVALSAKTVAGRYVSLFGMCMG-FSGGIILLGWISTSIPRPPVKRAASIAFVNGFAN-IGQIPASYLWPSKWGSKYWQSFVTEICLLVLSLLIGLVYRQYLISLNKKLEKGEAEAFDASAEVVERSAD............ 446
116 0.000e+00UniRef50_A0A094AQJ2 Uncharacterized protein n=1 Tax=Pseudogymnoascus sp. VKM F-4513 (FW-928) TaxID=1420907 RepID=A0A094AQJ2_9PEZI  ali  20  892...................................................................................................................................................LVSFLDRSNIGNAQTAGMGKSLDLSDSQYQWLLTIFYIPYITFEW-MALMWKLVPPHWWAFCTVLVWGIASTLQATAQNWASLMVCRFFLAVAEAGYAPGIPYLLSFFYMRNEIGLRCGIFLSAAPLATCFAGALAFGITS---GHSALENWRLLFLVEGLPTVILAFVAFYVMPDSPENAR--FLSEEEKEAAKARAIRQVGTEGAERVGHIDYKDVVLALMDSKNWITALMYFSC-NVSFSSLPVFLPTILTGMHFTSIDAQGLAAPPYFLSFMICILSTWIADKTQQRXXXXXXXXXXXXXXXXXXXXXXXTAVRYXXXXXXXXXXXXXXXXXXX-XXXNNQGTDTKRGTGMALLQMVGQC-GPLLGTRLYPQNEGPYYTKGMIVCAAFMFFNAFLALVLRFLLRRENKKFEEAERFAGHEARGDEKGTD............. 1315
117 0.000e+00UniRef50_G2XXZ0 Uncharacterized protein n=21 Tax=Leotiomycetes TaxID=147548 RepID=G2XXZ0_BOTF4  ali  20  131.......................................................................................................DETRRRRRGSFSTVQSYQLYTPDEERTVVRKFDRKLVVFVALLYMLSFLDRSNIGNAKIAGLERDLHLDSNKYEWVVTAFYIAYICFEWMS-ILWKXXXXXXXXXXXXXXXXXXXXXXXXXTSFAGLLVLRTLLGIGEAGFT-GIPFYLSFFFKREELAFRTGIFLSAAPLATSFASSLAWGIVK-LGERSPIAPWRLLFLVEGFPSVLVALFAWHHIPDSPNTAS--YLTTREKKIARLRLRHEVTSSPSAKTTPLKIREVFLTFRDPKVYLTALM-FFFSNMAFSSMPIFLPTILTHMGHSASTSQALSAPPYLLSFFSVLLTSYLSDKFCSRSPFLIFHALLSSLGYTLLALPPHPSIRYLAIYPACVGFFCVITILITWTLNNQPSS-SRQGTGFAIMQMVGQC-GPLVGTRLYPETQAPYYTEGMGVCAGVMFGVAGLGWGLRWWLGRENQR................................. 585
118 0.000e+00UniRef50_A0A1Y2LS80 Uncharacterized protein n=1 Tax=Epicoccum nigrum TaxID=105696 RepID=A0A1Y2LS80_EPING  ali  21  3....................................................................................................ELRKHSVAESKIEVINDTAGTHIDAIAEKKLLRKCDFYVLPPLFVLFLLAFLDRTNIGNARIQGLEKDLDMHGSDYNIALFIFFIPYILFEVPSNLVLKKXXXXXXXXXXXXXXXXXXXXXXXXKNFEGLIALRVVLGFFEAGLFPGCIYLISMYYKRYELQWRMTXXXXXXXXXXXXX-XXXXXXXXKMDGIAGYRGWRWIFIIEGIVTVVMGFVTKFWCTDWPETAS--FLNEDERALLIARLSSDTG---DAVMNRLDKRAARRIFSDPKIYLGTLAYFGIVNTG-YAGSFFVPTIIKELGFTSAQAQVRSIPIFVVATITAVIAAYISDRIRNRXXXXXXXXXXXXXXXXXXXXXHNAGVKYFALFLVVPGGYVTQPIVLAWMSNLVSG-HYKRSVSSACQVGFGN-LGGIVASNVFFQSEAPKYPTGYGVSLGMLWICGAACTSLLFLVKFENKKRGRGERDWRLEEP---DADNLGDDHP....... 478
119 0.000e+00UniRef50_M2QV91 Uncharacterized protein n=16 Tax=Dikarya TaxID=451864 RepID=M2QV91_CERS8  ali  21  2................................................................................................SDEKYASSAGSKSVDAHDEAGMTLDQYDPAVVQRTWRKVDLHLMPVAVILYLSAYIDRANIGNAKVLGLAKGLNLTDGQYNWALSIFFIGYVIFETPSNILLKRWSPRYYLPALTVLWGLVCALTAVVTSSGGLLAARFFLGFIEAGFLPGLVYWLSCWYPRPMQGRRFAVLYSTVSLTGAFGGLLATGIHA-LDGTHGIAGWRWIFIVEGCITAGLGLLAFLVMTSYPTTAS---FXXXXXXXXXXXXXXXXXXXXXHEAEGFSSVQIRSAFTDWRXXXXXXXXXXXXXXXXXXXXX-XPSVVTGLGYEGTRATLMACPPYGFGFVIVLIAGWTADRYGKXXXXXXXXXXXXXXXXXXXXXXENLVARYXXXXXXXXXXXXXXXXXXX-XSSNVAGS-NKRAAATGIVFSIGNIGGAVSG-QIYRAEWAPRYVQGHAINLGCYVLALLSGAALWYSYKYDNAQRDREHGAKKHADLIGEDLGDLGDRHP....... 483
120 0.000e+00UniRef50_A0A164RKG9 MFS general substrate transporter n=7 Tax=Sistotremastrum TaxID=139133 RepID=A0A164RKG9_9HOMO  ali  19  1....................................................................MAQLNEKALGTQPTQNYTGVPDSPTNDDHSSDKGYTIDQKTEGGSQQLLADSPPQLSEAQKALYRKIDWRTMPILALLYLCSQLDRGNIGNAAIEGLTKDLNLTGNRYNIALTMFFIPYCLLEFPSNLVLKYFRPSRWIPLLTVIWGVVMTMMGLVKNYHQLVGVRACLGVAEAGLFPGVAYYLTFWYPRHELSFRXXXXXXXXXXXXXXX-XXXXXXXSFMEGIQGLHAWQXXXXXXXXXXXXXXXXXXXXXYDFPATAS--YLKPHERAYVVWRQKFAYSEQGEDED--FSWQYVKDAICDWQVYTHVLLYM-SIIGPLYGVVFFTPSVVKSFGFDTADTQLMTIPPFVFGTIVLLFNTFYSDRTGLRSPFILFALTLNVIGYSILLSDVKWGAHXXXXXXXXXXXXXXXXXXXXXXXNNFAG-HYKRCVGMALHIGIGNFSGAMFS-NVYRSKDAPRYKLGHXXXXXXXXXXXXXXXXXXXXXRYINAKRAKMVAGGEGGEGSGEEVRRLGDKSP....... 514
121 0.000e+00UniRef50_A0A1Y2EJX0 Major facilitator superfamily domain-containing protein n=6 Tax=leotiomyceta TaxID=716546 RepID=A0A1Y2EJX0_9PEZI  ali  17  2........................................................................................................................SPWTVEEEAAVRRKLDWQVVPTVTVLYMLCFLDRANIGNARIQGMGTELNLVGYRFNWALSVFYIVYVMIEVPSNIILKRVGPRFYIPGLVVGFGFVSMCTAFVQTFEQLCGLRALLGVFEGGTMPGIAFFLSSFYKREELLFRVGIYVASASMAGAFGGLLATGLSRIPPWAAPVTTWRNXXXXXXXXXXXXXXXXXXXXPQSPGVSTR--LTERERWIADERLRLEHKMISD---EQVKLRHVKRAVMNINNYV-CAGGFFLINITVQGLSVFMPTVLADLGWTATKAQXXXXXXXXXXXXXXXXXXXXSDKTRMRGLWLALFTLIAITGFSILRWSHNPSLKYMGVFFCTVGAFPGGPGFLSWGLNNASGPAV-RAVSGGWIVTIG-TLGGVLATWTYLARDGPDYPIGNSINLGGQILTLFLTLFGIFYCMWENRLRERGGRDYRLEGLTEEEQAGLGYRHP....... 462
122 0.000e+00UniRef50_A0A2H3I3E8 Major facilitator superfamily domain, general substrate transporter n=1 Tax=Penicillium occitanis TaxID=290292 RepID=A0A2H3I3E8_9  ali  20  3........................................................................................NHKDAAVELEHYEDAKVDATSDAQVKSVDAVNDPEQALKERRIVRKLDMTLMPMIWLLYLFNYLDRNNIAQAKLNHFEAELGLKGDNFNTAVSILNVGYMLMQVPSNMLIT---PS----------------TAGVKSYAGLVLVRLFLGVVEAPFFPGAFYLLSCWYTKKELALRTXXXXXXXXXXXXXXXXXXXXXXXXXDGARGLSGWKWLFIIEGAGSFFVSLFAFFLIPDTPNSSRSRWFSEEECLIAKERIIRDQVSNQVSENSV--WYGLRLALLDYRVWVFSLI--LCSNHTAYGFNNFYPTIVKGLNLNTTVTLACTAPPYLFATIFALATAYSSDHNKERGYHIAGNMALAIVGFVISLSTGHSGVQYFASFLYITGAFSANALVYTWAAASVSQTPEKRACATAIINLMGQ-VGNIWSPYFFRPQDAPHYNXXXXXXXXXXXXXXXXXXXXKWTLRRDNKKL................................ 465
123 0.000e+00UniRef50_A0A084GHW6 Uncharacterized protein n=1 Tax=Scedosporium apiospermum TaxID=563466 RepID=A0A084GHW6_9PEZI  ali  23  1................................................................MQSPTTQRKGSSDQIQTAPEHDNPSVIDEKLEKVVQIGEIRVLGLDAEDEEFYVNFGEERR---KKLVHRIDIRLAPMLAILYLISNLDRTNIGNANIEGLSEDLGLTGVQYNTALSILFVTYVGFEVPSNMILKKFRPSQYIGIIVTCWGIVMTLTGVVQNYAGLVACRLLLGLFEAGFYPAAIYISSTWYRAQELSTRIAYLYLTSALASAFSGLLAAAI-AGMDGVGGYAGWRWIFLLEGIGTVVLGVMCFFLLLDSPRLSK--WLTPEEVRYLEIQQFIQDGGEFGKRSNQATWKVLRATLLDWKLYGTSLL-LFVNITAGYGVKLTMPAIIKGMGFKNRNAQLLTAPPYLVGALSTIVSSKISDRFFKR........................................................................................................................................................... 368
124 0.000e+00UniRef50_UPI000440CF0B MFS general substrate transporter n=1 Tax=Stereum hirsutum (strain FP-91666) TaxID=721885 RepID=UPI000440CF0B  ali  19  2......................................................................................SQSDNEKKNDGETSVVIQGASMYEEELEDFKVLNAKYTGPVLRKLLWKVDLRLIPVFALLYLLSFLDRGNVGNAKVAGLLTTIPMTDAQYNTALSCFYVFYIVFEIPSQIALKKFRPKWYISAMTLSWGLVMTLTSLIQSYHGFQVARIFLGITESGMFPAAGYTLSTWYSRTELASRVSIFFCSASIAGAFSGILAYGI-SFLDGKAGMEGWRXXXXXXXXXXXXXXXXXXXXXXDSPHSGK--WLTDEERRFLILR-QRYSTTGVIPPAEHFDWKYVKMAFSDWQMIPQIGVFITHSAIGV-SISFTLPVILKSLKFTTIESYLVPVPIYAAACGVTYFNSWLGDRRQSRFLHILIPFCVAVVGVVLCLATAGVGVNLFGLILIVLASYSPVPSSISWCANNVIG--YKKVISMGMLMGIGNLSGLI-ASNIYLTRESPRYHTGYGM.......................................................... 447
125 0.000e+00UniRef50_U4LPJ2 Similar to Uncharacterized transporter C1039.04 acc. no. Q9US37 n=8 Tax=Fungi TaxID=4751 RepID=U4LPJ2_PYROM  ali  17  45.....................................................................................................................................KFDYTILPVVTLIYLMAFIDRSNMGNAKIMGMEEDLHLKGYDFNIALTGFFVTYVLFEVPANVLCKHFGPRXXXXXXXXXXXXXXXXXXXXDNKKGLIAARVCLGVAEAGIMPGITYTLSTFYRRHELVTRVGIYASVASVAGGFGGLLATG-FSLIPQWGMVHSWRNIFFFEGVMTIGAAIVCYCALPNSPGEAR--FLNKEQQVLGVRRIQLEALALA---TEKMQKRHFTAAILNFNTWLMS-IGLFCSLLCMNSVALFMPSLLRAMHFTSIKAQLMTVPPYVLGSIVCISAAITSDRFKTRXXXXXXXXXXXXXXXXXXXXXXNIAVKYFALFLVTMGAFTGSPVFISWTVDNSAGPTV-RAIASGFAVSLG-STGGLVATWTYLPSEAPGYTTGHIINLCAGIVFFLVTAITTTYLRWENRMRDQGKRDYRVEGKSEEEIATLGHSHP....... 503
126 0.000e+00UniRef50_M7TEE4 Putative major facilitator superfamily transporter protein n=7 Tax=leotiomyceta TaxID=716546 RepID=M7TEE4_EUTLA  ali  19  2..........................................................................................................................................LLPWLCILYLLAFLDRTNIGNAKIAGLPADTHLVGDQYNITLTVFFIPYALCEPVTNVLLKKWRPSVFIPTIMILWGASMTGMGFCHNFGGLATARFFLGLAECGLFPGVNYYLSCWYKRSEFGVRAAIFFSAAALAGSFGGLLAAGI-EHMDGVGNLEGWRXXXXXXXXXXXXXXXXXXXXXYDFPAEAR--FLSDEDRNRVIRRLWADQQSLAD--NEDWNMEHVRAALKDWKMWLGMLVYAGCL-MPVYAFSLFLPTIVQGLGHDPVKAQXXXXXXXXXXXXXXXXXXXXXDKTQQRGIWNILISCLGITGFAMLLGSKNPAVQYVGTFLGAAGIYPCIANTITWMANNVEG-VYKRGVVLGFVIGWGNLNG-IVSSNIYRN--APRFLEGHXXXXXXXXXXXXXXXXXXXXXXRENKKRREGKRNCWAEGKEHDELAALGDQRP....... 443
127 0.000e+00UniRef50_A0A093Z260 Uncharacterized protein n=1 Tax=Pseudogymnoascus sp. VKM F-4246 TaxID=1420902 RepID=A0A093Z260_9PEZI  ali  19  754...........................................................PDKPGLADRHAHHTGFTKEQFLEELAMEELKDSALHVEVTSATTKVGPTEEEIQLQEALRNYTPDTDAEKKLVRKIDLYLMPTLWIMYILNYVDRTNIGNAKIAGMEDDLTLDAQKYAWVLSIFFFGYLIMEVPSNMILSRSRXXXXXXXXXXXXXXXXXXXXXXPSYGSLLAFRFILGCVESGFFPGVLFVMSCWYKAAEIGKRFAIFYSASTVSGAFGGLLAGGITDGLHNAHGIAGWRWLFIIEGVTTVGVAIIAKFILLDFPQ--SSPVLTLEERQLATVRIIADSPTSGSASGSTSHLEAFKAAVTDPRTYFFMLL--FVLDVGAGTISYFFPTITKSMGYDTVTAQYMTVPVYAVAAVSLNICAYSADRNEERRWHITSALSLGFICAMVCAIVETPVVRYXXXXXXXXXXXXXXXXXXXXXSKTIDLPAEKRAIAIAMINAVGN-LSSVYGSQIWPTSSAPNYTLGWGITAGFLGAGACVAALM........................................... 1244
128 0.000e+00UniRef50_A0A0D2Y0P0 Uncharacterized protein n=3 Tax=leotiomyceta TaxID=716546 RepID=A0A0D2Y0P0_FUSO4  ali  16  1............................MAYSDDVRVSESKNAVDLHIDPTDSDSSKSIPSTKVIPATLPLAAPEEPRSWWQRRPRHDGEAVATRRSVFDDPDMARRYQPRPDWHRFDPSERWTFNEERKVIRKIDRRIMIFACVMFMALELDRSNLSQAVSDNFLPDLKMDTNDYNLGNTVFKLSFLCAELPSQLVSKYLGPDRWIPMQLCLWSLVSA----------------------GGFIPDTILYLSYFYTASELTVRLAFFWTAYNVADIISGFLGAGFLQ-LRGWHGYEGWRWLFLFEGLLTLAVGISAWFLMPAGPTQTKNGWFTER--------------KGDMHNRQPITPKLLWASIKDYDLWPIYAIGLTFLIPATPPAQYFTLTL-RGLGFNVLVTNLLTIPHTILSIGGLLLISYLAEKWNERSLLGLAVQIWKLPFIIYLYVVDMSTVNRWVSFAVLAGSPTAHPIQVSWNSRN-SNTVRLRTVSAAIYNMFVQSAG-IIASNVYRKDDAPRYREGNKNLLAIIALNITLYLLTRTYYIWRNKSRDKWDAMDDEQKKHYLDTTKDEGNKRLDF.... 536
129 0.000e+00UniRef50_A0A139AB89 MFS general substrate transporter n=1 Tax=Gonapodya prolifera JEL478 TaxID=1344416 RepID=A0A139AB89_GONPR  ali  19  2..................................................................................................ASKGETQVPFVESKDSEAGYVKKEWTDEEERKVMNKVNWKLIPWLMVCYMVVGIDRTNIGSAAIMNLEEELGMHGSDLNWATSAFFFGYVLFEIPSNMMITKTSPSVWISRIMTTWGIIAAVMGAVHNFAGLIAVRVLLGIMEAGFTPGAALYLTFWFKKYEVGSRVAYMFAGAGMMSAFSGFIAYGI-AYMDGVGGLTGWRWLFILEGIASSILGIATYFVLPDYPQTST--FLNSDERAIVVGRLP---PSAPSFVAKEMNWKEIAELLRDWRMYALASAQFL-ITVHNYGLAFFLPKVISAMGFVSTTALLIKVPIDFIGHAWNFYINWSSDRYQEKVYHSLVCALPVLVAWALLGTIQPYLSQYYGLLYLSIFYNGLPPMQIGIGATSTTG-ATKTAFRTGFIISMSN-IGGIVGGQVYQPDDAPLYIRGH............................................................ 436
130 0.000e+00UniRef50_A0A2I2FUD5 MFS general substrate transporter n=1 Tax=Aspergillus steynii IBT 23096 TaxID=1392250 RepID=A0A2I2FUD5_9EURO  ali  29  8..................................................................................................................REVVWGKPAPTKQERKLVFKLDCIIMPFICLMYWVNYLDRSNLTNAYVSGLKEDLKMYGTEYNQINSVFYVGYTVSQIPNNIILQKVSPQVYLTISMICWSFLTLGLAFVNGWHQIMGIRFCLGIFESATFVGSHYIMGSWYNQQEIGKRTAVFAASGVAGNMFSGFLQGAIYKNMNGLDGRAGWRWMFIIDFLITIPVACLGYFVFPGHPETTKSKFLTPEEKSLATERLPE-----PLIRRGALGWSLVRRVILSWEIYALSLLAVLAGDTEMWADNGILNIYLKYLGYSVELVNYIPTAVYAIALVSILLCSWYADYFQKRWHVGVFLSVTAIISGAIMLKPPSIGAKLFALFL-NGIQLGYRGVLFAWANDLMRKDDAKRXXXXXXXXXXXXXXXXXXXXXXYNTDQSPMWYEGSIALIVTGVCMIFSVGSVVFFERREAK.................................. 450
131 0.000e+00UniRef50_G2X2T5 Uncharacterized protein n=2 Tax=leotiomyceta TaxID=716546 RepID=G2X2T5_VERDV  ali  17  4......................................................PNEKPPAADKAIAQSATDSDNDATATPKSEEVYAGSGGKDTWAAGASGALYEPIPEYEGRHRYDPTAVWTEKEEKKLVRRLDYRICSWVCIMFFALQLDRGNISQALSDNMLDDLGLTTNQYNYGMTIFYVTFLSAELPSQMISKKLGPDVWIPIQMVSWSIVAACQSILVGEKGFYATRALLGLLEGGFIPDAILYLTYFYTSKELPIRLSYFYTSSYLTQIIAAFLAVGIFQ-LRGVGGWEGWRWMFAIEGGLTALIGVFSYLYMPPSPTQTASWWFTEREEVVMVNRILRDDPSKGMHNRQGLTLPLLWASLTDVDLWPIYLMGFTVLMPLRPVMAYFTLTL-RNLGFTTLQTNLLTVPAFAIFIFQLIFWSR----------------------------------RTLTSFLRAVG-----------LTSRNAGSVRTRTVGSAVYNMTVQTSSIILTAQIYRADDAPLYRRGNRAIIGIIAWNFASAFLVKGYYMWRNKKRDQWNALGAAEKDHYLATTTDEGSRRLDF.... 505
132 0.000e+00UniRef50_Q7SB45 MFS transporter n=57 Tax=Dikarya TaxID=451864 RepID=Q7SB45_NEUCR  ali  15  10......................................SPPSADGTNSPTESKGSNINVSSETLSSIPPLGIALAERRFWFQRASSYDPTAIATQVSVFDDPDTAEKYQPRPDWHRFDPLERWTWGEEHRLIRKIDWRIMVWACIMFMALELDRANIGQALTDNFLGDLHMTTNDYNLGNSIFKLAFLCAELPSQLVSKWMGPDRWIPSQMVLWSIVATAQFWLQGRTSFLACRALLGILQGGFIPDVILYLSYFYKHHELSLRLGFFWTAMSIADIASALLAYGLL-HMRGVQGHAGWRXXXXXXXXXXXXXXXXXXXXXPAGPCHTASWWFTEKEEKIIVNRVIREDPSKSDHNREPITPRLLWQSLKDFDLWPIYILGLVFQMPMAPIGQYLTLTL-RGLHFDTFQANLLTIPYTVIHMITMLGITYLGEIFNELTLIAASGQIWALPFLIYLNSVDTAGVNRWVIYAVTTGYPNAHPIQVGWNSRN-SNTVRSRTVSAACYNMFVQA-GGIVSSNIYRKDDAPLYRRANKQLLAICCMNIALYVLVKAYYLFRNKQKARWEAMTTEARLEYLATTTDKGNKRLDF.... 570
133 0.000e+00UniRef50_A0A0E0SGK9 Uncharacterized protein n=8 Tax=leotiomyceta TaxID=716546 RepID=A0A0E0SGK9_GIBZE  ali  19  8......................................................................................SHASSMEKQSATHVEGQTVDDEYLILFPLLANKSLEDRQRIEKQLKRKLDWVFLPVVTLMLLMGYLDRINVANARLAGMQDDLHMSDTMWSAGISLFYVGYIITQLPATVYLAKGLPRWQMPAYVVAWSVITACMAAMTSGWSFLVCRFMVGVAEGPFLPMVSLMTSSWYTKEEAPLRMAIWHAGNIASNIFSGLLAAGVLENMNGVAGMRAXXXXXXXXXXXXXXXXXXXXXXXPNFPHNTGTYFMTPEMSEMAQYRMMVSAGGRSEDDEGG-AWEGVKLACQDPFTWIYTVLH-FGLIVAL-SFKDFFPSIVKTLGYSNLMTYLIQAPPYIFAYIATCAISWSSGRHMEHCWHIIGSTVACIVGVVVMISTLNPGARYFGMFLLCAGPFVGLNVHIPWETTNVARPRTKRGALVAITNCIA-SVSHWFTPYFFLRSQEPRYENGGILIIAGCVLGIVGCLICKWYVKKLNKKMEAHEA........................... 483
134 0.000e+00UniRef50_A0A1Y2W4I0 Uncharacterized protein n=5 Tax=leotiomyceta TaxID=716546 RepID=A0A1Y2W4I0_9PEZI  ali  18  2............................................................................ATMDGAKNSSTNDLSRSSLHEGRTEKDLQVAAEEAVTDSHCDSIVEFDRLAERKIRTKIDLMIVPTVSLLYLFCFIDRANIGNARLAGLEKDLGMGGNDYNMLLSIFFISYIIFQIPSNLACKWIGPGWFIPFLSFGFGASSLGMAFVKNLPAACGVRFLLGIFEAGMMPGISYYLSRWYRRSELVFRXXXXXXXXXXXXXXXXXXXXGILT-LSHIGGVSEWRMVFLVEGIITMGISVIAFVTLTDRPETA--IWLTEEEKTLAVARVKSELLGQTKVLDTA-DRKKVWLGIWNPVVLATGFI-FLLNNITVQGLAFFAPTIVASIAYSTVEKQLYTVPPYVVGAVFTLVIPLLSWRTDRRQVFLILSAPLTMMGYIMFLASENSKVRYAATFFTAISAFAAGPLTNAQVAAQVISDSS-RSMSIATNVMFGN-IGGLIATWSYLTWDGPDYPIGNXXXXXXXXXXXXXXXXXXXXXKADNKRREKLDVTKELEGLTQEQIESLEWKHP....... 508
135 0.000e+00UniRef50_E4UT00 Uncharacterized protein n=43 Tax=saccharomyceta TaxID=716545 RepID=E4UT00_ARTGP  ali  19  4....................................................................................LQEKPETGVQGDVERNNENVASDKRGSETVSVSSSEPDFSDIDEKKVIRKMDIRLIPALALLYLLAFLDRGNIGNAKIEGLDVDLGLKGGQFNWCLTVFFFTYSVFEVPSNILLKRLRPSXXXXXXXXXXXXXXXXXXXXRDYKGLLIARIFLGVAEAGLYPGVAYYITMWYCRHEVQLRQAMFFSAASIAGAFSGLLAFAIAK-MDGVGGYQGWRXXXXXXXXXXXXXXXXXXXXXEDFPETAS--FLSSREREFVIYRLKYQGSSLSGAQTEEFKWKYIKEVFTDWQVYASLFVCV-GIICPLYGTSLFLPSIIKDLGYKTSTAQXXXXXXXXXXXXXXXXXXXXSDKSGKRSPFVLGCMSMIGLGFIICISAGVPGVVYAGVFIAICGIYPAFPGAVTWLANNLAGS-YKRSAGMAFQIGVGNMSGA-MASNFYRAPDAPKYTLGHALELGFLVAGVISAVFMREAYKRVNAKRDRE----GTQGLSDQELSELGDKAP....... 501
136 0.000e+00UniRef50_A0A093YJP8 Uncharacterized protein n=1 Tax=Pseudogymnoascus sp. VKM F-3808 TaxID=1391699 RepID=A0A093YJP8_9PEZI  ali  19  212.................PGFIP-FQSLWPIPNIASKHSAPHTRLEGFTGEKRGHHEDSSRTTTTHYLPTTTLCVTERRSLAMADLE-----KSPQAYAADVKPSSPTSSESEGPAGSIDIPVLTPFQYRKLIWKLDLHLLPPLWALWFCSLIDRVNIGNAKIQGLEADLHMKSNQFNVALVVIFIGLVSLEVPSNYLMKRVSPKAVLCTETLLLGIFTIGQGVITNWGGLVAMRFFVGIFEAGLIPGSVLLLSQYYPRYELQWRLNMLMVGNAISSAFGGLLALAIADI-HSSNGYKSWRWIFIVEGSMTAGCTLVAYFLMSDWPETAK--WLSDTERAILKAKIRGEGTIGSMD---RLDSKAMRRILLDWKIWVCTLM-FICSIVAVYSINLFAPTIVKQFDASVRHVQXXXXXXXXXXXXXXXXXXXXSDKLKHRXXXXXXXXXXXXXXXXXXXXQRNVSVRYAALYLISIGGYISVPQLWTLLVNNCSGS-YKIAFAVGFEMGLGN-MGGIISSLTFQGNQAPFYDMGYRVNLGLVCAAMVMATGYVGGMWWENKQRDAGKRDHLLDG---DEKDNLGDDHPL...... 769
137 0.000e+00UniRef50_A0A2B7WRN9 Uncharacterized protein n=1 Tax=Helicocarpus griseus UAMH5409 TaxID=1447875 RepID=A0A2B7WRN9_9EURO  ali  20  2........................................................................................AEKTSTAKISTDKNEADLPSPSDTGSASSRQDEDDDPALAARVTRKTDLRVVPMLCALYLCAYLDRTNIANAKILGLEAELNMPANGYNTALWVFFLTFVLMEVPSNVVMAHIPPNYWLGGSMTLLGIVTMSQGFVKSPGPLYACRAIMGVFEGSLGPAAALMMGSYYRKHEFALRYTCFTTSALVGASFSSFLAYAI-NFMDGTQGISSWRWIFILEGLFNIGVALLTFVVLPRFPAEST--FLTPPEKEHLLHRLHVERGNEAESLKG----QPWLSFFVDWQTWINIVAY-FGADISAAAISQFSPTILKQLGWTANEANLRNVPIWLVGAVVALTTSITAGKLGFRFPFILTGATMCTIGWAILAQVDPPPVRYXXXXXXXXXXXXXXXXXXXXXXANTVGRPRK-AVAHALQIGFGNSA-NFVSANVFIKGESPQYPTGFTTGLVITVVGLCAACTVEFLLWRQNRAADQREARGEPE...................... 480
138 0.000e+00UniRef50_A0A1L7WGW4 Related to allantoate permease n=1 Tax=Phialocephala subalpina TaxID=576137 RepID=A0A1L7WGW4_9HELO  ali  19  2........................................................................................STKDMLVSELHEFRDGKSTSQPPKIEDPFLINVEDYRRLEKKLIRKLDLTLIPMVWILYLFNYLDRNNIAQTKLNSFEKDLGLKGYQYNTAISILNVGYMLMQLPSDMILTRVRPSLLIPFWVLVWSCISASTAAASNYTHLIVIQFFLGIAEAPFFPGVFYLLSCWYTRKELGLRTAFLYSGLVLATAFSGLIAAGVFSELEEYLGHAGLRXXXXXXXXXXXXXXXXXXXXXPDCPESSTGWLLNKEERLVAMERMKRDRVSNTEEGKGSV-WRGLKLACMDFKTWIFVVM--LIANHTAYGFNYFYPSIVKGLG-STTITLVLTSPPYLLATISSMLFAYSSDRRGE------------------------------PSFLFICGCISANAMVFSWASSSLSETPEKRAAATAMINLLSQ-LGNIWSPYFFRPQDSTRYLLAMLLMMAFSLLGVGRCILMKMVLVRENRKIVEEFEGSDERPNLYSGEVYAMDLQSIEDK... 473
139 0.000e+00UniRef50_H6CBU0 Retrograde regulation protein 2 n=5 Tax=Herpotrichiellaceae TaxID=43219 RepID=H6CBU0_EXODN  ali  21  15........................................................................................................EQHIQDVVEVQAWQMRTDEERRAEKRLLRKLDMVILPMMSISYLMAYLDRNNIGYARLMGLQEDLRITDGRFYNVIMVFYAGYLFCIFLGNISIRRFGPRVILGSAVVIFGAFVCGMSQAKSYATVIGLRFGVGAAEA-LLQASPLYMSVWYGRNELGKRVAIFYSSTTISGVFSGLISYGIQKNMEGTRGMASWQWLFLIEGAIAVAVGLVNATILPTFPDRLKSRFLTDMEIRVGLQRSLEYNSAEV-----KIEPKQILQGLKDPKLYLLALLS-GTNAMLLAATGAFLPSIVKEFGYSKLDAQLFTVIPYACSFCSMLAVGYLSDYYHSKSXXXXXXXXXXXXXXXXXXXXTGKEIGMFGACLLVAGTYPSAVLQITWIQITFCG-ATKRAFSWGFAMVIAQGMS-MAASQIY--SKPPRYFAGHGTLLGFVTLAIICTYAARVLMIRANKKKD----DEVLEYQNRGDEHPEGGKSFEEVCD.. 487
140 0.000e+00UniRef50_A0A0G4N6R1 Uncharacterized protein n=1 Tax=Verticillium longisporum TaxID=100787 RepID=A0A0G4N6R1_9PEZI  ali  21  601....IDEYEVKARKK-------ATRPLPTGEPRMGQREDTALKWGVRVPLAGPWVSIAAATTTAAMYATPPGEVYTGPGVVQNSGPLTEEEKHSMLNMEHAENNELDTKLETVYNDPIFSDPDFQAKEKKMVRTLDLTLLPMLWILYLFNYLDRTNVAQARLNTFEEDLGINGSHYSTAVAVLTAGYMVAQLPSNMVITRVRPGVYLPCCALLWSGVSAATAATNDFSSLIAVRFILGIVEAPLFPGAVYLMSSWYTRSELALRTAVLYSGLVLAQAVSGLIAAGVFSGLHGAQGLAGWQXXXXXXXXXXXXXXXXXXXXXPDYPHSAAKWSMSEELRHLAAVRMAADRVSTAEEEQTV--WNGLKLAVTDYKTWVFVVTNICM--TSSYGFNNFFPTIVSGFGISRTVSXXXXXXXXXXXXXXXXXXXXSSDRRKERGYHISANVAMAIVGFIISVSTINAPARYVASFLYTTGSFSANALVYTWAVSTLSQTPEKRAAAGAIVNIMG-HIGNIISPYFFIDSHAPRYTMAMILMMSFGACTIVLANVLKWLLRKENRKL................................ 1150
141 0.000e+00UniRef50_A0A1S8BFR7 High-affinity nicotinic acid transporter n=3 Tax=Diplodia TaxID=66735 RepID=A0A1S8BFR7_9PEZI  ali  16  120..........................................................................................................EAGDAGADDAVRDYELYTPQEETAVVKRLDRRLVLFMGLLYMLSFLDRSNIGNAKIAGMSRDLSLSSDQYEWLLTSFYITYILFEW-ATLLYRLVPPHIYIPLCVFSWGLIASLQSLSTSFGSLLALRALLGVSEAAFGPGVPFYLSFFFRRDELAFRTGLFISAAPLATSFASTLAWLITKLGEG-GPWAPWRLLFLVEGFPSLFVAVWAWSFVPDGPGEAR--WLSAREREVAVLRLRGSVRKGGTKKKRGVDFREVLQTLMDPKCYLTAFM-FFSCNVAFSSVPVFLPTIIKEMGYTSLTSQALSAPPYLFSFLTVLATASLSDRYRTRSVPLILHALLASFSFTLICLLPHRPAVTWTHFLXXXXXXXXXXXXXXXXXXNNQETASRRGAGMAVLNVVGQC-GPLLGTRLFPEEEGPYYVRGLGTCAGFMMCAAVLAAGLRLVLARENKRKERARRVGMGLGEAGEDEEELG........... 628
142 0.000e+00UniRef50_A0A229X0X9 Lysophospholipase n=1 Tax=Aspergillus turcosus TaxID=1245748 RepID=A0A229X0X9_9EURO  ali  22  2..........................................................................................SKSTTEQREFTQTKLENASDALYEAYASKDPEWHRQMTRSLLRKVDLHLLPFLVVMYLLNFLDRNNLSQARLGTLEKDLGMTGTDFNLATSILFVGYLLMQLPSNLLLTRVKPSWLLGVAMAIWGIISACQAATTSFTGLVLARFFLGFVEAPFFPGAIMLMSSWYTRQELSHRIAWFYAGSSLANAFGGLIGAGVLGNLEGAHGIAGWRWLFIIEGSITVGVSLFSTVWLPNYPATTS--WLDETEQAYAQWRLINDAGEADDTNAVSI-KEALAMVFRDRRIYLFILLQ--HISLLSQTFQYFFPTIVKTLGYGSIEXXXXXXXXXXXXXXXXXXXXXXXGRTNDRSWHIIGLMSLSAVGCIICTATTNIGARFXXXXXXXXXXXXXXXXXXXXXXNSFPRPLVKRSAAIATANMIGNTA-TIYGSYMWPSSSGPRXXXXXXXXXXXXXXXXXXXXXXRMVHSRINKRL................................ 466
143 0.000e+00UniRef50_A0A137PFC0 MFS general substrate transporter n=1 Tax=Conidiobolus coronatus (strain ATCC 28846 / CBS 209.66 / NRRL 28638) TaxID=796925 RepID  ali  17  2....................................................................................................EFNTNLKDIEVNNVEEKHHVREFDPVAVSRLTRAIDRHIIPVIFVIYMLCYLDRVNIGFARLYHLEKDLNLSLSEYAWTLSIFFAGYVLFEVPSNLIIKKATPSRXXXXXXXXXXXXXXXXXXXXNFAGLMAGRFFLGVAEAGLFPGLVFYLSFWYTRKEQAFRLGMLHSASCVAGIIAGPLSYGI-GFLDGKGGLEGWQXXXXXXXXXXXXXXXXXXXXXPNTPSI--VNWLSNEDKNLIVSRLEADH---TDSRATKFYKSQFIEALTDYKIYFYMLMY-FGFLCPVYSLAQLLPTVLSGMGFNTRDTMLLTIPPYAIAAVSNIVVAKSSDYHKERCFHLMVPLTLSALSFLSLILVKDLTSQYVANLFAVVGNASATPILLAWLNNNMVG-VTKSGTASAMVICFAN-LGGLVAGQLFSKSEAPYFVRSNIICMCLVLMTLILSIILRFLLIRENKKL................................ 453
144 0.000e+00UniRef50_A0A167DS35 Tna1p n=4 Tax=Saccharomycetales TaxID=4892 RepID=A0A167DS35_9ASCO  ali  19  1..............................................................................MSEINKVDIAHDEQSIIKPNDELPDLGQFAHLFEGVTLPPRGSEERAKLEKRLKRKLDFTIFPLLIITYILNYLDRNSLAASKEGTIMVDLNLTNTQFSTCQAILFVGYITMQVPSNIIMEKLGPQXXXXXXXXXXXXXXXXXXXXKNFNQLVAIRAILGAFEAAFYPGVMFYLSSWYTRTELAKRMSIFYTGSLLSGAFGGLIAYAVVTDLEGVHGLHSWQYLFIIEGVATIGVAFICFFCLPELPATTK--WLSKEERLLGVVRLIDDIGQADDDTEKKSAWEGLRLAVVDEKVWIYLAILFFEAATA--SLNAVFPAIVASLGYDSSKTXXXXXXXXXXXXXXXXXXXXHSDKTNERYWHVMIGPAISMVAFIIGISTLKTAPRYVAMMLVLQ-VYNSYGLSYAWASSNLPRPPIKRAAAFAMINIGGN-LPNVYAPYLFSSNYSPHFYAGFGYCLASAILSMVFMTVAKWRLNKLNKKLENGGTVDGLGPETG.................. 496
145 0.000e+00UniRef50_M2RSJ2 Uncharacterized protein n=4 Tax=Dothideomycetes TaxID=147541 RepID=M2RSJ2_COCSN  ali  16  2...................................SSSSSRQRPKQPSPSTSDSSPQATPSSRSSKPSDGPSMMHQPNSFELQTISPHQEPVSKEDLEGEEDEGLLPSGHRPSLDSVQSYELYTPDEDRTVLKKLDRRLVVFMAFLYMLAFLDRSNIGNARIAGLPEDLKLGPAQYEXXXXXXXXX-XXXXXXXXXXXRVVPPHIYISLCVLSWGIIASLQAVTNSFGFLFILRALLGLSEAAFAPGIPFYLSFFYRRRELAFRTGLIVSASPLSASFAGALAYSITKIGEHTR-LNPWRLLFLVEGFPSVLVAVWAWDVIPDGPGFVK--WLSPRQREVAVMRLRSEKEKEDQDKDDGLNFREVLQTLKDPKAYLTAFM-FFSCNVAFASMPVFLPTVVKDMGWESVTAQGLTAPPYLFAFATVLITAHYSDRLQSRSTFIILHSLLATAGYATIAISDNTTVRYIALFPAAAGFFSAITCIITWTVNNQESD-SKKGAGMTLLNLIGQ-IGPLVGTSIFPDQDGPYYVKGMSXXXXXXXXXXXXXXXXXXXXXKENRKLDSGHAEYAGVPLEE.................. 550
146 0.000e+00UniRef50_F8NMU0 Uncharacterized protein (Fragment) n=24 Tax=Basidiomycota TaxID=5204 RepID=F8NMU0_SERL9  ali  21  1.........................................................................................................................EERDVIERTLLRKLDAR-MSILILIYILNYIDRNNAAAARLRGFEEDLGLKGQEFNTILSILYVGYIIMQVPSNMLLDYIGPSIYLPACMVVWGFISIMTGY---FTGALLTRFFLGFVEAAFFPGALFLLSKWYKRRELGQRMAYLSCGILLSNAFGSLLASAILDGMDGRLGRAAWRWLFYIEGSLTVFVAICAIFILPDFP-SMSHSWLTPAEHALAKQRMEEDAGTTIESVIALDKSREIILALTDWKVWWMAIA--LTSMVVSLSFNAFFPTLSATLGFSPTVTLLLCAPPWLFATFEAFVISRHSDASGKRXXXXXXXXXXXXXXXXXXXXXXNIVARYISLFLMAQ-SYTGFIVFFAWVSNTIHSPSSKRAVSLAFINAVS-SLGNVAGSYVWPIWWGPSYRYSCAICIVGNGLCIIM............................................... 419
147 0.000e+00UniRef50_A0A286UDJ1 MFS general substrate transporter n=2 Tax=Phellinus noxius TaxID=418867 RepID=A0A286UDJ1_9HOMO  ali  23  25...............................................................................................................................ESKVVRKIDARLIPVISVFYLLSFLDRVNIGNARVAGLQKDLKLTDNQYQICITVLYVTYIATDLPASLLLRKXXXXXXXXXXXXXXXXXXXXXXXXSSYKGLIAARLILGLLEGPMVPSIILYLSMIYTRRELSFRISLFASAASLSGAFSGLLAAAIEK-MDGINGRPGWAWIFILEGTFTALVGFFGYFLIPASIGNMK--FLTEAERSLANERIINDRPSI--QISEKFSFKQVIISMTSPHV-IMVSCXXXXXXXXXXXXXXXXXXXXSELGFSATHTQLLSVAPFATGFVCTNLASYLSDKYQTRAIPICFCAITSTIGYIIFLVSSSTAMSYGSLFPSVCGVYSLLPISAAWVANN-SEPHYRRATSLAL-TIMATNSGGILSTWLFPSSEGPRYTRTTIIYITFSLSIFSLSVMNALYLKWRNRKLSQKNSISSGVDETSDSWLRLGDKHP....... 476
148 0.000e+00UniRef50_A0A072PLB4 Uncharacterized protein n=1 Tax=Exophiala aquamarina CBS 119918 TaxID=1182545 RepID=A0A072PLB4_9EURO  ali  20  16.........................................................................................................DEIERDEVEQVQLGGVTFTKEEEAKLVRKIDLFLLPTIWLMYLLSYMDRTNIGNAKIAGMADDLELSSSEYSVALVVFFVGYVIFEAPSNMILVRSRPSRYLPAIMVIWGGLTCAMAAINTYHHLIILRIFVGILEAGFAPGILLIISSWYKRSEQSKRXXXXXXXXXXXXXXXXXXXXXXTGGLEGAHGLRGWRWLFIVEGVATIGWAGVSGFILLDFPATSKR--LTERERAIAIARLLDEGVTVRTEHGPKISKRSFWLALKDWRTWGFILGYM--VIVGSSTLSYFYPTLVHNLGYSTVQAQYMTVPIYAVAFVCTAVTGYFSDRIPWRXXXXXXXXXXXXXXXXXXXXXHNFTARYALLVLMAAGLWSSNALSLSFASSTFGSEPEVRAVALALVNAMGN-LAQIYGAYLSPQQIALNTPWALASSLAF...................................................... 448
149 0.000e+00UniRef50_A0A0U1LUN7 Sugar transporter STL1 n=1 Tax=Talaromyces islandicus TaxID=28573 RepID=A0A0U1LUN7_TALIS  ali  19  937.................................................................PETAGLSLESIDLCFMDRAHNPVKKANEMRRRIKEGRDVTLNNALEGEKNVGSEHVEWERILEKKLTRRIDVLIMPLIILVYLMNYIDRNNYAAAKLQGLIQELSLTDQQYQTGLSILFIAYILMQVPSNLLLNYMRPSLYISFFVCAWGLVSTCTSQVQSYGGIVACRFLLGLVEAPFFAGVLFYLSKWYTKKELAFRMSVFYSGSLLSGAFGNLIAAGILNGLDGKRGMSAWRXXXXXXXXXXXXXXXXXXXXLPDFPETWRV--LSPEMKVVAIRRLAIDAAEADDEEGSASQLKGLKMAVTDVKTYALALAYFC--IAAGGSFQYFFPTLTSTLGYSNTISLLLVAPPYVFMVFYSLAHNWISDKIGXXXXXXXXXXXXXXXXXXXXXXXDSFGPRYFSLFLMN-FTFAQNGTLYSWIASSLPRPPAKRAAAYAFINSLGNSAS-IWTPYTYYDAEKPYYRVALGVCIAVQALGGLSAIFMYFTLHALNKRQERLEEDVQLTEKEMRRLQRTADLEGIDVAAAR 1462
150 0.000e+00UniRef50_A0A1E3QCA1 Uncharacterized protein n=1 Tax=Lipomyces starkeyi NRRL Y-11557 TaxID=675824 RepID=A0A1E3QCA1_LIPST  ali  28  24......................................................................................................................WDSFGKDAQTQKYLHKIDLFILIYVMLSYLIKSLDNTNINNAYVSGMQEDLALYGNELNLFVTFFNMGYLSGSIPFQYIVSHIRPSIVVPSCELVWSGLVMLVASVKSAKSVYALRYFIGLVEAAAFPVFMQVLGSWYTPEELGKRVAIFDMCANIAAMFSGYLQAGLYTSFNGRGGLAGWRWLFIMDGVISFPIALLGFYCLPDFPTNTRARWLTKEEKEFSIRRFAAVGKKGP----RKLTLRRLGQYVLSWRPYG-CLCFVCTASGGDAPSASFNLWL-KSLDMSVQKVNIIPTVANACAIGSAFVFGSLSDRTRTRWPWIIFGEFIRISGNVILAVWNVNYSSKFYAYLAPSLATFYWTLWLSWSQEAFQDDAEFRGLVMAGANTIGPVLGTFVPLLLFPTEQAPHYHYGFYAAIAFNTATIGSVLLFHILSKREAKRL................................ 460
151 0.000e+00UniRef50_A0A1Y2IH10 MFS general substrate transporter n=8 Tax=Agaricomycetes TaxID=155619 RepID=A0A1Y2IH10_PYCCO  ali  19  5.............................................................................................EKDQVSVQQVERHESNTGSFDDGELLALDVRAAAERKLVRMLDWRLLPTIVLIFIMNYIDRTAVSAARLKGLEQDLGLSDIQYSTVLAVLYASYVPAQIPSNMILNRIRPSYYIPICVMLWGLTSAMTGVTKNYAGILAARIFVGVPEAAFYPGAIYLLSRWYTRRELAFRSAILYGGLLISNAFGSLMAAGILAHMEGKMGIRAWRXXXXXXXXXXXXXXXXXXXXXPDFPHNTR--WLTPAQRRLAQVRLAEDAGEADEDVSTDSAMKGLIMALKDPKVPIFAVM--TCSQLLGLGFVNFFPTIAGTLGFSTTVTLLLAAPPWIVATIVCCISAWNADRTGERXXXXXXXXXXXXXXXXXXXXXXXXXXRYVSMFLMACG-YSGFALTAVWVSNAVPRPPAKRAAAIAIVNGFGN-LGNLISSYVWKAEWGPDYHXXXXXXXXXXXXXXXXXXXXXXXXXKQNKRLE-LEELANLNEAKRERIADAARLEGITFEEA. 497
152 0.000e+00UniRef50_A0A094E3Z7 Uncharacterized protein n=3 Tax=Pseudogymnoascus TaxID=78156 RepID=A0A094E3Z7_9PEZI  ali  17  570....................................................SEYWNSYARGIITTTKMAVTAHDIEEKQLGKHIEESPEVSTKDTPLFGDGENAAERGQTATDRHGRSLVQFDPAAERRLRLKIDLYIVPTVALLYLFCFIDRANIGNARLAGFEKDLKLVKYDYNIVLSVFYISYIIFEIPCTMACKWVGPGWFIPAISLGFGICSICTAFVTNIHAACGVRFLLGAFEAGMMPGIAYYLSRWYRRSELAFRXXXXXXXXXXXXXXX-XXXXXXXXRLDGFGGLHSWQMIFAIEGIITCGLSVIAFVTLTDRPETAR--WLTQAEKDLAIARVKSERVATTEVLDTIDNAKTMRGIFC-PVTIATSFI-FLLNNITVQGLAFFAPTIVKTI-YSVISQQLHTVPPYIVGGFFTLLIPFLSWRFDRRNHFFIVSAPLMMIGYIMFLASTEPMVRYGATFLIASGAYSFGALTNAQVAANVVSDTA-RGAAIGTNVMFGN-VGGLISTWSFLPTDAPNYHIGNGLNLATSSTILLLSILLLFWMKMDNRQRSKKDVDSVLAGLSQKEEQDLDWKHP....... 1101
153 0.000e+00UniRef50_A0A2A9NPG7 Uncharacterized protein n=1 Tax=Amanita thiersii Skay4041 TaxID=703135 RepID=A0A2A9NPG7_9AGAR  ali  20  6........................................................................................................................TEERKIAERKLLRKLDTRVLPTIFVIYIMNYIDRNGVTTARLKGLEKDLGLSGVQYATVIAILYVSYCPAQIPSNMLSRHIRPSLYIGTCVVLWGLTSLLTGVTHNVSGILACRVFIGFPEAAFYPGAIYLLSRWYTKKELAFRSAXXXXXXXXXXXXXXXXXXXXLARMEGKRGIRAWRWLFFIEGAITIFIGFQTMWLLPDYPHNTR--WMSPQERRLAQARLSEDAGEADQDNAGTSLFAGLVLAMKDVKVQLFSLMTI--SQLLGLSFVQFFPTLTQTLGFNTTISLLLAAPPWIVASVVTCLNAWHADRTGEXXXXXXXXXXXXXXXXXXXXXXXXXXXRYVAMFLMACG-YAGFSMTLVWVSNAIQRPPAKRAAAIALVNGLGN-LGNLMGSYTWKVEWSPLYHXXXXXXXXXXXXXXXXXXXXRQMLVRENKRLDADERAA-LEGADRTRVEEAARLEGLTFEQA. 470
154 0.000e+00UniRef50_C4JJP3 Uncharacterized protein n=1 Tax=Uncinocarpus reesii (strain UAMH 1704) TaxID=336963 RepID=C4JJP3_UNCRE  ali  22  4......................................................................................SAEASIEKASSLGEATEKRDEVASSEYQEYTDLLAKFDDTRVKSLLRRVDIRLMPPLAILYLIAFVDRSNIGNARLQGLERDLQLSTQQFAWCLTIFFFPYALFEVPSNVMLKLLKPXXXXXXXXXXXXXXXXXXXXCQNYSALLACRFFLGVFEAGLFPGCAFITTAWYKRFEVQYRVALFYTAASLSGAFSGLLAFAI-GKMDGVRGYSGWRWLFILEGLATVVISTICYFLIPDSPGSAK--WLSPDEARFLELRLQFDGNDKG-SKEGGFQWKYVIQGFTDSKVYLGTIM-FGAICTCTYSLSYSLPTMINLLGYSAANAQLLTIPVYAFGCIICVANSVLSDRYRHR........................................................................................................................................................... 350
155 0.000e+00UniRef50_U7Q1P5 Uncharacterized protein n=3 Tax=Sporothrix TaxID=29907 RepID=U7Q1P5_SPOS1  ali  19  4......................................................................................HPDEKLGDSAISATATPPNEFAXXXXXXXXXXXXSDADRKADRRLVRKLDLHIMTLAMLIYIFSVLDRVNIGNAALYGLKTDLGLVGNQYQILVSILFATYISVEIPANWMVKRIGPSRWLGFITAGWGLVATFSGFAQTFGGFLACRLLLGALEGGLWPGLVVYLTTFYTRREIALRIAVLFACSALAGAGGGLLAFGI-GFLEGHSGYNGWRWIMILEGLPCIVLGVATWFGLADEPATA--YYLTPAERARLVRRL--DRQPGMTQAAKQFHWNDALEAFADWTVWAFCFAQ-FGADVMLYAFSAYLPTIIKGINFSTPVVQVLTIPCYLVGAAAYLVVGQVSDRIQHRALFVLVAGIVTVCGYGMLISDGGVAVHYXXXXXXXXXXXXXXXXXXXXXXXNVPR-YGKRTTTIAMQACIGNSAG-IMSGYVYPAAEGPRYVKGHXXXXXXXXXXXXXXXXXXXXXXXENKQRTAGKRDARISGLTDDQVRELGDKSP....... 497
156 0.000e+00UniRef50_A0A0F7TQC5 Putative Pantothenate transporter n=2 Tax=Penicillium brasilianum TaxID=104259 RepID=A0A0F7TQC5_9EURO  ali  30  4..........................................................................................ASHADETVAADSLPNVQEVPKRKWTSYIWDTFDKSPEERRLLFKLDTAILTFASLGYFIKYLDQININNAFVSGMKEDLGLYGNQLNYMQACWTVGYVIGEIPSNILLTRVRPRYWIPAAELLWTVLTFSLSRCNTATQFYVLRFFIGLAESTFYPGMQYIIGSWYRRDELAKRSCIFHTSSGIASMFSGYLMEGVY-HLGGRGGFKGWQXXXXXXXXXXXXXXXXXXXXXPDVPEISNPWYLTKEEVALSQKRMQLEGRQ----NRGPFTKAKLKKIFSSWHIYLLTLLYVLFNNGGAGGQPVFQQYLKHSPKYSVDQINAYPTTTNAVQVVTTLAYAWSSDTFGRRXXXXXXXXXXXXXXXXXXXXXDIPIGWKWTCYIISGAGYGLSGLCMAWAHEICSKDNEERALVIGSMNEMAYVLQAWLPLIVWQQVEAPEYRKGFITVSCLSLLLIITTFVIRNLAHKESRREKASNSQAQETGDN................... 486
157 0.000e+00UniRef50_W3XDR9 Uncharacterized protein n=12 Tax=leotiomyceta TaxID=716546 RepID=W3XDR9_PESFW  ali  23  2........................................................................................ASTVEKNNITDVHDNTTNDEKDQQTQPDVDLDEEYTLPEQRKIIHKVDRRLLIILGLIQAVSFLDRANMSNAAVAGMTKDLQLVSNRYSXXXXXXXXXXXXXXXXXXXXXRKIGPRIFLSSVTLLWGIIMLCFSFVQHWTSLIALRFLLGILEAGSFPGLYYLVSAWYSRFDLYKRTSVFYLIGVLGSALGGVLGAS-FSQMKGLADYNGWRWIFIMEGIITCLIGMASFIFTVDFPEQAHKAWLTESESAFIIRRLNRDRQ---DAEPELFSIRKFLKPAGDWKIWIFALM-FFCSTIQAYAIGYFLPIILKELGFTEVQANGLSTPPYVGAMLLMFVEGYLSDKIRLRYPFLYLNACMNITGLCLMVWSRSSAVQYLGTMFLTAGCSAAIPLIMAWQANNIRG-TWKRAFCSASMISFGG-IGGIAGSLAFRSEDAPKYLPGXXXXXXXXXXXXXXXXXXXXXXXXQNRRANAEQTVIE........................ 479
158 0.000e+00UniRef50_A0A2B7YD46 Uncharacterized protein n=2 Tax=Ajellomycetaceae TaxID=299071 RepID=A0A2B7YD46_9EURO  ali  21  2................................................................................................SNDGSKGQAQEVEQASSRDEEDFMTAEMKKRCRKIYLKVDFRMIPILGAIYAISGIDRTNLSAARVAGMHEDLRFDGERYSIVLLVFFITYFIFEIPSNVILRKVGAARWLSFIALSWGVVILGAGFVKSWAPMIAIRLLLGLFEAGFFPGCMYLISCWYQRYQVQQRIAWFYSLNVIANGFGSLLAYGLIR-MEGLGGLRGWRWIFIIEGLITCVLAIMGYFLIIDFPDKLKRPFLSLEDVEIIKARLNRDR---SDAEHDLFSIKKVFQTLCRWQLWIYSLL-FMCTAVGIYGYAYFTVVILQGMGYSTGRVFLLSAPPAIVSVPVSLIVSYVADKTRLRAPFIAFMAIMCLVGYVLVTYAKQNGVKYXXXXXXXXXXXXXXXXXXXXQANNIRGQST-RAVASGLQVAFG-AVGGVYASLTFMEKE.................................................................... 427
159 0.000e+00UniRef50_H6BV89 Retrograde regulation protein 2 n=16 Tax=Eukaryota TaxID=2759 RepID=H6BV89_EXODN  ali  20  62................................................................................................................................KRVRRKVDIRLLGMAWLMLMFNYFDRCIIAAARVVGIQKSLHMNSTQYGTAVGILYVGYVLMQVPSNLILTKLRPSIYLPSCMAIWGVISACSGLVHSAWSLHLVRFLLGFVEAPFTVGALFLVSSWYTRSELGVRSAMLLSAPLLGNAVSGLIAAGITDALEGAGGFEAWRXXXXXXXXXXXXXXXXXXXXXXDFPSNTR--WLSCEERAVAEWILILDAGQVDEEATD--WKHGVNTARKDLRVYGFAAMYMLLSV--ASSLHNFFPSVVQTLGFRRMDTLLLTAPPYLVAILVAIYNNWSADRTRNSSFHVAWPLAAAIIGFSICAATLSTWARYVAMILMVAGGHGANAVVLAWAQKTMIRPRIKRACALAFINATG-TLAQILTSFMYPSRTAPRYVIAMSVNSATALGAISLAFTMRVILQRANKKLDADSNVEE........................ 495
160 0.000e+00UniRef50_A0A1Y1VY74 MFS general substrate transporter n=1 Tax=Linderina pennispora TaxID=61395 RepID=A0A1Y1VY74_9FUNG  ali  19  7...........................................................................................KDDEKRHAESHDTAYDGNAREHISGELILSAAEQESRRRYLRKVDTRLMPLAFLMYFLCVLDRNGIGNAKVAGLDTAVGLHGSQFNWVSSVFFITYIIFEIPANILLKRFSGKXXXXXXXXXXXXXXXXXXXXRSYASLIALRLLMGVAEAGFVPGFIYYSTFWYTRKEQAPRLAIFYSAGMFSGIVAGPIASGLSSI---RGSLDSYQYIFLVEGCVSVCVAVLAYLVMPDYPETAK--FLTLDERNVAMRQLGHER---ALASKTKISPVQIVTALVDWKLWMYALM-FWACTTGGASQAIFGPTLIKAMGYTATKAQMMSAIPSACGFVGQLLSSVLTIHYRHISVLISIAAAISCA----------YHLRFAFLCLAQFGLAPILPWSTLWMTSNTLG-ITKRGAGSALTVMLGGIAG-IVSSQIYREKDAPYYRFGHWFNCACEGLIVVWAVGLSMYFWSENRRREQANVDI--SKLSDSEIDDLCDNHP....... 478
161 0.000e+00UniRef50_A0A068RKM5 Mfs nicotinic acid transporter tna1 n=2 Tax=Fungi incertae sedis TaxID=112252 RepID=A0A068RKM5_9FUNG  ali  19  4.....................................................................................................PSTSHDNKEKIPVEIETKSNPDNALVEKRLLR-------------YMTRALSRSNIGNAKLGGLQRDLGLSHFEYQWTLSIFFFGYIFMQVPSNIVMRRWRPSTWLGVLMGAWGIIATCMAACHDFAGIVVCRLLLGACEA--------VLSIWYMRKEYARRAGLFFSFSSLAGAFGGLLAYA----------------LFILEGIPSVILAAFSAWYLPDKAESAT--FLTMEERTLQKERLERDAGASQDQV--PFSWAAAFSVFRDWKLYAYMVIYLLG-TCALQGVTLFLPSIVMNTGWSHAQSQALTTPPYVLSFLGTLLVSYSSDRFFDRAYHMMACNLIGIIGFLVLILLPQVAGQYTGACLVVIGVYCNVPPKVSWFSNNFGGD-TRRAIASAVIVSFGMAGGALGGQIYY---DPPNYTHGNTIALACLAAQTVIVFMLRTMLARENRRRNEIANNADLELLRYGGPAMAGDRHP....... 450
162 0.000e+00UniRef50_A0A094DC83 Uncharacterized protein n=1 Tax=Pseudogymnoascus sp. VKM F-4281 (FW-2241) TaxID=1420906 RepID=A0A094DC83_9PEZI  ali  17  883...................FLRKARGQIDRPPRVNITPIT-------------RHKSIPDQPVSKETDIGVALSESGSDYSSKVTASQKQHRGEAYAEGGLTKFYEPIPEYEGRHRWDPTAEWSPAEEKKLVRTLDYRICSWVCLMFFALQLDRGNITQALSDNMLNDLGLNTNQYNYGMTIFYLCFLFAELPSQLISKKLGPDNWIPIQMICWSIVAICQCKITGQSTFYATRALLGLIEGGFIPDSILYLSYFYTSKELPIRLSFFWGSYTLTNIISSFLAFGIL-HLRGVLGLEGWRWLFALEGILTALIGIASFFYLPPSPTETKDGWFSERDEIIMVNRVLRDDPGKGDHNRQGISLRLFWQALCDYDLWPAYLIGFTWGTPFHPVGAYLTLTL-RGLGFDTFRTNLLVIPGSVLTLMQLLFWTWYSEKINSRXXXXXXXXXXXXXXXXXXXXXNSSPWSKYXXXXXXXXXXXXXXXXXXXXSRN-AGSVRTRTVGTALYNMFVQA-SSIVASNIYRDDDKPAYRRGNKVLLGFVAWNFILIIGTKYYYVWRNHTREKWSVMSQEEKDTYLETTTDEGNK........ 1441
163 0.000e+00UniRef50_A0A146HZ86 Uncharacterized protein n=1 Tax=Mycena chlorophos TaxID=658473 RepID=A0A146HZ86_9AGAR  ali  19  626......................................................................................SHRTMSALVEKVPSRSSSDPEKIVGSAATSDVGELVQNPTLEATVWGKSDIWILPIVTLFYLLSFLDRTNVGNAKVAGLTTQLHMTPTQYSMALTVTYIPYIVAELPSNLLLKRVGANLMLPTMITLWGVVCTVQGTVKSYSGLLVCRFFLGLLEGGVFPGLVLYLSYFYPRQRLQTRVAGFFSAASLSGAFGGILAYGIIK-LNGKSGHSGWQXXXXXXXXXXXXXXXXXXXXXPASPDTAR--FFNAEEKAYVKARLEEDGAINGDEALDGFSWREVGKAFTSVHV-ILVGINFFFSGVVLYSLAYFVPPLIQSLGYTAAKAQLMSVPPFSVAFVMTMITAYISDRYQCRGWMTVFCSVLCVAGFGMWLGSTNHHIQYGSMFLSVPGVYLGAPALSTWNANNSA-PHTRRATXXXXXXXXXXXXXXXXXXXXXSISPAPRYIEGTKXXXXXXXXXXXXXXXXXXXXKYQNALKAERRKTTSREDEVARGDE.............. 1113
164 0.000e+00UniRef50_A0A1G4J771 LADA_0D09120g1_1 n=1 Tax=Lachancea dasiensis CBS 10888 TaxID=1266660 RepID=A0A1G4J771_9SACH  ali  20  16.................................................................................QASIEMADVTTNSLTYFEGKQKPLQGTVEVETGVLDIATVESIDIDEKKLLRKMDMHIIPGICILYLLSFIDRGNIGNAKIEGMPDDLKLHGNQWNIVLTVFYFSYCAFQVPYNMLMSKYRPSXXXXXXXXXXXXXXXXXXXXKTYKQLIACRVLLGLAESGLVPGIVFYLTKWYTRQNLQYREALFFAAASGAGAFSGLLAYGI-SFMDGLGGISGWRXXXXXXXXXXXXXXXXXXXXXYDYPETAK--FLTDNERRYIKYRLTHDSPEVALEAYQRQDKSQITAALCDWQLWLQIFIQ-WCFCTALYTAAFFLPSIVKSLGYTNAKAQLLTVPPYAFSIGSSLLMSYYSDKLGLRSPFIFFCQILMIVGYIVALTVDKPGAVYAGIFLTVVGTYSAFPGMLSWLPVNVDGP-YKRSISVALHVGFGQ-MGSTFATNYFRLTDAPRYRXXXXXXXXXXXXXXXXXXXXNIRYYLLNKEKERSIISGETDSMTDVEILAMGDRSP....... 524
165 0.000e+00UniRef50_D5GBG8 Uncharacterized protein n=3 Tax=Tuber TaxID=36048 RepID=D5GBG8_TUBMM  ali  19  19...........................................................................................KRTPKQNSEEKAPKVTAPVTPETASQIQAQQTT----KRILRRVDLRLVPILSLLYLLCFLCRQNIGNAKTYHMTYDLHLTTQQYQIALTAFFLSYSTFDIPCNIMLKKLRPSVWLPLMTLLSGVITVCMGVVKNADELIVVRTFLGMTECGLFPGVAYVITMWYCKKEAQFRQALFFCAASMAGAFAGLLAVGLSK-MDGLGGQEGWRXXXXXXXXXXXXXXXXXXXXXXDTPDRAK--FLTKEEKEFLLRRLEVDQAEKARIHTDLPKSQIFKSVFTDWHIYAHILV-FYGISCPLYSISLCLPSIVQELGYTSAQANFLTVPIYITACLLSLLTAYLSDRTGMRXXXXXXXXXXXXXXXXXXXXRPGPGLAYAGLFIAACGVYPAFPGMITWCSNNLASS-GKRAIAMALHIGMG-SFGGAMGANFYRVQDKPLYRLGHWLNLGFVCVGGVAIAVIYFSYYTENKRREGVRAGLVEELEKEIEKAGRG........... 511
166 0.000e+00UniRef50_A0A132B673 Major facilitator superfamily transporter n=4 Tax=leotiomyceta TaxID=716546 RepID=A0A132B673_9HELO  ali  31  3..........................................................................................................SEKKAPWWSYIWDYGPGRSFEEVKFIQKLDIGLLTILSLGYFIKNLDQTNISNAYVSGMKEALKMNSNQLNLIDIAWTTGYVIGQLPSQFILTKVRPSIWIPSCELVWTILTFCLAAATSANQVIAIRFFVGLVESIFYPAAHVLIGSWYKPSELGKRACIFHASAAAAGMFSGYLQAAVYKGLNGHLGKAGWQWLFIMDGVISTPICLAGFFLIPDLPENTRAFYLNEEDSALARKRMDDVGRAP----RKKLGWSILRRVFTRWHVYALTVLYIIFINTPSSSVSPMALWLKAT-GWPVTQINIIPTGQSAVQLVTTVTFAMLSDFLRNRPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSKAAVPYGPLSMSWANEICGADAEERAVVLGVMNASGYAVNAWLPLLTYPVTQAPRFKKGFVFSTIAFVAQFGITGLVAWLHRREKGKK................................ 453
167 0.000e+00UniRef50_A0A0D7A8H9 MFS general substrate transporter n=1 Tax=Fistulina hepatica ATCC 64428 TaxID=1128425 RepID=A0A0D7A8H9_9AGAR  ali  18  2................................................................................................EHKGEVVEALPVDRHGEVSHHIHDYDVDPQAERALVRKLDKRIAPLVFCLYLFNALDRSNLGNAETDGFTTDLHFGTNDYSLMLSLFYIPFCCLTFPGVALTKKIGAHITLPLYMMVFGAMVMINAGVKNIGGCLVVRILIGAAEAGFATSIIWYLTTFYRRGELAKRVAAFYSASAFSGAVSGLIAYGVFQA---DSALYGWQXXXXXXXXXXXXXXXXXXXXXPRNIETAN--FLNDEEKRIATLRVLKD---SSHQISQKLTVAAFFKPLADWKVYVLAVIGI-CYGTAASSVSIFLPQIIERMETSTLRINLLTVAPNFVGGLWVLLMSASSDYFRERSLHLSSSMALTMIGFIILSQVPNTGVQYFATFLCCMGAFVPSVLFHVFHNCNDPSDVG-RGFRTAFLTFFANSAGLI-ASNIFMSSEAPKYPTALKVNFALLAVGIALVLGLRTYMMLDNRKRNKAQGANWTDRDVPTAALALGPKSP....... 482
168 0.000e+00UniRef50_A0A1Y2BFN3 Pantothenate transporter liz1 n=1 Tax=Naematelia encephala TaxID=71784 RepID=A0A1Y2BFN3_9TREE  ali  26  2.......................................................................SVEPAPSALPQEALAYVSAVDATPSSTPEAKKSTKGWWQKFVSVVWDPDYYEKSDAERKLVSKIDCGILTCVAFGYLMKYIDQTNLNNAYVSGMKTDLKFKGNEYTYLTVMYNAVYCIMQVPANLLVLKVRPSYVLAGCELGWMCFTFAQAGAQTVNQLYAFRFFIALFEAPFQPASILLMGSWYNKNELGKRVAIWMISGTAGQAFSGFMQAAIYKTLEGAGGLPGWRWLYIICGLMTLPCGLAILFFLPDYPSNTKVWYLTEEEKEMAKARCALAGTKPA---TGIINRQTFLRFAKGWHFWVLLPTYVV-YAWGVQSYNYFNTYLLLS-GYSVSNRNXXXXXXXXXXXXXXXXXXXXSDRFQSRFAFTFGPVLWGLVPTGILCFYAPSKSVRLFAFMVAE-TYFVTPVYFTWVNELCRGDAEERAFMIGAANCLFYAVNAWLPTLVFLQTQGPRWKKGFPTLFAGCILSCFAFVLIRYLERRDRNKASIMEEEPEVRAQAEETLAASEGDE........ 509
169 0.000e+00UniRef50_G3J498 Phthalate transporter n=5 Tax=leotiomyceta TaxID=716546 RepID=G3J498_CORMM  ali  17  2....................................................................................SHEAKNAAVVEKDQADVSHLEKNGSLRDDGASGDGHITLTEEQERSIIWRIDRRLVLTVGALYCVSLMDRVNMSAANIAGMAKELELTGYRYAIANLVFFVTYIVFQPPSTVMIRAAGPRRHLSLITLLWGVVTLCMGFTKNHEQITALRAVLGIFEAGFFPSAVYLLSTWYTRYDVGKRYSVFYIVGCLAAAFSGILCYGLMQ-LNGEGGLSGWRXXXXXXXXXXXXXXXXXXXXXXDFPDSDRPTWLSRDELNWVVARIHRDRG---DSTVSKFDMRSFFGNALDAKIWSFALI-FFNTTTITYALAYTLPILIENMGFTVGQAQCLVAPPYAFAGIIMYASAALGDRFRVRGPLIIFNMLLCLVGLPIMGWASSTGVRYFGVFLVTAGANCNVPTVMAYQANNLRGQ-WKRAFCSATL-VGFGGIGGIAGSLIFREQDKKTYKPGMYACIACAALNVLLVAVTDLYFHSANKRADKGGKVPESHDDND.................. 489
170 0.000e+00UniRef50_A0A1E3Q083 Uncharacterized protein n=1 Tax=Lipomyces starkeyi NRRL Y-11557 TaxID=675824 RepID=A0A1E3Q083_LIPST  ali  19  1.................................................................................MTDPEHRGSSRTMEDIKIDDKFTENLDENADSGAYAAAAIVFTAEEERRYLRKLDIRLVSLLSAIYLCSFLDRSNIGNAKTAGMSASLKLTSNQFSWLLTIFYIPYIVFEF-CTLFWKVFPANYYVFAVVFFWGMVSALQAVTHNWAGMMVLRFFLGVAEAAYGPGVPFFLSFFYHRHEMAFRSGLFFSSAPLASAFAGALAYGITS---GESKLANWRLLFLVEGIPSMLMAIVALFFLPRSAPEAK--FFNAREKEIAASRLARQSGQTSHKL--GLNVKQIFEAMMEPRSWIIALMY-FCVNVSFSSLSVFMPEIINAMGYTSVHAQGXXXXXXXXXXXXXXXXXXXXXKYHIRXXXXXXXXXXXXXXXXXXXXXXXXXXRYFAIYLCAIGMFTTVGVIMPWSVDNQ-GTDSKKGTGMFLLNLVGQC-GPLLGTRMFPQTDAPYYRKGMWVSCGCLFAVTLLAVILRFYLQLLNHRLDKRWGPVESQNVEELQE............... 486
171 0.000e+00UniRef50_F9F2U9 Uncharacterized protein n=2 Tax=Fusarium oxysporum TaxID=5507 RepID=F9F2U9_FUSOF  ali  16  1............................MAYSDDVRVSESKNAVDLHIDPTDSDSSKSIPSTKVTPATLPLAAPEEPRSWWQRRPRQDGEAVATRRSVFDDPDMARRYQPRSDWHRFDPSERWTFNEERKVIRKIDRRIMIFACVMFMALELDRSNLSQAVSDNFLPDLKMDTNDYNLGNTVFKLSFLCAELPSQLVSKYLGPDRWIPMQLCLWSLVSAGQFWLDGRASFLACRALLAIFQGGFIPDTILYLSYFYTASELTVRLAFFWTAYNVADIISGFLGAGFLQ-LRGWHGYEGWRXXXXXXXXXXXXXXXXXXXXXPAGPTQTKNGWFTEREERIMVNRVIRDDPSKGDHNRQPITPKLLWASIKDYDLWPIYAIGLTFLIPATPPAQYFTLTL-RGLGFNVLVTNLLTIPHTILSIGGLLLISYLAEKWNERSLLGLAVQIWKLPFIIYLYVVDMSTVNRWVSFAVLAGSPTAHPIQVSWNSRN-SNTVRLRTVSAAIYNMSVQSAG-IIASNVYRKDDAPRYREGNKNLLAIIALNITLYLLTRTYYIWRNKSRDKWDAMDDEQKKHYLDTTKDEGNKRLDF.... 573
172 0.000e+00UniRef50_A0A1Y2FVR3 Major facilitator superfamily domain-containing protein n=1 Tax=Leucosporidium creatinivorum TaxID=106004 RepID=A0A1Y2FVR3_9BASI  ali  20  38...............................................................................................................................EKHLLRKIDFKLVPFLSLLYLLSFLDRVNIGQAKLDGLEDDLNLVGNQYNIALVVFFVGYVITEVPSNILLKKLRPTRXXXXXXXXXXXXXXXXXXXXNFAGLTAARFVLGLTESGLFPGICFYLTMWYRRREANLRISIFFSSATLAGAFGGLLAYGISQ-MDGLGGRXXXXXXXXXXXXXXXXXXXXXXXXXADFPEESK--FLTPDEKAAVIARLKEDQGAAGEA---KFSKVHFFNAVKDWRVYCYMLIYI-GVAEPLYSLALFVPTIIANLGFTRPQAMLLSTPPYFLAFFVTLASALYSDRIGHRGXXXXXXXXXXXXXXXXXXXXDHPAPAYFAVFLAVTGVAPCISGTITWCGNNI-GPTLKRATGMGMMFTLGN-SGGIVSSLVYFKQDSPRFQRGHAVGLGFACMAILLSLFLTFNLKRENARRDALYGRWGLEGMSEDEITALGDRHP....... 511
173 0.000e+00UniRef50_UPI000D7F8CDD MFS general substrate transporter n=1 Tax=Aspergillus saccharolyticus JOP 1030-1 TaxID=1450539 RepID=UPI000D7F8CDD  ali  18  102...........................................................................................................................................IPWLSLLYLASFLDRTNIGNAKLEGLQTALHMSNAQYNASLTVFFVSYSVFEPLTNVLLKRTRPSLFIPTILVLWGICMTTMGLVHNYGGLLTARWFLGLAEAGLFPGISYYLSCWYRRAEFGIRMAXXXXXXXXXXXXX-XXXXXXXAQMDGVGGKEGWAWIFILEGLATVVLGAMSYWLVYDFPD--RAAFLSEAERKRVLRRLAADTQGSG-AREQQFKSAYVWASLQDSKTWLGCVIYM-GADGALYAFSLFVPTIINGLGYSSTRAQLLSVPPYACAAILTVTIGYLADRTRQRXXXXXXXXXXXXXXXXXXXXXESAGVQYAGVFLGAMGIYPCIANTISWVSNNVEGAPYKRGITLGLMIGWGNLNG-IVSSNIYRTEDAPRFYPGHGVVLGYLVVFLLGSVVQYLLLRRENRRRVRGERDYRLEGLGAEEVEELGDQRP....... 559
174 0.000e+00UniRef50_A0A1Y2G2P8 Major facilitator superfamily domain-containing protein n=1 Tax=Leucosporidium creatinivorum TaxID=106004 RepID=A0A1Y2G2P8_9BASI  ali  19  11............................................................................................................................TPAYRRGMLKVDFYVTGVVLLLYLFAFLDKANLGNARVAGLQRDLGLSSTQWSLVLTALYPPYMFSEIPVNLMLKRIGPHILLPALTLSFGIVCTFQGFVTSYGGLVACRVMLGLAEGGLLCGIVLYMSTFYPRYSFQLRCVFLFSATSLAGAFSGLLAAAISK-LDGHGGKPGWAWIFFLEGAATCIFAIAAFFLMA--PSYEKAWWLKQEEKEAL--RAGYNSSGRGEEHDAHFTWAEVFSTFKSPFM-LMMLPVFWSNGLILFGLAYFAPTIVGTFGYSPIQTQLHSVPPYAVVFVVAVISSYYSDKHGIRGWNLVVFGGIGLIGYAINIATSNRSARYAALFLQAFAGYAPSPVLSSWLVDNTA-PFYKRGTAIGASY-MATQIGAIISTWIYPT...................................................................... 401
175 0.000e+00UniRef50_A3GET9 Allantoate permease n=42 Tax=Saccharomycetales TaxID=4892 RepID=A3GET9_PICST  ali  19  6..............................................................NSRAKSVGSSDQSSENSKLEKVHVVNTELDELESSSSEK---LYEQTGYECRHHFDPDFTWTEAEEKKVVRKNDWYVTFWAFVMFTALDFDRNNIQQALSDDMLTDLGLTTNQLNLGNTINLVCFLSAELPSQLISKKIGADVWIPMQMILWSVVSMSQFAIKDVHGFYATRALLGALQGGFICDVCLWMSYFFTSKELPFRLSLFYIANPMTAVWSSLLAFAVLKV-KTKSNPEGWKWLFLIEGTFTLVAGIAAFFKMPASPVQTKTWWYTDREEKIVVNRVLRDDPEKGMHNREPVGPKELIGAVFDYNLLPIYIIRILG-DIGTAPIATYLQLVLRGMGFSTFKTNALTIPYNVLSVITMLLTGFFSEKLNTRALMIATTPLWIIICLFPLRYWPGAQKDIWGSFALLTGHAPIWPLTISWCSANSNG-VRSRAVSAAVVNIFSQSAS-IIAANIYRKDDAPLYHRGNVDLIGIAFGALFACVFAKYYYIWVNKKRDKWNAMSIDEQEEYIRNPRHDGNKRLDF.... 535
176 0.000e+00UniRef50_A0A1X2IGW3 Major facilitator superfamily domain-containing protein n=1 Tax=Absidia repens TaxID=90262 RepID=A0A1X2IGW3_9FUNG  ali  20  3...........................................................................................DEKKIKSSSDDMNSISTGEPHYEGSENVVYESDPFVEKKLLRKLDFW----------------SNIGNAKLGSFEKDLHLEGNGFYQALMVFYIGYA-----SSIVSKFLPLSRRLSALSIETGVCSTSIAGTTNLAGVIAARFFLGCSEAGLGPCVPLLLSFWYKRDEMASRVSIFISASTLAGSFGGIWAYLIMDYLDQVEGLASWRWMFIIEGVPTILLGILCLLFLPNYPETASKRWLTPDEKRLAIQRGNAEGKGN---NGDGLDWRQVSVALLDYKTWMISFIN-GAAVLCHASFSIFLPTLVKAMGFQALQAQLLSAPPYVVGCIVLLVSSKLSDRINQRGIVILGCTITTVIGYTCLVIGEYIPLQYTGVILVACGINATIALGISWLSNNQFGS-TRRGVSLSASNMIAQVFG-LAATQIYRDSDGPTYRIGHTVCLTFSFLAIFMTLFLRYLLAQENKRRDELYGPVEKKETVVNDSEDDG........... 490
177 0.000e+00UniRef50_E5AA74 Uncharacterized protein n=1 Tax=Leptosphaeria maculans (strain JN3 / isolate v23.1.3 / race Av1-4-5-6-7-8) TaxID=985895 RepID=E5AA74_  ali  20  393....................................................................................................DNKAQVEERHHGVGLAANMSPERRAEVEKKLKFKLDLR-CSLFILIYIMNYLDRNNIASARLGGLQEDLGINNTQYATCLSILYVGYILMQVPSNIIINRIRPXXXXXXXXXXXXXXXXXXXXXXNFSGMVAIRFFIGFTEAAFLPGALLILSKWYTKRELTLRNALLFCGNLISNAFSSLVGAAVLGNMEGVLGHRAWRXXXXXXXXXXXXXXXXXXXXLPDLPHNSRG--FTEEERAVAVLRMTEDVGEVDADSEEQGVFDGLFMAVKDTKIYVMMLT--FTAYVVGLSFNAFFPTLTQTLGFSRIGTLLMSAPPWAFACIVSIINAWHADRQQERFWHIVGPIFGGLVGFVISMSTSNTAGRYVALFL-QASSYAGFIVFYSWISSSFPRPPAKRAVAIAMVNAFSQ-LGNIAGSYVWNMKDN-GYRNSYGVVTAMFGVTIVGCYIFKLILVRLNKRLDEGTDAWVVHGDVAEQTARTEGISVED..... 873
178 0.000e+00UniRef50_A0A0F0I8Z8 Major Facilitator Superfamily protein n=4 Tax=Aspergillus TaxID=5052 RepID=A0A0F0I8Z8_ASPPU  ali  19  370..........................................................................SKSVPSSDLERHDTFKSAGRNASLDDNDTNKLGAYASAPGVVEDVVRVVDHKAERALCRRFDLRLLPILAVMYLFNALDKGNLGNAETDGMSDDLNFKPNQYNXXXXXXXXXXXXXXXXXXXXXKRFSPARVLPILMFSFGSFTLLSSATKNFGGMFALRWFLGMSEAAFFPLVIYYLTTFYRRGELARRLAIFYAASNIANAFSGLIAFGVFQIKN--SSIPNWRYLFIIEGGVTVLFSIFAFWYLPRSASEAK--FLSDDEKALALHRIQVDSSAVV---NEEFRFREALGIFKHPSTYVWLCIEI-CLGVPIQGVALFLPQIVQRLGYSTVKTNLYTVAPNVTGAVMLLILAFCSDAVRLRSXXXXXXXXXXXXXXXXXXXXNDVRVAYFATFMMTWGTSAPSVLLSTWYNNNIA--HEGRRVLLTSIGVPLANLMGLVSSNVFRSQDKPKYMPALITVGAFGATGAALAGCLGIYMWLDNKRRDRRDGVTVRAQDVPTERLRDGPASP....... 875
179 0.000e+00UniRef50_Q5K9T2 Uncharacterized protein n=65 Tax=Dikarya TaxID=451864 RepID=Q5K9T2_CRYNJ  ali  22  21...........................................................................................EPKEDVVVELRGVDAKYTKPIPENIRNLSADELKAIEKRIVRKADMVMMPIMGLLYILNYVDRQNLASAKLQGIMTDLNMTTQQFATAVSILFVGYLPYQIVSNVLISRIRPGLYICIACAIWGVLSACTAAVKSYGALLAVRIMLGFVEAVFFPGAIYLLSAWYTKNELGKRIGGLYIGQQVGNAFGGLIAAGCLK-LDGVHGIAGWRWLFIIEGAATVGAALLCAFVLPEYPYNARL--LKPLEREVAVWRLEIEAG-AAEGNEKVGAWAGFKEGFHDPKLYALIFFNMMSQT--QGSIANFFPTIVQTLGYSSIITLLLSAPPYVFAGGYYMGMTWISDRYNXXXXXXXXXXXXXXXXXXXXXXXXSIGGRYTAMIFMPCTSVGPQLLLYKTINHHMPRPVAKRAAAIALMNAIGGTSNIWASYLWF---SGPKXXXXXXXXXXXXXXXXXXXXXXRFYVRRENRLLDGTPEEVARVMKRGQEQVDMG........... 505
180 0.000e+00UniRef50_A0A1Y2EEJ5 Major facilitator superfamily domain-containing protein n=3 Tax=leotiomyceta TaxID=716546 RepID=A0A1Y2EEJ5_9PEZI  ali  20  8.................................................................................PAKLAHGDAVDQSPTEIAGDNSYHPGNGHVEYDELHVICPPHTT--ERRIVTRIDFRLMPFVTLLYLLAYLDRINIANAKVFSLVDDLALDGVKYNTALTMFFIPYVFFEIPSNIMLKKFSPKIWLPGCMLGFGIVSICQGLVQNYAGLLVTRFFLGLFETGMLPGCFYLLGMWYKRSEAQKRYSLFFSSTSLAGAFGGLLASAI-GKMDGMRGFHGWRXXXXXXXXXXXXXXXXXXXXFPSFPEQA--AWLNEDERAYVKTRLQADQGRNAAERHVGF--RDVLSVMKDPRX-XXXXXXXXXXXXXXXXXXXXAPTIIQTYHYSAIQTQLHSVPPWAVAFGFSFLIAAISDWAKHRFLFTIMPLFLSIAGFSILLHEHSDINXXXXXXXXXXXXXXXXXXXXXXXXNMNLGGHHRRSIGTAWQIGFGNIGGI-ISTYAFISTDAPHFTKGYSLCLAFTSLSGLASIAYFVSNIIENKRRAK---SVTNVGLSEYEKTELGDLNP....... 500
181 0.000e+00UniRef50_A0A2S6CGL2 Uncharacterized protein n=1 Tax=Cercospora berteroae TaxID=357750 RepID=A0A2S6CGL2_9PEZI  ali  19  3.......................................................................................................SDKAVEVIESIEDAPELSEHEREVEKSLVRKIDIRFIPVTILIYLLYYLDR----NAKILNILQTLSLSNHAYVVALMVFLVAYSVFEVPSNLALKIISPAKWISFLVIAFGSFCTGIGGVQDATSLTVLRFFLGAAEAGVFPGLMYYFTFWYKPSERAFRIACFLCSATLAGAFGGCIAYGV-GHMNGVLGLQAWRWLFIVEGAPTVFLGICLIFLLPSYPEDVS--WLTAKNKVF--------------NSQQKINWKDAKAILLDLSMYGHYLAY-TGVGCGVASLSLFAPTIIQGLGYRGLHAQLFTVPPYAVAYVCTMLAAYASDRYEMRGLIAAV------------LPGERFTGRYALLIFATSGVFAALPSLNAWVGDNATNTTCM-SLVFACNVAFSG-PGQIAGVWIYRSQDAPLYRLGHGVNAGFTALACSLSFVLYFYYRGLNKKMA............................... 431
182 0.000e+00UniRef50_A0A0S7DX55 Uncharacterized protein n=1 Tax=Aspergillus lentulus TaxID=293939 RepID=A0A0S7DX55_9EURO  ali  21 1615.................................................................................................VTDTKYPVGTTETALSKDDFPPDADIDPRAERALVWKFDLRVLPVLAVMYLFNSLDKSNVGNAKTAGLEKTLNLKGNQYNXXXXXXXXXXXXXXXXXXXXXKKYGPNRVLPCMMFVFGLCTTLVVAVFNFSGLLAIRWFLGMAESAFFPLVIYYLTTFYRRGELARRLAIFYAAQSIASAFSGLLAFGVFRIQSG--PLAPWRYLFLIEGGGTILVALFTLWYLPRSAAHAS--FLTPDEKQLAYLRLQRDSSAIV---NEKLNLRDAFKIFRHGTSWLILAIQI-CLGVPLQSVQLFLPSIIKRLGYDTVKTNLYTVAPNVSGAAMLLILAFCSDWTRWRXXXXXXXXXXXXXXXXXXXXXDDINVAYFASFMMTWGTSAPSVLLDVWYNNNIAN--EGRRVVLTSIAVPVANLMGVVSSNIFRFQDAPRYMPALITTASFGGTGILLTLVLGGWMMVDNKRRDRVQGRKIRAQDVSTERLHEGPDCP....... 2096
183 0.000e+00UniRef50_Q10097 Uncharacterized transporter C11D3.18C n=4 Tax=Ascomycota TaxID=4890 RepID=YAOI_SCHPO  ali  19  1................................................................................MSDQSEYKISKDDEHSIYASEKEKLQNTASPDVDYGDTASLKIDPKVEKKLLLKMDLVISPIIGFLYLMAFLDRSNIGNAAVAGMTEALSLYGERLNVAVSIFYVLYILVETPSVVLVKRIKASRMLAFISFAWSMTVLFSGFMSSYGGLIATRLILGLLEGCLFPALNLYLTTHYTRKEQCQRLSYLFASAGLAGAFGGLFAYALEQV--HAGNKEGWQWIYIVEGLVSFIGVPLCLFALPDKMENA--WFLTREEREVAIIR---RDINARYHGEQHFEWSEVRKAFKDPKVYV-SATSQFCADMVLYGFSSFLPVIIKGLGFVGLQTNXXXXXXXXXXXXXXXXXXXXXDRTQLRXXXXXXXXXXXXXXXXXXXXXDSNAAKYTATYIIAIGCYIGPGLNLGWLNNNVAG-HYKRATAIGIQQTLANSSG-IVAGQIYRSKNAPKYILGNAFTLGCVIVGGLAYVVMFFSLRYVNKKRDERCARGEFDPSAIGDFADD............ 493
184 0.000e+00UniRef50_A0A1L9TRM8 Uncharacterized protein n=4 Tax=Aspergillus TaxID=5052 RepID=A0A1L9TRM8_9EURO  ali  20  1..................................................................................................MDYRSPTSRDFLQPENNASDELSEAEKQIEKKLVRKLDLLILPLIVLSFFLNCIDRANYGAARLQHLESDLHMSDSQFQTGFSVFYAGYLLFQVPSNMLLNYFRPSWHMGVSILAWGVVTSCTAAVNTYGGLVACRMLLGCVEAPLYPGIMFYLSKWYKKTELTLRISICLAAGLTATATGSLIAAGISSGLDGAHGLSAWRWVFLIEGIVSICGGFLFIAILPDFPHTWTA--LSPEAAEVAIRRLTLEASQSDIDDDSMSLIDGLRLALLDKKLYIMIAINMC--IIGAIGCQNFFPTMTATLGYNHVISLLLIAPPYFFTAIYSCIHSYLSDRSENRXXXXXXXXXXXXXXXXXXXXXXTSFGPRYLSMFLMLFIYSINSTATAWIATSISRPPAKRAATYGLVSMLSNT-SALWTPYTYRARDSPHFRXXXXXXXXXXXXXXXXXXXXXXXXXRENRQLDEVDRQRAVAEGTESEKPKQG........... 480
185 0.000e+00UniRef50_A0A2K1R399 Uncharacterized protein n=2 Tax=Elsinoe TaxID=40996 RepID=A0A2K1R399_9PEZI  ali  19  6.............................................................................................KEEDIVSSAMPLESASMSSGPKSPSHIPEYDVAAVRALNRKLDLRVLPPIVVLWFWAFIDRVNMGSARIFGLERDLRMTGDQFNVALVIFFVPFILLEVPSNLVMTKLKPSTWLCLQVMCLACFTIGQGLVQGFSALVAMRWFIGVFEAGLVPGCIVLLSTYYPRFDLQWRLNVLMVGNALAGAFGGLLAYAI-AGMAGTNGWSGWRWIFILEGCITAGMVVICWLLMVNWPEEMS--FLSDADRDMIRNRIAAQAGSFRMDRFDGPARK---RTFLDWKIWINIFIYV-GTVATTYSINLFSPTIVQALNYTGRRVQALCIPIFVLSTATALGSALVSDKLKHRYGVAMVGYITSIAGFIILLNSVSVGVRYAALYIISGGSYISLPTLWTMMVNNVSG-RYKTSFASAAQIGIG-SSGGILASMVFQRREAPFYWKGYYXXXXXXXXXXXXXXXXXXXXXXENKQRAAGKRDYRLQEK---DIDNMGDDHP....... 492
186 0.000e+00UniRef50_A0A1B7P8Q4 Uncharacterized protein n=23 Tax=Onygenales TaxID=33183 RepID=A0A1B7P8Q4_9EURO  ali  20  4.........................................................................................PTHAPLSDSKNIIEGSDVEHGRPDGGETAENKVDQYELEKNLVRRQDLIILPQMAILYLVAYLDRSNFGNAKLQGLVEDLEGNDNYYNWAASIFYFGYVSFAVPFTLYGKKLHPSRFMFICVLGWGVAASAQAGGYNFAGIAAARFFVGLFEAGFAPTAIYYFTLWYTREEVAFRTAXXXXXXXXXXXXXXXXXXXXTLINTNFG---HWRILFLAEGIPSVICAFFALAFLPDRPETSK-FFKNEAERKLAIERM---NRGQQSEGHGVLVTKHVIAAFKDWTIYALALIKM-GHDAALAAISVFLPTIIRSLGYTNQQAQYLTIGPYMVAWASLLSVCYFSDRLRMRGPFLFGCGLVSVLGLALLYTHPNPKTALGGIFLLLAGVFPCLSLELQWATGNCGAESKKTAAVS--IMVVAGHCWSILASHSFPDVEGPRYVRGYAIVLTFLSLGVVISAFLHFRYRRINAERDRLYGKPNPNEKVDTSELADK........... 490
187 0.000e+00UniRef50_A0A261XYV5 Uncharacterized protein n=1 Tax=Bifiguratus adelaidae TaxID=1938954 RepID=A0A261XYV5_9FUNG  ali  21 1867...............................................................................................................................ERKLVHKLDAVILPITMCMYLCAFLDRGNMGNARLQGLEAELGGNDLRYSVCLAMFYVTYIAFNVPGNMLAKVLPPAKSLALATFVWGVAATCQAAVKNYAGLIVCRLFIGIGEAGFGSAVALYYSMWYKKNEIATRLALFIGCGALAGTFGGLIAYGVGNIQS--SSLSDRQILFLIEGLPCLFLSGIVFLFLPDRPETSK--FLTEDERVVANTRL--NSHAGPAEGPRHFDMRSLRRALSDYKNWMIASMY-LGVNLTLGYISGFLPTILTTLGYSNVNAQXXXXXXXXXXXXXXXXXXXXSDRFKIRGTLVCFNGLVAAVGFIILLAVHNNHVRYFATFLIVAPTFTNIPICLSWASNNNA-TESSRAVALGLVNSVGQCFS-ILASFSFPSSEGPLYIRDIALNLAFSLVTALLGITLYTILKVENKRRDRAEGPPSES...................... 2303
188 0.000e+00UniRef50_I1RUV9 Uncharacterized protein n=32 Tax=Hypocreomycetidae TaxID=222543 RepID=I1RUV9_GIBZE  ali  18  2................................................................................ASSVHSKLGSLDAKRNVEYDENAPERDEVLERYALIRDKTPDERAAIEKSLVRKLDWKFLPMVTAMLLMNYLDRINVSNARLAGMQEDLHMSDTMWSLGISLFYVGYIISQIPANVIIAKGRPRILLPSCMLAWSCVTICMPAVTAGWGFCLCRFIIGLVEGPFVPAVSLMTSSWYTKHESPLRMGIWHAGNTISQALSGLLAAGILTNMEGVANLRAWKWFLLLEGAASILVAIVSFKFIPNFSDNTGTYFITEEEAEMAQYRQAVSAGGLSEDDAGDY-WGGFWMCMKDPFSHLFAAIHFCLII--GQSYKDFFPSIVATLGFSGTTTXXXXXXXXXXXXXXXXXXXXSSGRRLEHGYHIIVPILLTLVGCAVMISTLNVGARYFCMILLVIGPFVGLNLQISWETTVVPRPRTKRAALIAYANCVS-SVSHWFTPYFFLRNQEPYYQTGGGAIIAGCGLVVVFVLITKWYVNKKNKELEAAENAAGE....................... 487
189 0.000e+00UniRef50_Q755I1 AFL158Cp n=10 Tax=Saccharomycetaceae TaxID=4893 RepID=Q755I1_ASHGO  ali  66  7MVDILKELVVQPWRRLKWGFIPVRRRLE---EDAGGVATTTEDGSLKESGLQKTTSL--------------------DTFTEEKYEYRDESKRPWWKYLDEQEYRVTKAHASKRRSWSWFGTATSKAEKKLLFKLDVLLAFYSCLAYWVKYLDTVNLNNAYVSGMKEELGMSGNDLVNTQAMFTVGAVIFQLPFIFILNKVPLNYVLPALDLGWSVLTLGAAHVNNVGQLKAIRFLIGVFEAPAYLSYQYLFGCFYKHDEIVRRSAFYYLGQYAGILSSGGIQSAVSATLDGKNGLSGWRXXXXXXXXXXXXXXXXXXXXXXXDPNNCYSIFLTDDEIRLARRRLEESNIDKSDFSSKIFDKQLWKNIMTDWKIYILSIWNIFCWNNNNGPAGAYLLWMKSLERFSTPNLNRLSMITPALGMVYLILTSLIADLGHSRLAAILLTQVFNFMGNVILAVWDVSESAKWFAFMLQYFGWAMAPVLYSWQNDICRRDARARAVILVVMNTVAQAMQAWISVLVWKTSEAPRFLKGFTFTSVDIFCLSMWTFVVLWFYKRDERMHCRENNVIIVNPKKDE................. 559
190 0.000e+00UniRef50_A0A1Y2A259 Major facilitator superfamily domain-containing protein n=8 Tax=leotiomyceta TaxID=716546 RepID=A0A1Y2A259_9PLEO  ali  18  14..........................................................................................................DDVGTVESKDDSMESEFTPAEQRKIIHRVDRRLVVTVGVLYCISLMDRTNLSAASIAGMTKELKLDVSRYSVVTLVFFTTYIVFQPPSTIIVRKLGPRXXXXXXXXXXXXXXXXXXXXKDWKDLAGLRVILGILEAGFFPSCVYLLSTWYTRYDVGKRYSCFYILGSLASACAGILAYGLMQMGGLQGLGG-WRWIFIIEGVLTCVLAIGSYWFLVDFPDEASFKFLNERETKFIMDRVNRDRG---DARIVPFSAGSFFRAGLDLKIWAYAMI-FFNTTCVTYALAYFLPIILRNMGFSIGASQCLVAPPYALAAIVMYATGWFGDKYHLRGPVICFNMILCLIGLPIMGFHSNANVRYFGVFLTTAGANSNVPAAMAYQANNIRGQ-WKRAFCSATL-VGFGGVGGIAGSLIFRTQDAPSYHPGLYACIACCLLTLIIVAITTLVFLRQNKRAARGEIELEDSEED................... 482
191 0.000e+00UniRef50_H2ATZ4 Uncharacterized protein n=1 Tax=Kazachstania africana (strain ATCC 22294 / BCRC 22015 / CBS 2517 / CECT 1963 / NBRC 1671 / NRRL Y-827  ali  19  1......................................................................................................................................MDMYIIPLMGLLYFLSNLDKSNIGNAQIAGLTEDLNLVGTQYNVCVTLFYVTYIVFDPVGSTILKFLGPKLMLSTSLFAFGVISFCTAWVKNYHGLLVIRLLLGASEGLIYPAINMYLSVCYRREQYAKRFAYVFTAACISSSFGGLISYGCAHI---NGSLSAWQYIFIVEGCISIGCVPLFIFGL--SKHLQDSWFFDEEEKEYVIERYKSMSTFNPADQ---FSWYQVFLAVKDVKTWV-CSIALFGIDLTTFGLTVFLPSIITTMGFTNVRAQLMTVPVYFLSAVTFFICALYSDKWKIRFPFIMGACLITSVGLAIVLGSEIHGVRYFGVFILCMGIYVSAACNCLWLSGNNAN-YYKRATALGINLFFGSGSG-ILSGQVFLTKDKPKYTLGLSLCLGFQLLSFILTFVQFLLYW...................................... 410
192 0.000e+00UniRef50_A0A1E3HNV0 Uncharacterized protein n=4 Tax=Cryptococcaceae TaxID=1884633 RepID=A0A1E3HNV0_9TREE  ali  16  1....................................................................MTGLDRSSSSREEYPVEKQLSPVYTTNEGGSDKGEEHIVEKENPEYVEYLALAEIYQGEKKNLTKRVDWHVLPQLAFIYLLTHIDRNNVGNAKLFGALEDMNLSSEMWNLSLSLFFITYAIGNPPCTMLLKRYGPRPVMSGILVTVAIVLVCSGCAGSIASWMPLRLLLGLFEAGVYPCSIFILTTWYTPSELHSRNTIFYCGASLSGAFSGLLAYGIGQ-LDYTWGYRGWRWIYVIEGVFSFVVGVGAYFVLQESPAK-QGGWLGDEDRRFLVLRNRYAYGHDASGNSDKMKKKDIIAALKSIHVWAISTAY-LAACLSVYGLTFTLPTIMNDMGFSRGKSQAVSAPPYVFATICIIISGWISDRYRMRXXXXXXXXXXXXXXXXXXXXXXXTALTYVGTCLAAGGAYCLNPAYASWVGLNSAG-AGKRAIAISLSVLWAQ-IGGVAGSNIFMGKEAPGYHTGFGVCLAAVGFGILVPCAYYLYIGHTNAKRGKMSEKEIYAKWTQEELREMGDLSP....... 519
193 0.000e+00UniRef50_A0A0F7S095 Related to TNA1-high affinity nicotinic acid plasma membrane permease n=15 Tax=Ustilaginomycotina TaxID=452284 RepID=A0A0F7S095_9  ali  16  4..................................................................................RTPDSASIEKKDDSRLEDGVMMAPVLTAGTTNADAVASTVEDPKETARLLRKLDWHVLPMCSVLYLMSFLDRTAVGNARVLGMQKDLKLSDNDYAAALSIFFALYCLLEVPSNLILKKLGVKKXXXXXXXXXXXXXXXXXXXXNFGALFAWRLLLGAAEAGLFPGITYYLTVLYPRKSIQLRVGLFFSAATIAGAFGGLLAFGLAKV--HAGAYNGWSWIFFCEGVLTILVGVIAYFALFDGLE--KAPCLTESEKIYMSDRVHFDGNDIPMNNE--FAWKFVWAGLKDWKT-LFTLICYVTTITPLYSTALTLPTILKTLKYNSVDANLYTVPVYTVAAVTVVIFAYFADRTGIRFPFICLGTLISGIGWGLSLAYSNPRIAYGAQFISAAGSYAAFPGVVASLTQTVGG-KTKRSVCIAIIVGFGGLAGTI-SSNIFPKKQAPYFHRAHYINIGMNAVAFCSALSFAGLLYLANKRKQAKIDSGEAAGLTREQIADMGDESP....... 501
194 0.000e+00UniRef50_A0A0B7KPH1 Uncharacterized protein n=14 Tax=leotiomyceta TaxID=716546 RepID=A0A0B7KPH1_BIOOC  ali  19  8....................................................................................................EKMPNKDLVEVTTIRSATMAETWGPDEEKALVRKMDIRIFPVMIVLFILNFIDRNNFANARLRGLEKDLNLTDVEYQTCISILLVGYVSMQVPSNMILNKLKPSWYLCGCVATWGVISAATAAVHNATGAILCRFILGCVEASFFPGSIYFLSRWYTRKEMQLRVTILNLGNLAAQAFGGLIAAGILANMEDKAGIRAWRXXXXXXXXXXXXXXXXXXXXXXDYPHTT--AWITERERFIAERRLTLD-IGESDETEDKSAFQGLKLALVDPKVWLLGLTY--HATIMGLSFVFFFPTITQALGYGTTTTLLLTAPPWIWACLVSLPNAWHADRTGDRFFHYFGPAALCIIGYIISMTTKTTAPRYFSMFLMTTGFASGF-VMLAWISNTIPRPAAKKAAAIALVNAMGN-IGSIPGSYIWPAKFGPFYVQSFGAEIGILGLACCSAFLLRTH........................................ 454
195 0.000e+00UniRef50_Q0UF78 Uncharacterized protein n=2 Tax=leotiomyceta TaxID=716546 RepID=Q0UF78_PHANO  ali  17  2................................................................................TDKPIDEKMADAEFKEVAPESYRITPQQIQTRFELLRNLSEEQMAALNKKLVRKLDWRLMPCITVMFLMNYLDRINVSNARLAGLQKDLNMNDTIWNTGISTFYVGYLVGQLPGNLWLAKADPRWFLPSMMMAWSIATICMPAMTSGAGFAVCRFFIGLSEAPFFPGITL--------KENPMRMAIWHAGNTMSNILSGFLAAGILTNMDDVLGLHAWQXXXXXXXXXXXXXXXXXXXXXXSWPHNTR--WLTPEESEMAQYRVQVSNGGVDEVLGG--TWDGVKDAARDPFTWLFCLMHF--ALVTAQSFKDFLPSIMSTFHFDKLTTYLVQAPPYAIAYAVACGLAYTSGRFQESCYHIVIPILFSAAGCSMLIATLNVGARYFGLILLISGTYSGLNLQLSWETTLVPAPRSKKAALIAIANCISQT-SHWFSPYFFPTSQEPFYRLGGGLILFGCVACVVSAMLVKMRAKALNKKLDEAEGWSEHTGVE................... 480
196 0.000e+00UniRef50_A0A225AN71 Uncharacterized protein n=7 Tax=leotiomyceta TaxID=716546 RepID=A0A225AN71_9EURO  ali  16  2.........................................................................................................PEKSELLFTTSIADDNAGNTRLRRRLVWKLDIRILPPLALLYLANFVDRSNVGNAKILGLADDINITNHQYATALSVFFVFYVVSELPSNLILKRMTPKXXXXXXXXXXXXXXXXXXXXKTYAQFIAVRVLLGIFEGGLYPGSLLFLSTLYTREELALRVGIFYSAASLSGAFGGLLARGLSAISATSTIHGSWRWIFIIEGVITSAIAIVSHFLLPNSVETAS--FLTHSEKEFAKKRLELFSEASVSSEPEHFQWSEVRRGIFSLQLFFTGTVY-FSICCALFSFSLFLPSIIQSLGYTANEAQLLSVPPYAVASVVGVGVAFLSDRMRVRGKLILVSLPLAIIGYALIARVSSNVTKYGLTFLMASGIYGSVPPLLVWILNNSAG-HYKRATAGAMQVCLANC-GGIVAAFLYPDSEKPAYVKSHNIILGLLCYSWISVLFNVLHVWKINKDKENGKYDKYVGSGDDRE................ 469
197 0.000e+00UniRef50_A0A0P9EUU6 Uncharacterized protein n=1 Tax=Rhodotorula graminis (strain WP1) TaxID=578459 RepID=A0A0P9EUU6_RHOGW  ali  14  12..........................................................................................EEKRYTEHVESSSTFGQAAEPHVGAVKVPARIFTRAEEDKLYRKVDLRLMPILAVLYLLSFMDRGNIGNARIEGLEADLGMTSQDYNTALSCFFITYCLCEVPANLVMKKFRPSRXXXXXXXXXXXXXXXXXXXXXXXXXXXXRLALGVAEAGLFPGVILYLSIWYPRERSQARVGFFFGAATLAGAFSGLLAYGI-GFMRG------------LEGLATFVVGVASFWLISDYPNECK--WLTQEEKEWLIYRRATDNSKVGEA--EHVSKSFIWSAFSTWQTXXXXXXXXXXXXXXXXXXXX-SPTLVAGLGYSRAQTQLLTVPYYVVAFLFVMAVAVLSDRYKTRFPFLMIELTLCVIGLVINISPAPSGVKYFGIYLIAMGAYGGLPTSVTWLSNNLSGQ-TKRAVGSAAQIGLGN-LGALASSNVYRKQDKPHYYLGHGVVLGFVMLGYICGPLYAVMLKRENARKTEWLEEEQRTQYTVEELRAQGDK......... 514
198 0.000e+00UniRef50_A0A2H3E131 MFS general substrate transporter n=3 Tax=Armillaria TaxID=47424 RepID=A0A2H3E131_ARMGA  ali  18  2........................................................................................SSISSQEKDKRNVSTVQVQNYEEEFEEFKALSEKYQGDVLAKLLRKIDCRLVPVFALLYLMSFLDRGNVGNAKVAGLTKTIPMTDKQYNTALTLFFVFYIVFEIPSQMMLKKFRPKWYISCLTLSWGLVMSLTCLIQSYRGFMVARSFLGITESGLFPAAGYTLSMWYSRSEMASRVALFFCAASVAGALSGILAYGI-SFMDGLAGMEGWRXXXXXXXXXXXXXXXXXXXXXXDSTAYC-GKWLSDEEKKFLILRQQYTETGPV-PPAEHFDWKYVKMAFTDWQM-IFQIGIFVTHGALGYSISFTLPVIIKSLEFTTYESYLIPVPIYIAACVLTYFNSWWGDRRRSRFLHXXXXXXXXXXXXXXXXXXHIAGVNLFGLILIVFASYSPVPTSISWMANNVIG--YKKVIAMGMLMGIGNCSGLI-GSNIYLTSESPKYQTGYGVSLALAVMGITCAIVLKIVYARENKSRD............................... 472
199 0.000e+00UniRef50_A0A261Y3Y7 Uncharacterized protein n=1 Tax=Bifiguratus adelaidae TaxID=1938954 RepID=A0A261Y3Y7_9FUNG  ali  26  22....................................................................................................EEMPSVSVWGSFKHSVFRRLYGEKSPEEAELVSILDKRLLGFAMLGYFLKVLDMTNLANAYISGMEEELNVQGIDYNWMYTFFWIGYLLMQVPSNALLTRVRPSLYLPCLELLWFILTLSMGFVRSVHAIFAIRFLLGLAEAGFYPGMIYLIGSWYTKEELGKRSSLFITAGSLGGLISGVMQAALLKGMNGVLGLSSWRWLFIIDASITLLLSTVGFLLLPDYPNNTK--WLTQEQRELAVARLAKQGRSST---RKSLNLAVFRTIFSSWQVYAFVAAWMLGHAASEGPHQ--LGIVAKKVGFDAVTANLLTSPLTLIDMVCIIGNGYLSDRYQTRKWCIVIPSTIGVIGYTLXXXXXXXXXXXXXXXXXXXGTKCTNSIVMTWVTEVLGESMEHRALIVGIMNTCTGIQHTVIPLLLWPVTDAPYFTTGFRFSVLLLMGFIATAFLIDALHKRDLRRKRKLSFNVPDGGDTFLNGHAMAMEARVDDA... 507
200 0.000e+00UniRef50_A0A0D2JYT1 Uncharacterized protein n=2 Tax=Fonsecaea multimorphosa TaxID=979981 RepID=A0A0D2JYT1_9EURO  ali  18  4...........................................................................................NNTSGKHDSEEDHVEVACNTGAPDEESFGFHFDAKFDRTAVFQLDLLLQPILFGTFILLLLDRANVGNARVAGLQKDLRLTDHQYQISLMVTFIPYILIELPSNYVLKKIGPRWLLPGLCVCWGIVTTLESLIQNYAGFVACRFFIGLCEGGVFPGYVVVLAEFYRRHEIQKRIAILYCAASLAGAFGGLLAAAIEQ-MDGLANLAGWRXXXXXXXXXXXXXXXXXXXXXPSGPRDVLT--FTAEQKEYYVRRMAADKQTTEDD---KVTPRDVLTCVKEPHFIIIAIMS-FCVGTVAQGVSYFTPSVVQTFGFSRTATQXXXXXXXXXXXXXXXXXXXXXDRYQRRGLLAIVTAALGALGCILNFSGTSLGIRYPSLFFLIGGIYACAPTVLAWLPNNMAA-YGKRSTAVAIGFMVSN-SGGILGVWIYPTKDAPRYLPASSANIALLAAVILFSTVQVLLLRYLNKRKIENREELLCGLEHDQQIKELGDRHP....... 492
201 0.000e+00UniRef50_B8NRG9 MFS transporter, putative n=9 Tax=Aspergillaceae TaxID=1131492 RepID=B8NRG9_ASPFN  ali  19  370....................................QCTADAFKSTSQTPRSVPQSFTSVATVVPGADSSEPKAKLANILAARQAHVIGNGTNPPNLYLTAMDQGVRELEGHVDSQSTDLPQLRNTTERKLMAKIDWHIMPCLCVMYLLAFLDRVNISNAAVLGLQEDLNIDGTNYNTALTIFFVPYIIFEIPSNILLKKLRPHVWLTGCMFLFGLVTICQGLVSNWGGLMTTRWFLGMFETGMFPGCTYLLGMWYKRSEAQKRFSFFFSSTTLAGAFGGLLASG-LGKMDGTRGYRGWRXXXXXXXXXXXXXXXXXXXXXPDFPEDVK--WLTDEERQFIRAKLARDSGSAGHDA--KIGWRDVLEVFKDIHRWFDVLRSGCHWICLLRADHYQELWLRW---YVSIKTQXXXXXXXXXXXXXXXXXXXXSDRTRHRFAFTIGPMLIAMAGFGILLNVHGQARRYGALFMVTCGCYSAMPVIVCWFAMNLAG-HRRRSVGTAWQVGFGN-IGGIISTYAFLKKDAPEYRPGYIISVSFLSFSAACCIGYFAAVWYDNRRRDQAIADGMAIPSDEEQELR............. 918
202 0.000e+00UniRef50_A0A0D2XFE2 Uncharacterized protein n=24 Tax=Fusarium TaxID=5506 RepID=A0A0D2XFE2_FUSO4  ali  18  1....................................................................................MEPSPTHPKPETLFSLEKFPDTQDIEEGTVHQYQPAPSVDEALESKLRWKMDLRILPTVTIIYLLCFIDRANIGNAKIAGLEADLKMQGYDFNVSLSIFYISYILFEIPLNLLCKRIGPGWFIPACCVGFGICTTCTAFVHDFSTLCGLRFLLGVFEAAMLPANVYYLSRWYRRSELTFRLSXXXXXXXXXXXXX-XXXXXXXXRLQSFGSLHSWRMIFAIEGTVTCAVGVISFFTLTDRVETAT--WLSPEQKKLANARIMAERVGTT-EIIDKFGTKRMLRGILNPVVLPTAVISFF-NFITVHGLSFFLPTIVRTIQHSVQNQQLLTVPPNVLGTIMCMLFCYISWKLDKRGIFLIICAPFSMVGYSMFLATSNPHVRYAATFLPVCGIFALGAFPNAHVSANVISDTS-RSSAVAFNVMLGN-IGGLVSTWAFLPFDGPEYRIGNGLNLAAQSAIFLIGVCMYFAIERSNKRRSGVNVERVLAGKTLSEIQDLEWRHP....... 515
203 0.000e+00UniRef50_A0A2U3EQ05 Uncharacterized protein n=2 Tax=Purpureocillium lilacinum TaxID=33203 RepID=A0A2U3EQ05_9HYPO  ali  19  68..............................PSYPQAVFGTLRVGSMFIKLRRACQYRTPCGPAAAPVSLVLRGCTHAFERSTVRTPSLDTMDSPTLTMDIDVKHMDAIHLETSHVDSLSHGFIDANKEKNLIRKLDLWISPIMTIIFLTAYLDRSNIGNAASAGMVADLNMTSAELGNAVTLFYVTYLAFEVPCPLVMKRFRPGRMIPFLMFCWSIVIIGTGFIHNAGHLYASRLLLGSFESGMFPCLALYLSTFYEPHEQALRISYLFVSAALSGSFGGLFAYALLK-MDGVAGLAGWRWLFIVEGCASVLISILVFFCLPDSFETAR--FLNEEDRSLMRIRAERNARFNGKPE---FDWKDVRSAATDPKLYISCFSQFM-ADTCSFGLSSFLPLIIKSFGYDTITTXXXXXXXXXXXXXXXXXXXXXXDRWRRRAFFMMPVCLVTATGYALNIGLPVSXXXXXXXXXXXXXXXXXXXXNCAWLLNSHA-PYYKRAMAIGMNQTLGNSSGIVVG-QIFKKTVNGKYLMGLSASLAAALLAMLGHLSLYLYLRQQNKRRDR---MTDEDRLREISEGKMGDFHP....... 613
204 0.000e+00UniRef50_UPI000D7FD083 MFS general substrate transporter n=1 Tax=Acaromyces ingoldii TaxID=215250 RepID=UPI000D7FD083  ali  20  24...........................................................................................................................RAAVERRLVRKLDTVMLPLFCLLNFFSYVGRANLGNAKTDGLEKDVGLHGQDYSNIITAFYIVFGFCSSFLCVTTKKFGPRRMIPIYVFGWGLMGTCSAFAKNFGGLLVLRVLLGFFEAGFGSSTILCLSLVYKRDELARRIAMPYVFAALAAAFSGLVSYGVFQINSPV--LHGWQILFILEGLLTISCAPLAYCFLPNKLET--VWWLTPEERSLAIERMQQDGSNVVDSS---FSLKDCVKPFLDVRTYAWGIIAV-SYGVSVATMSNFLPQIISRLGYSTVTTNLLTCGPSVWGAIAVFAISTSSDKLRDRSGHLIAIMCFNLIGFSMLYAVSPSKIWYGACFIAATGSWVPSVVFHTWHCNNQL-DENKRALDAGIFTMCANGAG-IITAQTFRAVEKPLYRTNLIATFSFASICIAVTVGVRAWMTIDNRRRDRQEGVPRKSWSVDSNELVDGEKD........ 477
205 0.000e+00UniRef50_B8MJ05 Pantothenate transporter, putative n=15 Tax=leotiomyceta TaxID=716546 RepID=B8MJ05_TALSN  ali  26  11............................................................................AETRVVAENSHPSDRNSVLEQPNINDQDKPPLPFRRRLKHIVWDTLDYTPAERRFVSKIDFFILTWAGFSYFSKNLNSNNLSNAYVSGMKEEINVVGNQYQTFITMWTIGYVISQIPSQVICTRVRPSIWCPSWELLWVIVTFASSSVKTPHQLYACRFFVGLAEGTFYPAVHTVLGAWYTKREIAKRACIFFGSAFVGSMFSGYLQAALYTGMDGVGGLSGWRWLFIFDGVITFPMAVWGYIALPDLPTNTRVFWLKPHEKELAVRRIKE----AGKAVGEPVTWAGIKRVLGKWHFWVYTAYYTFFICSENIG-SYMNLWLKSLHKYSVAEINTYPTVTNAITIVTSLAYGWTSDYIKLRSPIVFFSLCVCFFAAVNLAVWDGPFGLKWASYYLTGFAQGSGPVFLTMVNEVCAGDSLERIIILGSTNSIAYAFNAWIPLLSYNTTYAPRFLVGNXXXXXXXXXXXXXXXXXXXXERRDNARKDVGEEDATSSPIVASQSEE............. 511
206 0.000e+00UniRef50_A0A178ZLZ7 Uncharacterized protein n=4 Tax=leotiomyceta TaxID=716546 RepID=A0A178ZLZ7_9EURO  ali  18  2........................................................................................DSKSLPSTDLCEHKEELSDKLQNAPEDMLEDNDLGDDKQYSQLLRKLDRRIIPILAVLYLLSFLDRGSIGNANIQGLSKDLHLVGNQYNWCLTVFFFPYCFFEPLCNALLIKLRXXXXXXXXXXXXXXXXXXXXXXXGYSGLLAARFFLGLTEAGLFPGITFYVSLWYTRADAQFRLAMVFASASVAGAFSGLLAYLIVK-MDGVGGLHGWRXXXXXXXXXXXXXXXXXXXXXXDEPATAR--FLRESEKRLAIARLLHDRPQHNSAGEQHFKWKYVRAAFTDWQTIFHCLGY-WGNGVAVYAISLFLPTIINGLGYTAEHAQLLTVPIYTAAAITCIMVGYYSDHTQQRSLFIMLSFTF--------------------------------PGLLTLSSNNYA-PSAKRATGMAIQIGFGTMGGA-AASNFYHKPDAPRYRLGHSLVLGFNVLSMLCMGSYYLICRHINKKRAVEYADT-HTQYSDEQLHDMGDKAP....... 464
207 0.000e+00UniRef50_A0A0F2MDK4 Uncharacterized protein n=11 Tax=sordariomyceta TaxID=715989 RepID=A0A0F2MDK4_SPOSC  ali  16  14.............................ATDNAATDNEPANSSSGDDKTPQLTVSEVPPQFPISERPLGEPISKKRTFFWRKSETLDLDAIATQPSVFDDPKLAIEYRPRADWHRFDPSVRWTWREEKALVRKIDLRIFVFTCVAFMALEIDRANLSQALTNNFLTDLHLTTNDYNLGNSVFSLSFMCAEIPSQLISKRMGPDRWIPLQMILWSIVAASQYKLSGRTSFLVTRSLLAILQGGFIPDMNLFMSYFYTSAELPVRLSIWWTAETSAIVLGSFMAFGIL-HIDGVRGVEGWRWLFLIEGLITLAVGVSAFYFMPPSPTQTRGFWFTEREEYIIINRAIRDDPSKGTHNRQAITPRLLLKALSDYHLWPVYMIGLCFQMPMGPPSQYLTLSL-KGLGFSTFQTNLLVIPSNVLKMITLLTVTRFAGWSHKLAFNGIIGQVWALPCLVALYATNTTTESRWIVFAIVTGYPSNHSVQVGWVSRN-ANTVRSRTVSTAAYNMTVQACSVIYS-NIYRSDDAPRYRRGNRNLIIICISNICLYLLVNFYYKWENNRRDKWNAWTPAEREHYIKTTKDEGNKRLDF.... 622
208 0.000e+00UniRef50_A0A094H7P4 Uncharacterized protein n=4 Tax=Pseudogymnoascus TaxID=78156 RepID=A0A094H7P4_9PEZI  ali  19  790.............KPWIVRFIRKARGQIDRPPRVNIVPITRQ---------QSVPDYSISKGAEVGVAVSESGSDYSSNAVGLQKQHRGEAYAEGGS----TKFYEPIPEYEGRHRWDPNAEWTPAEEKKLVRTLDYRICSWVCLMFFSLQLDRGNITQALSDNMLDDLGLNTNQYNYGMTIFYLCFLFAELPSQLISKKLGPDNWIPIQMICWSIVAICQCRITGQSTFYATRALLGLIEGGFIPDSILYLSYFYTSKELPIRLSFFWGSYTLTGIISSFLAFGIL-HLRGVLGLEGWRWLFALEGIVTAIIGIASFFYLPPSPTETASYWFSEREEIIMVNRVLRDDPGKGDHNRQGITLRLFWNALCDYDLWPVYLIG-FTWGTPFQPVAAYLTLTLRSVGFGTFETNLLVIPGSVLTLLQLLFWTWYSEKINSRFXXXXXXXXXXXXXXXXXXXXPSPWVKYXXXXXXXXXXXXXXXXXX--XXSRNAGSVRTRTVGTALYNMFVQA-SSIVGSNIYRNDDKPNYRRGNKILLGFVAWNFALIIGTKYYYVCRNYTREKWTVMTQEEKNTYLETTTDEGNKRLDF.... 1358
209 0.000e+00UniRef50_A0A1Y2I9N0 MFS general substrate transporter n=2 Tax=Trametes coccinea BRFM310 TaxID=1353009 RepID=A0A1Y2I9N0_PYCCO  ali  17  2......................................................................................SSAHHQVQALQESDDCLPQTKVESPSTSDYDHDHEACQDAASKAVWTKLDLIVLPVVTTIYFLSSLDRSNIGNARIAGLQRQLHMSDDQYSIALTATLITYTVIDIPSNLAIKTVGPRLMIPTAAILWGMTCTLQGLVHNYAGLIVCRLFLGLFEGGLLPAISLYLSSFYPRRRLQFRIAIMFSATSLASAFSGLLAAAIL-NMEGVGGKPGWAWLFILEGLFTVLFGASCYFMLPDTPSQ--IPGLSSKERNLVVLALREDGIINRSEDDTSYTLRNCIRTFSQPHVLLVMITGFLNGTSSGSLTDVFLPSIVAGLGYSGTRAQXXXXXXXXXXXXXXXXXXXXXDRFGQRGLNIIFFAMISLTGLAIFYGKSPSHVRYGSLFLLVPGTYCIGPPLGTWAANNSA-PLIRRATALALLPVMTNLGSILSTWLLGAISPAPRYTSATITLLAFQVGIIACAVLNMLWLAKENRRKQERDNIVPVDGQAEHDITGKGDD......... 501
210 0.000e+00UniRef50_A0A1Y2F3M8 Major facilitator superfamily domain-containing protein n=1 Tax=Leucosporidium creatinivorum TaxID=106004 RepID=A0A1Y2F3M8_9BASI  ali  20  2..........................................................................................SQQSVDDKMVDEKTTTPTNLSANEAPLDSELYIDPKEEKKLLRKLDFFLISLLGTLYLLSFLDRSNIGNANIAGLSTDLGLVGNQYGAAVSVVYSTYVAFEPVWSNLLKVIGAKRLMTVSTLLWGAVTTGTAFVKNWDQLMAVRVLLGAFEAGLFPCVNMYLAMSYRPDEQGKRLSYVFVCAAISGAFGGLLAFGLTQIKGG--SLASWQYLYLVEGIISLSFAPIIYFMLPNTLD--KAWWLNRRERELCVIRYEINR--KNYDVKEKFSWGQVKLAALDWKTWSHSV-NQFCVDTTLYGLTTFMPVIIKGLNLTTVDAQLLTVPVYFVAATSYVIGAHYSDKYQNXXXXXXXXXXXXXXXXXXXXXXXXTKVRFGGVFVVGLSLYGAVGLNVTWVTTNTAG-HFRRATSVGLMQLVGNSSGAAIG-FIYNAKEAPRYNK.............................................................. 435
211 0.000e+00UniRef50_A0A164P147 MFS general substrate transporter n=6 Tax=Agaricomycetes TaxID=155619 RepID=A0A164P147_9HOMO  ali  17  10.......................................ATRESDVESESAPLLANANDHESETAFADTQTPVSKQDADSVEERVRFRDQHDETGSGSNHEVEGRVLIAEERRRAERE------------LVRKLDHRLMPCLVVIFIMNYVSRSGITSARLKGLEHDLGLSDMQFDTVLAILYVSYCPTQIPSNMIINRVRPSIYIGCCVVLWGLTSGSTSLTRGFSDIMWCRVLIGLPEAAFYPGAMYLLSRWYTRKELAFRSAILYFGSLISMAFSSLMAAAILANMENVMGIRAWRXXXXXXXXXXXXXXXXXXXXXPDFPHNTR--WLTPDERRLAQVRLAEDAGEADEDTAGDSAWQGVKDAITDPKVALFSIM--MVTQLLGLSFVNFFPTITATLGYSTTVTLLIASPPWLVTSIACLFNAWHCDRTGERFFHIAIPWFGVMLGYIICIMTSNTAARYFSLYLMSLG-YAGFALTLVWLSGAIPRPPAKRAAAIGLVNGFGN-LGNAVGAYAWKAAWGPLYRXXXXXXXXXXXXXXXXXXXXRTNLILANKKLDREQLENVK-GAARERIEDAARLEGITFEEA. 544
212 0.000e+00UniRef50_A0A2S7PS55 MFS transporter protein n=1 Tax=Rutstroemia sp. NJR-2017a BBW TaxID=2070414 RepID=A0A2S7PS55_9HELO  ali  20  57..........................................................................................................................IDPALEKALLRKLDIHVVIPLAILFLLAFLDRVNIGNAKIQGMTQELHMQGNDYNIALLIFFPSYILFEIPSNLILRRVSPSTWITFLMTSWGIITLGQGLVHTHSALIGLRFLLGLFEAGFSPGAVYLISMYYKRYELQWRLSXXXXXXXXXXXXX-XXXXXXXXHMDGVGGYRGWRWIFIIEGLLTIVVSLKVFGGIADWPESA--HFLTPNEQVLVLQRLASDTGVGGEERLDTLNKKSLKRILADWKIWVGALMYFGVVNTG-YATSFFIPTILNEMGYTAIASQVRSIPIFCVAAVLALVTARLTDYFQHRXXXXXXXXXXXXXXXXXXXXQTHTGVKYMACFFIVGGGYITQPVTWAWLANQNTSGHYKRSITSALQIGLGNC-GGLVASNIFITTQAPLYPVGYGTSLGMLLLCGGMCVTFFFGLRKENAMRERGGRDYRYSGEERKELGNMGDDHP....... 564
213 0.000e+00UniRef50_A0A1V8UJT7 Uncharacterized protein n=2 Tax=Capnodiales TaxID=134362 RepID=A0A1V8UJT7_9PEZI  ali  18  2............................................................................................EKDSSPGSDSPTRIEHVTAMEKGNASTFVAPTRSEEAAVIRKLDRR--------------------NARLAGMVKDIDLSGNRYNLLGTVFYIFYICSQW-LCMGWKQFSPHKWCAFCVLFWGFIATIQATAFNWGGLIACRGFLGIAEACFGPGVPLYLSYFYPRDKIGFRQGVFISGAAMANAYGGALAYGISQI---RGSVAPWRILFIIEGAPTCLFAILVWFYLPDSIMEA--PFLSAREKEIALHMTARNQRIDVDQQTG-IRLKEMWEGIRDPKSWLPALMY-FGVNVSYASLPLFVPTIISELGFTTIQSQGLSAPPYILCFFTIITFCYLSDRLQMRGPFCALAATLGAIGFIINATCKGAGPRYFSIFLSVE-IFASVALLLAWVANIHS-TESRRAGAYTVLATVGQC-GPLLGTNVFPISEKPYYRKGMWISAAFCLMVAVLSGVLSCWLIWENRKMDR-EGVPEVEEFEETSGGRAEDRN........ 470
214 0.000e+00UniRef50_I1RM34 Uncharacterized protein n=89 Tax=Fungi TaxID=4751 RepID=I1RM34_GIBZE  ali  18  9..........................................................................................................SPKPSLDVPALETVDLNDKEMEKRIVRKQDLRIMPWVCITYLLNYLDRVNLGNARTLNIVTQLNLTGQKYNIAVALFFVPYVLMEFPSNILLKYFSPSKWISRIMVSWGIVTICTAAVSTYGGLLAVRIFLGLAEAGFFPGIMMYLCFWYKPEERATRMAIFASSVAVAGAFGGLLATGI-SYLNGKAGLAXXXXXXXXXXXXXXXXXXXXXXXXXDYPQTVS--WLSPEERAFAVKRL---GPYAPSMNDKHWDSKVAKETVSDYFFWLFAIAYFFMAN-SLNAFGYFAPTIVASLGFEGKYGQLMTVPPNVFAVFIIVGNCLHSDKTKERSKHVLGGLTFVATGYLLLAFVKHWGVRYFAVCLIACTNAAVLP-FVAHRTATVRGSTAT-ALATGGMIAISNT-GGITAPFLFPSSTSPMYAMGNWTVFAFLVSAGCITGYVWYVFG-----AHSGYRTGDATATGHLEVLDAGDKDP....... 480
215 0.000e+00UniRef50_A0A139A885 MFS general substrate transporter n=1 Tax=Gonapodya prolifera JEL478 TaxID=1344416 RepID=A0A139A885_GONPR  ali  20  2....................................................................................................SESLTEKPSEKLHDEKSDISSRFNPKEQAQIVLKIDLHVLPWMGWLLLINYIDRTNIGNVRINDILTELNLTATDWQYALSVFYIGYFIAEIPSNLMLKRFGPSKWMCRIVFTWGICSFATAFAQNATGLILARFFLGLTEAGLFPGIILYFSYWYPPAEFAKRVSLLVCSMNMSGAFGGLLAYAI-SFLNGTGGYSGWRXXXXXXXXXXXXXXXXXXXXLPDFPHTSS--WLTEHEILWAEARIQATKQGPSAHD-EHFNKPEFIKAISDPHAYVWSTI-FLAQAVSAVSLGFWLPSIINALGFVSTTANLLTVPPTVLAFIFSMAISWNSDRTGDRIFHMVSCQSLFILSLILFATVPATAAGYFVCFLAYCGSSGVAPMIWSWRADTSSGTTGT-AVSTALMGSIGNSGGA-FSSLVFRADWGPRYQRAFAICAALSTFSVLLAVAETVYQRR..................................... 465
216 0.000e+00UniRef50_A0A094K3H8 Uncharacterized protein n=2 Tax=Pseudogymnoascus TaxID=78156 RepID=A0A094K3H8_9PEZI  ali  21  3....................................................................................DSKTSSDNTGAATMIENIKETSDPTLQIYLEFASQTDEWKEANSKKLLRKVDLRLLPLLITMYLLNFLDRSNLAQARLGSLEVDLGMSGNDFNLATSVLFVGYIIMQLPSNLLLTRVKPSIYLGCVMAVWGVISAAQAGTRSFGGLVACRIMLGVVEAPFFPGAIMMMSSWYTRKELGFRIAFFYSGNALANMFGGLLAAGILGNLNGVHGITGWRXXXXXXXXXXXXXXXXXXXXXXNFPATS--MWLTEEERNFAQWRL-VDDAKESDDTGAVSLMDGLKMALKDYKIYLFLILQHLSLL--SQTFQYFFPSIVITLGFEKIEXXXXXXXXXXXXXXXXXXXXXTAGKTGDRSIHIMCLLCVSCVGNILAISTTNTGVRFFAMFLMPMGAVSAYQIIVTWVANSFPRPMVKRSAAIAICNMIGNA-SSIYGSYMYQSTDGPRYLHG............................................................. 444
217 0.000e+00UniRef50_A0A2A9P068 Uncharacterized protein n=1 Tax=Amanita thiersii Skay4041 TaxID=703135 RepID=A0A2A9P068_9AGAR  ali  20  4....................................................................................................NEKTQIDSFQDNSSNDEEVMLKVTEEERKRVVRKVDVHLLPFVSVLYLLSFLDRANIGNARIAGMAKDAHLDGLKYNIIAAVFFIPYSLAEIPSNILLKLIRPSRWIPSIMVAWGLVMTLMCLCKNFKSLLIARVFLGLTESGLFPGITFYLSLWYRRRDVASRXXXXXXXXXXXXXXX-XXXXXXXEHMEGIGGLHGWQWIFCLEGILTVVVAFISYFFMHDYPSTAR--FLAPREKQLVVQMLKEDTQGLATH----FDKKFVWQALTDYKXXXXXXXXXXXXXXXXXXXXXXX-XXXKSLGYSAAQAQLLTIPPFAAGCVATIGVGLWSDKLNLRGPFLIGGCLLSMIGYIVCITRSEPGAGXXXXXXXXXXXXXXXXXXXXXXXXSAGGDVRK-GVTLAMVIGLGN-LGGICSSFIYLK--APRFYAGHGTCIALLAMSIILSLFAMWDFNRLNKAKEAYCAHHGIDDSRKGEFVEFGSESPL...... 478
218 0.000e+00UniRef50_A0A0A2L107 Major facilitator superfamily domain, general substrate transporter n=1 Tax=Penicillium italicum TaxID=40296 RepID=A0A0A2L107_PEN  ali  20  2.............................................................................................QESHKSRTDMVEDAELGTTKESPSLGEIEVDFEQEKALVRKQDLRILPLCAGIYLLCYLDRSNIGNAKTLNLLDETNMTDHQYIIALMVFLIAYGVFEVPSNYLLKKLKPSRWIAFLMFSWGAVTMGLGGAHSFAQVAGVRFLLGALEAGLFPGLVFYLTFWYKVSERSLRVAFILASATLAGAFGGAISYGV-GHMNGVRGLSAWRWLFIIEGAPSCASAILVWFFLPDYPETCS--FLNPEDKALSKQRLAVEGGQGA---AKAMTWNDAKAVLTEWRLYAHYLVY-FSISVPFSSLSLFTPTITAGLGYEALQAQLMTVPPYAVA----------------RGVHXXXXXXXXXXXXXXXXXXDAYLSRYGCLIIATSGAFSCIPPLLGWLSSNLRSTA---GIGLAIMNISFGAPGQIVGVWIYKSDQAKKFPTGHWTNAALLLLASVI............................................... 438
219 0.000e+00UniRef50_A0A0D1ZVT1 Uncharacterized protein n=5 Tax=leotiomyceta TaxID=716546 RepID=A0A0D1ZVT1_9EURO  ali  19  5......................................................................................KRDESGSPVSEPIHKEDKIVGETETENTVFASKDQEWRAAFEKKLMRKVDLRLVPLLIIMYLNNFIDRAALGQARLGTLEADLNMDGTDFNLAISILFVGYLTMQLPSNLLITRIRPSLYLGITMMVWGAVCASTAAVQNLAGLIAVRIMLGVTEAPFFPGAIFLMSSWYTRQELTKRIAWFYGGVALANMFGGLIAAGVLGNMEGAMGIAGWRXXXXXXXXXXXXXXXXXXXXXPNFPATTK--WLNEEEQAFARWRLKLDAEEEDDNTSTSL-WHGLLLCLKDYRMYIFLLMQHLSILSMT--FQYLFPSIVGTLGYPHXXXXXXXXXXXXXXXXXXXXXXXXXDRTGDRSIHIMCLLTVSAVGNAIVGSTLNIGARFFGXXXXXXXXXXXXXXXXXXXXNSFIRPMVKRSSAIAICNAVGNCAS-IYGTYMYPASDEPQYMPGSAGNAGVCITVALLALTLRFVHKWENKKLEKAEREGYVEDGVQRDRRAFG........... 497
220 0.000e+00UniRef50_N1QER5 MFS general substrate transporter (Fragment) n=2 Tax=Dothideomycetes TaxID=147541 RepID=N1QER5_SPHMS  ali  18  1..........................................................................................................................YTPDEEACVRRKLDTRLVLFVALLYMMAFLDRSNIGNAKTAGLSQDLNLSDSQFKWLLTAFYITYVLFEW-MTLCYQIFPPHIYISTCVCVWGLLASLQSLATTFGFLLTLRALLGIGEAAFV-GMPIYLSFFFRREELAFRTGIFIAAAPLATSFASSLAYLIVRFGNLV-PIANWRLLFLLEGFPACVVAIWTFYWIPDSPSTAR--WLTAHERKIATVRMRNETXXXXXXRDHKFSWPSVVQTLSDPKSYLTAAM-FFCCNVAFSSMPVFLPSILHAMGSTPLRSQLLSAPPSLFAFITVLLTAHLSDRWKTRTWPMVFHALLASSGYLLLTVAGHQGIRYAATFPICAGFFSCVTIVITWTVNNQRSDEGK-GTGVAVLNVIGQ-MGPLVGTRLYPDTEGPYYTRGMEVCAVSMGGVAVLTLVLRWVIGREN................................... 451
221 0.000e+00UniRef50_A0A167RSD6 MFS general substrate transporter n=4 Tax=Agaricomycotina TaxID=5302 RepID=A0A167RSD6_9BASI  ali  26  3.......................................................................................SNDVDIDAEKQVAAQRSGLQPNAKKGWRSYIWDHDSDSPEERRLLVKIDATILVYACLAEFLKLLDQSNLSNAYVSGLKTDINLDGNWYNVANALFSIGYAIGQIPGTLLLQKFRPHYVLPLFEIIWSVATFGTSAVKTPGQLCACRFFVGLAEAPFFPGMLVTLAAWYTPAELGKRSSIFFVMAQVGSFFSGYLQAACY-NLNGIQGLAGWRWLFIMDGIMSLPIALVGFFFFPDTPARARGWWMTDADKQLAIDRIARAGIAK---NPGYFDWRLIKRALSNWRWYLFVPGYVFFGLGTQAASTWFGVWL-QDEGYSVYLRNIIPTCTNLVTLVAVLIWGWLSDYLENRXXXXXXXXXXXXXXXXXXXXXNIPDGLKFFSYL-TLGVEYITPLFFTWANEVNRGDDGVRSFIVASMNCAQYAMAAWVTILTLPASKAPQFSVGYQTCAAFNAAAILIITGIWYWDRLEKARELPYEPETDPTSHVAGEGSEDE........... 493
222 0.000e+00UniRef50_Q5K928 Tartrate transporter, putative n=18 Tax=Cryptococcaceae TaxID=1884633 RepID=Q5K928_CRYNJ  ali  17  3...............................................................................................ASPSPIDDQSIMSEVKSEEHFQLDEIDYSPEDEARAVRKVDFLVLPAIVFCFLMLQFDRTNLGNAQTDTFLPAVGITTSNINIGQTLFTLGFVIFELPSNMLAKILGPHRWVPCIIFIWGLITLCQAFLTSKGGFYATRFLLACGEAGFIPGMAWYITRFYQNGELSLRLAIFWAANSFAGMVSGPLALGILQGLNEKHGWHGWQYLFAIEGAMTMGVAIFALLYLPASPRSLLIPVLNSRDAQILAARILADDPKKAFGRGSKITLVDIKDTFVDWRLWGHCAAAFLSSII-LTPINTYGPKVIQSLGYSGFTANGMAAPASAIGLVYSVSLAWSSDRFRERGIHIFTAMALSCAGCLWLALAPDSAVLYGGYLLTAGTMGCGQAINASWVSSKF--DERRRPVALATYVAFIQMAG-FAGSNVFKTKDAPRYKDGLIVCGVCSVVGGVIMLVWKLLYIWDDRRAKEGRRSESSPELE................... 485
223 0.000e+00UniRef50_A0A074YDK7 Uncharacterized protein n=24 Tax=leotiomyceta TaxID=716546 RepID=A0A074YDK7_9PEZI  ali  21  2...............................................................................................EKYPEQVAISAGSTTSKSEDDSRGTVDWTPEEEKKLVRKLDFTVLPLLTMVFFALQLDRGNIGSALNDNFLKDAGITQYQYNIGQQLLSAGIVILEIPSNLLLYRFGPRIWISSQIFAWGLVATFQAFQHGLGAFLSTRLLLGLCEAGFIPGGLYTLSLYYKKEETSKRFAIYFFGNNFASACTGLLAYGIL-HMRGIAGLAGWRWMFLIEGIFTILCGAIFLLCIPLGPQNPSTVFFTEREEYILRQRVLLDDPSK-EKKSHSISKKELLSVLGNWKIYPHVLIS-LCGIAPATTMSSYAPSLVKNFGYDRLKATAMSVGPWI-QIFLNYASGYLSDKTNRRGHVNLGGLLMWCLGSLILADSKQKEAKYAMLVLAMASSTIWHPVNGSWLSTN-ARSPAERSITMAMFVSAAN-LGGIIGGQLFQAEDAPHYKKGWTAIVCLISVSIAANLFANTQYRVLNRRAEKKKQQNGTLEEKD.................. 483
224 0.000e+00UniRef50_A0A135SF62 Uncharacterized protein n=1 Tax=Colletotrichum simmondsii TaxID=703756 RepID=A0A135SF62_9PEZI  ali  21  2.............................................................................................DNKVTAKHLEGRVGPIQDLTGIDESNLPRYNDKTTQKVLHKIDWRLLPMLTLLYILSYLDRGNIGNAKVAGMNQDLGLSSKQYNLVLTLLFIPYTTFEVPSNLVLKLMRPXXXXXXXXXXXXXXXXXXXXXXGYRSLMAARIVLGVCEAGFFPAASYLLSEWYCRFELQWRLSIFFSAASLAGAFSGLLAFALEK-MDGLGGLEGWRWIFVVEGIFTSVVGMTLPWTLPDSPETAS--FLTPGEKALIKTRLEQDAGTTAGMTSEGFKWMYLKAAFTDWKIRFTVFIY-WGNTVPIYGFIFTVPTIIHQLGYSSAQAQXXXXXXXXXXXXXXXXXXXXXDRHQRRWKFVALSYSISLVGCVGLLAIPHPPGLTYXXXXXXXXXXXXXXXXXXXXXSNNLSPTWKRATGIAISVMMGN-LGGMIGSNIYMAEEAPHYWTGYGVSVACLMLAICCTLILRFAYDRENKKRNMISEAEVRAHYTQDQSDHSHHQSDETHQSEQ 500
225 0.000e+00UniRef50_A0A0K3CJ65 FGENESH: predicted gene_8.408 protein (Fragment) n=9 Tax=Microbotryomycetes TaxID=162481 RepID=A0A0K3CJ65_RHOTO  ali  18  1....................................................................................MSSPPAAGTLEDRKLSYASSTQDSAHDDHGAQTDGELTWTAEEEKRIVRKIDWRLMPLLWALFMLSFLDRSNIGNANAAGMSKSLKMSSGQYQWLLTIFYIGYALGQ-PTTLLWKALSPHVFVAILTLCWGGFALLQAAAR-WEGLMALRLLLGVAETAFAPGVTFFLSFFYSRREVGFRQGLYLGAAPIASCYAGALAYGISHIHN--SSVPVWKLLFLIEGAPAIPMAAVTYFFLPDRP--TKAKFLTTREKEIARRRTERDGKTG---REEGLKMRNVWKGLRDPKAYIPALCYFSC-NVSYSSLPVFLPTILTDMGFTSIRAQGLSAPPYLASFFVVVGVCWLSDRVGDRXXXXXXXXXXXXXXXXXXXXXXSTGVRYFAIFLCASGIFPCIGLLLP-LTASMHEDDSKRGAGFLLLNLVGQ----------------PYYHKGMAICCAFMFFVTLLVSLLRLILIRENRRRDALYG........................... 455
226 0.000e+00UniRef50_A0A194XBH2 MFS general substrate transporter n=1 Tax=Phialocephala scopiformis TaxID=149040 RepID=A0A194XBH2_9HELO  ali  18  2...........................................................................EASSKPKSASIDVESGDAPHSNLKNSGSSLNESPREIRSDTSLREANIDPITEAAFLKRMDYRMVPLLFLLYMMSYLDRSNIGNAKIAGMSKDLHFSGNDYSXXXXXXXXXXXXXXX-XXXXXRVIPAHILVPIMVSGWGLVATLQSAVNSWSALMALRFLLGMFEAGVGPGIPLYLAYFYQRHEIGLRLGFILSAGPLATCFAGALAYGITS---GHPSIANWRLLLLVEGLPCFILAAVAWFYLPDSPASAK--FLTEEDQNIVSARGIRQVGAAEAGHHGKIVWSEVGAGVLNPRNYITALMYFSC-NVSFSSLPVFLPTIITEMGFSAIHAQGLSAPPYFIAVIFVLISTYFADRYGQRGIVICISALIGAAGYIVQATTTVTAIRYFGXXXXXXXXXXXXXXXXXXXXNNH-GTDTKRGAGLVIMGLVGQC-GPVLGTRIYPANDEPYYRMGMWTCASFMILVAVLSIALRTVLKWENSKLDAKYGKLENGGGR................... 497
227 0.000e+00UniRef50_UPI00086695F4 major facilitator superfamily transporter n=1 Tax=Saitoella complicata NRRL Y-17804 TaxID=698492 RepID=UPI00086695F4  ali  17  2.........................................................................................EQPYDLQTKLHAHHIEEADPGSVSNAGVGEWVEPPSHVTRAIVRKLDWRILPVMSLLYLFSFLDRTNIGNAKIDGLTEDLKLTSLEYNLCLTVFFFTYAVFEVPSNLCLKKYGARKXXXXXXXXXXXXXXXXXXXXNYEGLLSARLFLGLAEAGLFPGVTFYLTNVYKREEQSLRIGIFFSAATIAGGFGGLLAYGI-GKMDGVGGWEGWRXXXXXXXXXXXXXXXXXXXXXXDSPRTAK--FLTEEEATIVENRVKYD-GSAGTPMSDHYEWKFVVQALTDWKVWLSLLTYY-GTMTPLYCIALFLPSIIRGLGYPTTTSQLLTVPVYVAGCLGVLIFCYFSDKYRMRSPFIVLGAVLNLIGWGVAYGSNNIHVRYXXXXXXXXXXXXXXXXXXXXXXSNIGGQ-TKRATAIGMQIGIGGLSGCI-SSNIFYAKDAPNYRPALLIALGLSALALVNACLYWFCLLQAN................................... 464
228 0.000e+00UniRef50_A0A284RWV8 Related to permease of the major facilitator superfamily n=3 Tax=Armillaria TaxID=47424 RepID=A0A284RWV8_9AGAR  ali  18  6........................................................................................DSKLDHKDDVESNTPDVAYGLDGEPSHNIQDYYKFDPKAKRRLVRKLDARLMPLIFCLYIFNAIDRSNLGNAKTDGLEDDLHFRENDYSIMLSVFYVPFCTLTVPAIALSKKIGAKVALPLYMFTFGGMCMINAAVKNFAGCLVVRLLIGAAEAGFAVTIIWYLTTFYTRGELGKRVAVFYSASAFAGGFSGLIAYGVFQ---PNIRLHGWQXXXXXXXXXXXXXXXXXXXXXPANIDST--PFFSPEEKHIARTRILRDSSAV---INEKLTSHAFFAPLKDWKLYVWALIAI-CYGVAASSAGTFLPQIIGRMGKSKLTTNLLTVAPNFVGGFAVLLTAASSDYFRERSLHIAGAMTVTMIGFIVLDTVDVSKTQYFGSFLLCLGAFTPSTIFHVWHNCNDASEVG-RGFRTALMTFFANSSGLI-ASNIFMAKEKPYYNTALVVNFSFLAAGISLILGLRTYMMLDNRRRNSAQGVNWSSKDVPTAALAVGVASP....... 494
229 0.000e+00UniRef50_A0A178AP60 MFS general substrate transporter n=70 Tax=leotiomyceta TaxID=716546 RepID=A0A178AP60_9PLEO  ali  18  19..............................................................................................KEVSPTTYRITPQQIQARFELLKDKSEEQMAALNKQLVRRLDWRLMPCITLMFLMNYLDRINVSNARLAGLQKDLHMTDTLWNTGISTFYVGYLIGQLPGNLWLAKADPKWLLPTMMLGWSIGTICMPAMTSGAGFAVCRFFIGLTEAPFFPGITLMTSSWYTKEENPMRMAIWHAGNTMSNILSGFLAAGILTNMDHVLGLESXXXXXXXXXXXXXXXXXXXXXXXXSWPHNTK--WLTPEEAEMAQYRVQVSNGGHDEVIGG--TWDGVKDAAKDPFTWFFCLMHF--ALVTAQSFKDFMPSIMETFHFDKLTTYLVQAPPYAIAYAVACGCAYTSGRFQESYYHIIVPIFFSAAGCGMLIGTLNVGARYFGLILLISGTYSGLNLQLSWETTLVPAPRSKKAALIAIANCISQT-SHWFSPYFFPTSQEPYYRLGGGLILFGCMATVASASLVLWRAKKLNKKLDEDEGWSEHTGVE................... 491
230 0.000e+00UniRef50_A0A0D1X535 Uncharacterized protein n=1 Tax=Exophiala mesophila TaxID=212818 RepID=A0A0D1X535_9EURO  ali  19  1....................................................................................MALNKDASYAQEVDVAGGQFEMEKADPEGALATNVVSAIDHVAEKKLLRKLDIRIMPLIMGLYLFSFLDRVNIGNARVYGMEESLGLTGSQFQLSVSIFFVTYVLFEIPSNMIIKKITPSKWLAFITFSWGIISTLTGMTQNLGGLIACRILMGIFEAGLFPGLSLYLTTFYTRQELGLRYSWLFTCNGLAGALGGLVAYAI-GHMEGVGGLEAWRXXXXXXXXXXXXXXXXXXXXXADFPQTA--HYLSQEERDLLMAR--RGRQAGFSASWDEMHKSDVMKGVKDWKVYVMAF-GQFCGASMLYGYSTFLPTIILDLGWNRVVTNXXXXXXXXXXXXXXXXXXXXSDRLQLRGCFPAACGIISVIGYGVLLAPVSAAAHYAGCXXXXXXXXXXXXXXXXXXXXNCPK-YGKRAFASAFQLTISNLSGVIVP-FLYTSNFGPRYIQGNGAVLGWVGTGTIIYGSMFMYYVRKNAGRLSGKEDHKIEGKTEEEIADMGDESP....... 495
231 0.000e+00UniRef50_G4T4Y5 Related to putative tartrate transporter n=1 Tax=Serendipita indica (strain DSM 11827) TaxID=1109443 RepID=G4T4Y5_SERID  ali  20  2.......................................................................STETALSDMSKPPFYVKTSEKRPIPVRALHEHLDGDIEVESRQSVEELVYVPNTAVEKRMIRKVDLHLIPILGALYSFALIDRSNLGYLYVSGMDKDLEMKGSRYSICLTAFFIPYIMLEIPANIAIRIFGASRWLSTIALLWGITMFSMSFINTWQGIAGTRALLGALEAGFFPACAYLISCWYTRKEMQLRLACFYLMSVLAGGFASILSYGLYK-LDGRNGRAGWRXXXXXXXXXXXXXXXXXXXXXXDFPD--KNRFLSVEETKLVIQRINADRG---DAEYDQMTWSKLRAYLCDFKIWVFGLL-FFGSTVPSYAIASFSPIILMGQGHSIVASQLLSAPPFCAAVVYALISAYACDKTGARSAYIIGQAILCVAGLMMIGYAKTYNVRYAGLFLSLMGCQANIPAVLAYQSTNIVRQ-SKRAISNATVIAFGG-VGGIYSAFTFRSQDSPDYIPGLWATCACEFLIVALTLWMAYYFARENRKLKRKLRGPIEGTE.................... 495
232 0.000e+00UniRef50_A0A2C5ZJF1 Uncharacterized protein n=2 Tax=Ophiocordyceps australis TaxID=1399860 RepID=A0A2C5ZJF1_9HYPO  ali  18  2.......................................................................................NNSSTIATDDYANEFCEPVKCGVKRWARDSPDHVFLSRQAAKELTSKIDRRLLPLLCILYLLSCLDRSNLGNAKRAGLGEDLNFIGKQFNVAISIFFPSYLVVQIPSNLCLRYTRPCXXXXXXXXXXXXXXXXXXXXKNFEGLVVTRCALGLAEGGVLPGIVYYLTRWYRRDEYGLRIAILFSVAVVGGSFNGFLGHAIMA-LHGIAGLHGWSWLFIIEGTISLCIAGVAYKLMYDYPEKAK--FLSSREKHTVLVRLEKDGSCP----REKFDFSAVRAALLDWKIWMHMVM-TLGISIPMYSIGEFMPQVITDLGFSNDQAVAMAMPPHVAACIFVLAGGWATDRYQQRGVFIIGFCVLACIGFAVLSTAQNNAVRYAACFLVTMGIYPIVPQDIAWNANNICGS-TKRAVGIAMHIGFGNLGGA-VAAFIIRQDNARRFITGHGILLLVTAASCLLAVFMTWHLRQEN................................... 463
233 0.000e+00UniRef50_A0A1X7RPH8 Uncharacterized protein n=62 Tax=leotiomyceta TaxID=716546 RepID=A0A1X7RPH8_ZYMTR  ali  18  2...........................................................................SPQGDSRQHSMSLDEKKGDTMIETIETVVTPAAIQSQFPTLINLDAEEMAALEKRLIKRLDWRLLPTITIMFLMNYLDRINVSNARLAGLQDDLGMTDTVWNAGISTFYVGYLVGQLPGNLWLAKVRPSILLPSMMIAWSICTICMPAVTNGAGFCLIRFCTGLAEAPFFPGITLMTSSWYNKHESPMRMAVWHAGNTISNIISGFLAAGILYKMGDVAGVHSXXXXXXXXXXXXXXXXXXXXXXXXDWPENTR--WLKQDESEMAQYRSLMSNGGKREEVGG--TWDGLKEAVKDPFTWMFCAMHFSLIN--AQSFKDFFPSIVKTFGFGELETYLVQAPPYAIAYLVACLAAYSSGRFQESTYHIVVPIAFSAIGCSILISTLNVGARYFGVILLVSGTYSGLNLQLSWETTLVPAPRSKKAALVAIANCVSQC-SHWFSPHFFPTSQEPFYRLGGGLILFGCASTAALCWLIKWWANRLNKKLDEAEGWTEHTGVE................... 498
234 0.000e+00UniRef50_A0A194XHX5 MFS transporter n=1 Tax=Phialocephala scopiformis TaxID=149040 RepID=A0A194XHX5_9HELO  ali  22  2.......................................................................................................DKKDADNRIQPIDIDRGFIVNTDLERRILRKCDFKLLPPLMVLLIVTYIDRTNIANAKIEGMTTELNMKHNDYNISLWILNIPYICLALPSNMLMKFARPAIYLSGLMFCWSLCTIGLGLTRSYKGVLVCRFLMGCFEAGFIPGCAYLIGRYYKRRDFTVRYAXXXXXXXXXXXXX-XXXXXXXGHMKGVGGFSSWRWIFLIEGFMTVVATGIGIFCIPDYPENS--IFLEADEKGYLLDMLRIDAGPSRPDHYNPLVMKE---CLFDPKIWLAMLCY-FAADTSASSIVSFQPTILKGLGYSSAQAQVHTIPVYLVALVLSLITSYCSGKLRNRYGFLVLGSVLGIAGWKIELAVPIIGARYFGLFAITACAYIQMPILVVWLSNNMGGNA-KAAFATGFMIGLGN-YGNLISSNVFITEQTPRFQTGFGAGLAVTVVGLASSTIMEIVMFVKNRRRAAGKEDRKLDAAHEI-LGDLGDDHP....... 478
235 0.000e+00UniRef50_G9MVF2 Uncharacterized protein n=16 Tax=Dikarya TaxID=451864 RepID=G9MVF2_HYPVG  ali  18  2.......................................................................................................SDIKRLSHEQNAETEITAIEDEVNERALLRKLDGRLLPAVGVLYLLSFLDRSNVGNARIEGMVNDLHMTGNQYLTGLTVYFIGYVLFEIPCNVILKKTSPRXXXXXXXXXXXXXXXXXXXXXNLSGFLVARFFLGVTESGLFPGVVFYLSMWYKRRERQYRISLFFSAASLAGAFGGILAYGI-GKMAGVVWSNGWRXXXXXXXXXXXXXXXXXXXXXENYPDTAK--FLTKPERELIQTRLAAD---CDAMIKEEFNWSAVLEAVRDPNCWLYSL-GFHTMSLPLYTLSLFLPTIISNLGYTAAKAQLLTIPPYALAFLTTVGVAVASEKLGKRXXXXXXXXXXXXXXXXXXXXNTDPVARYLGTFFAAAGIYPSTALVLSWPAINVSGQ-TKRAIANAMQISIGN-LGAVMGTQLYRANDGPRFIVGHSMALAYLCANAIVASFIGWRLKAQNKARAE---ISPEVQNVGEAVDWEGDKDP....... 476
236 0.000e+00UniRef50_J3NM69 Uncharacterized protein n=72 Tax=Eukaryota TaxID=2759 RepID=J3NM69_GAGT3  ali  18  50..................................................................................PRKQLRQPVMKAEESPQAAEADRASAKDAALDKTGNEHGEFDPAVDKRLDRKFDLHILPFLFGIWLFSFIDRSNIGNAKIDGLATDLGITGTGFNVALLVFYAPYIAVDVPSNWVIKRVRAGVYLPALITAWGVVCTCTGFVKTFPALVACRVLLGLFEGGILGGVIVYLAMFYRRHQMVLRCGLFYSAAPLSGAFGGLLASGLGRISYG--GYNRWPWIFFIEGAMTVVFGLLCFLFMPNTPAESR--FLTEEERDHALRRMRMDGSSTVDVDDEKFNWHWVRMALLAPQTXXXXXXXXXXXXXXXXXXXXXX-XXXSGMGYQATHAQLLTAPPNVAGFVSVIVCSYLSDRAKVRXXXXXXXXXXXXXXXXXXXXXDKNPVKYAGTFFIGLGVFQCSALMMGWASNNLA-PHYVRATGVGVIISLANC-SAFIGTFVYLARDMPHYRLGHXXXXXXXXXXXXXXXXXXXXXRWENKKRENGDRNDRLLQP---DAHRLGHRHP....... 546
237 0.000e+00UniRef50_A0A0A2VRV7 Putative transporter n=2 Tax=Beauveria bassiana TaxID=176275 RepID=A0A0A2VRV7_BEABA  ali  20  4......................................................................................................SEKDLDSGDNASTGMGVSAQIDKESERRVLSKFDWFVMPQMSILVLFAYLDRTNIGNARVFGFEESTGMSGTDFNNISMFFYITYILFETPWVMAVRRFGPGRVLAVAIVCWSAVTLGTGFAHNYRQVIACRVLLGAFEAGLFPALTFVISGIYPAASQGKRXXXXXXXXXXXXXXX-XXXXXXXQSMGEQRGLAAWRWLFIIEGAVSFAIGALCWVSLPGTPETA--WFLDEAERNTMA--LLKARDHPYEEATVKFSWKQVGLAVSDPLVWL-ASIALFCSSIAMFGFSTFLPTLLKGMQYTSLQANYLSIPVYVLASIGTGLTTYISDRIGRRAICLIHSPILVMIGYAVGIGSSNKSAGYFGMFIVGAGVYSYNTVLLTWVSNNI-HPDYKRSVAIAMVVSIGNAAG-LAASQIYPIGDAPRYLVGNSVSLGFESLALACVALIYMLLRYRTGQKKKLRSQGIESNETSSSTFVKTGRH........ 478
238 0.000e+00UniRef50_G3BCQ0 Putative transmembrane transporter Liz1p n=2 Tax=Saccharomycetales TaxID=4892 RepID=G3BCQ0_CANTC  ali  28  18......................................................................................................................WTDLYESKVEQKLVAKVDGFILSYCCVSYFINYLDRTAFSNAYVTGMQESLGLKGNQYNVINNCLTVGYIISMPIHAILLQKIKPRYYFPINQILWAICTMSTAACKSFSSVCAVRFLLGCFESSTFSGTIYVLGFWLKRDEIGKRIGVFAASGVAGSMISGYIQTAIYNNMNGTHGLASWRWMFIIDGIVVFPLSLYGVFFFPDTPTTTKMFYFTEEELEVARNRL------PPPKPNTKLDFTLIRRALFDWKLPVLSMLWVLGGAIEAISQSVMILSMKAEGTYTVAQINQWPTAVNGVGIFSILVAAVYNDALDHKWEFIGFIGLLQLIAASILLKWDVSLGGRLFAYYLAGTSYGGQSLYFAWANEICQGDDPLRALTVFCMNMFSSVLFCFWGTLLYPASSAPKYHKGMITSIVTSLLLVCWGILVKLLFDWQKRRDANKVDPLEFSSDHSNDEVVSKEIIPLEQKE.. 486
239 0.000e+00UniRef50_A0A167SV68 MFS transporter n=1 Tax=Cordyceps fumosorosea ARSEF 2679 TaxID=1081104 RepID=A0A167SV68_9HYPO  ali  16  2........................................................................................ANIVKDKRDDLESMTSAKYIEELADGGTNLTEDAAEQELESKLRWKLDWHIVPLTSVIFW----------NARIAGLEKNLNMHGYQFNIALSVFYVSYILFEIPSNMVCKWMGPGRFIPVATFCFGVLTMCTGLVRDFSSLCGVRFLLGIFEAGIMPGLVYYLSRWYRQSEMTFRISLFIVSGSLAGAFGGLLASAILKIPS-IGTLHSWRMIFVIEGIATCLLGIGSWFVMANDPRTAR--WLSESERALALRRLRSERPAEGAELVDAFNWTKIRRGILNPVVLATGWI-FLLNSVIVQGASFFLPTLVAAI-FSVTTKQLLTVPPYVLGALCCIGTSYASWRLNRRXXXXXXXXXXXXXXXXXXXXXPRADVRYGAIFLPFFGIYTYGALTNSHAAANVASDTA-RSSAIATNVMLGN-MGGLAASWAYVPSDAPLYNIGTGLNLASMTSVIITATALYFWVRRDNRRRDELDPVTELSGLDASEIQNLDWKHP....... 485
240 0.000e+00UniRef50_A0A010Q6Y8 MFS transporter n=2 Tax=Colletotrichum TaxID=5455 RepID=A0A010Q6Y8_9PEZI  ali  19  48...........................................................................................................................TDPKEIALVKKIDFYILPILWIMYFLNFLDRNAMINGKLNSLSKDLKLKGTEYNTCVSILFVGYLCGQIPSNMILNRVRPSWYMA-----------------------VCRFFLGITEAPFYPGALYMLSIFYTRKEIATRMAIFYTGNMLASAFSGLIAAGIFAGLDGKHGLAGWQXXXXXXXXXXXXXXXXXXXXLPDAPLQTR--WLSPEQRQMAHQRIFDD--TTDRREGGTSVWKGLREACTDWRTWLFCLMDNLHL--SANGFKNFLPSVVKTLKYNTTITLVLTCPPYILAGIMSIVVSHSSGRFNERTWHTTVSKLIACAGFAMAVATLNTTVRYVGIMIFVGATYGVNNIILGWTSATLGQTDEKKAVAIAMANTFGN-LASVYTPYLWPDSDEPRYXXXXXXXXXXXXXXXXXXXXMRIALQRQNRK................................. 454
241 0.000e+00UniRef50_G3J4H3 MFS transporter, putative n=258 Tax=Fungi TaxID=4751 RepID=G3J4H3_CORMM  ali  22  27.................................................................................................................................KLVRKLDLHIIPLILMLYLFSFLDRVNIGNARFYKLESDLGLSSTQFQIAVSIFFVPYLLFEVPSNLVLKLFTPRRXXXXXXXXXXXXXXXXXXXXSYAGLLACRLVLGVVEAGLFPGLTVYLTLFYTRHELARRXXXXXXXXXXXXXXX-XXXXXXXXHLDGVRGMSGWRWILILEGIPSALLGVATYVWLPNDPATAR--FLGDAERALMELRHRREYGNT--QSSREFSARDMRTAFLDWKVWAFCVAQ-FGVDTMLYGYSTFLPTIIKGLGWTPAQVQLLTIPCYFVGASTYMAIATVSDRTQKRGLFCVVFGILSVVGYAVLLSNVSSGVHYXXXXXXXXXXXXXXXXXXXXXXXNSPR-YGKRTTATGLQLTIGNASG-IMSSFIYPTLDAPRFIRGHAVTLSMVSMGTLIYGLLWAWYRGENRRRAAGFVKEEYKTMSDDELRELGDESP....... 476
242 0.000e+00UniRef50_A0A167D8W8 Major facilitator superfamily transporter (Fragment) n=1 Tax=Colletotrichum incanum TaxID=1573173 RepID=A0A167D8W8_9PEZI  ali  18  12........................................ASRSAQNSTSRAVSYCSGKPPIQPPRVKEATKGRTTNKSKEITNMSFEDGRKQSLEMKEDKNASVVSQADAELAEALRNYVPGT-REEKQLVRKIDIFLMPMLWIMYILNYVDRTNIGNAKIAGMQKDLALTDDGYAWVLSIFFFGYLICEVPSNMILSRSRPXXXXXXXXXXXXXXXXXXXXXKSYGALLAFRFVLGCVEAGFFPGVLFLLSCWYTRAELGKRFAIFYTAAVLSGAFGGLLAGAITANLHDAHGIAGWRXXXXXXXXXXXXXXXXXXXXXXDYPSTAKQ--LTPAQRQLASIRIIADGIASGGQNKKRLSWNAFIAAVSDPRTYAFILL--FMLDVGAGTISYFIPTITLTLGYDTVTAQYMTVPIYAVASVCLNIVAWSSDRHVERRWHVAAPLALGFACSVVCAAVQTPIVRXXXXXXXXXXXXXXXXXXXXXXXXXXSLPPEKRAIVLAMVNAFGN-FSSVYGSRIWPSKDSPAYHVGFGVTAAFLGAG.................................................. 509
243 0.000e+00UniRef50_A0A100I8Y7 FAD/FMN-containing dehydrogenase n=1 Tax=Aspergillus niger TaxID=5061 RepID=A0A100I8Y7_ASPNG  ali  16  8...............................................SHETADQFDQRHYSDSSQDLPSPKDKAQVHTRPYEDATDATLDNPFADPEVAERYALIYEKAQYECRHVFDPTLTWTAEEEKALVRKLDWRVCLWACVMFFGLQVDRGNLVQAVSDNLLDDLGLTTNDYNTGNTIFLVAFLLAELPSQLVSKQIGPDRWIPTQMTIWSIVAAAQAALSGKKSFYATRALLGILEGGFIPDIVLWLSYFYTSRELPTRLSXXXXXXXXXXXXXXXXXXXXL-HMRGVQGMAGWRWLFLIEGLITLLIGLSSFFRMPASAVDTKKWWFTDREVSIVVNRVLRDDPSKGDHNRQAITPRRLWNSLRDYDIWPIYLLGLVVYIPQTPMTSYITL-ILKGVGFGTFTTNLLTIPYSVGHIICLLLLTRLSDWLKERSLVSMIQSIWTLPCVIALRFWPGNAWGTYATVTVLLCYPYCHAILVGWCSKN-SNNVGTRTISAALYNMCVQ-LGAIIGNNIYRADDKPKYHRGNSALIGINILAILLFIGTKIYYIYRNKHRERWNAMTEEERQDYLQNTTDTG.......... 549
244 0.000e+00UniRef50_A0A2B7X2F5 Uncharacterized protein n=2 Tax=leotiomyceta TaxID=716546 RepID=A0A2B7X2F5_9EURO  ali  18  11............................................................................PDSDPDRKDLKEFEHEESVADQYGEGAYIPPEQIQARFELLVDLTEEMEVLNKRVVSKLDWRMMPCVTLMFLMNYLDRINVSNARLAGLQSDLKMSDTVWNAGISTFYIGYLLAQLPGNMILAKTNPRLFLPGMMLLWSIGTICMPAMTNGPGFCLVRFYIGVTEAPFFPGLTLMTSSWYTKEESPIRMAIWHAGNTISNIISGFLAAGILENMDGIAGLHAWQXXXXXXXXXXXXXXXXXXXXLPEWPHNTK--FFTEQERQMAQYRVLVSNGGKDEKIGG--TWDGLKEAVMEPFTWFFCLMHF--ALVTAQSFKDFLPSIVDTFGFDTMTTYLVQAPPYAIAYAFACTVAWSCGRMQESTWHIIIPVIFSAAGAGMLMGTLNIGARYFGLVLLVSGTYSGLNLQLSWETTVVPSPRAKKAALIAIANCISQ-SSHWFSPYFWPTSQEPHHRMGSSLLIVGCVVTVISALLVNIRCRLLNKKLDASEGWSPNSGVE................... 502
245 0.000e+00UniRef50_A0A139AM91 MFS general substrate transporter n=1 Tax=Gonapodya prolifera JEL478 TaxID=1344416 RepID=A0A139AM91_GONPR  ali  28  3.....................................................................................ETSSLEKDVAKPLTDAKAVDAPKKKSFVSLFWDADYDTKSPLERSLVNKIDLGILIYATLGYFVKTLDQQNINNAFLSGMREDLNMYGNELNYAVLAFNVPYCVLAIPSNILLTKIRPSLYLPIIELCWSILTIAKGFVHNYQTLYVLQFFIGAFEAGYFPGVVYLIGSWYTNSELSKRFAIFSVTSAIGAMFSGYLQTAVYVGLNGSAGLSGWKWLFVVDGLISVVSAVVGFFLIPDFPETTKWKLFTPDEIELAKTRLNKDGKQGEV----KYSWDLLKRVFGRWHWYLFTILYAI-YNSASSSWGYLGFLLKFGGGFTVEQINLYPTGVNAVTAFFTFFWGWYADHTQNRXXXXXXXXXXXXXXXXXXXXXXXPFGLKFASYFFAAVSTPISN-TMAYLSTVVDKDPVERTLIIGSMNSASYTIFIIGQLVFWPTTSAPSFPVGYKYTATSLWVGLIVVTAIRYLWKRDLAR................................. 471
246 0.000e+00UniRef50_U5HG60 Uncharacterized protein n=3 Tax=Microbotryum TaxID=34416 RepID=U5HG60_USTV1  ali  18  10...............................................................................HFEDRLPMHASDPAKLSSSINSSEPEKVVLTTFESCDGRDPTSLRAIAERKLVRKQDFVIIPLAVCLYLSAYLDRGNLGSARLQGLEKELDNDDTKYSIALSCFFITYVVFSIPGTMLAKATSPSTSISIGALIWSIAASCQAAATSPTGFYVARLFVGIGEALFGQAMSFHLSLWYTKKELARRVGLFISAGATAGAFSGLIAYGV-AHLENT-SLQQWRILFLIEGLPSLLLAITVFFCLPTRPATSK--FLNEQERKLARLRLEE---QSSFEVSCGIEWSGVRRAFKDWKTYVFAVM-FSCMNLTLGSVGGFLPTIVKGLGYTAQNAQLLTVPPYLAALVCMLFLSTFSDRKQSRXXXXXXXXXXXXXXXXXXATYGQLHARYFACXXXXXXXXXXXXXXXXXXXXNT-GNESQRVVALGMLNTIGQAL-AILAAFSFPSKQGPQYREGILINLSFQALGLLIALFLTLYFRLENRRRNELEGTPLYGTLLNTREEFD............ 509
247 0.000e+00UniRef50_A0A166V9R4 Major facilitator superfamily domain, general substrate transporter n=1 Tax=Moelleriella libera RCEF 2490 TaxID=1081109 RepID=A0A  ali  20  2.......................................................................DPDYKAGAAEALSADNTSAHVIHLDHLADGRQQDCERSFQPPQILRNLTSDELARLEAKLLRKIDFRILPMVLVMYILNYLDRNNIASARFAGLEDDLGLSGTQFSTAVSILFVGYLLMQVPSNLLLNKFGPGKYLPFCMMIWGVISTSTAACHSYSGLLAARFFLGFVEAAYFPGCLYYLSCWYTRKELGIRTTXXXXXXXXXXXXXXXXXXXXXXNMDGARGLRAWRXXXXXXXXXXXXXXXXXXXXXPDFPRTTR--WLDEEEIALATWRLQEDIGQDDWVNSEQQTWQGFRLALVDVKTW--ALLALLFGNLSAASVTNFFPTVVSTLQYSDVITLLLTAPPYILGLITTFANAWHADKTGERFFHVTIPLVLAILTFIVSASTVNTAARYAXXXXXXXXXXXXXXXXXXXXSNTLPRPPAKRAAALAFINAVANATS-IYTSYLYPKSSGPRYTAAWIHNCVLAAMAIVAAFILRKMLIGLNKKLDHGELDRVASDTAPSEAVDNG........... 511
248 0.000e+00UniRef50_A0A093Y6E6 Uncharacterized protein n=43 Tax=leotiomyceta TaxID=716546 RepID=A0A093Y6E6_9PEZI  ali  32  29............................................................................................................QKAPWWSYIWDYDPNRSPQERKFVQKLDISLLTILSLGYFIKNLDQTNISNAYVSGMKEDLAMKANELNLIDVAWTTGYVIGQLPSQLILTKVRPSIWIPSCELVWTILTFCLAAATTSNQVIAIRFFVGLTESIFYPAAHFLLGSWYKQSELGKRACIFHASSAAAGMFSGYLQAAVYKGLNGTAGKAGWQWLFIMDGVISAPICIAGFFLIPDLPENTRAFYLSDEDAEFARKRMDDIGRAP----RKKLGWQILRRVFTRWHVYALTVLYIIFINTPSSSINPLSLWLKAN-HWPVTQINIIPTGQSAVQLVSTVSFAILSDFLRKRGXXXXXXXXXXXXXXXXXXXXXXPSGLKWFAYFSSRAAVAYGPLSMSWANEICSSDAEECALVLGIMNSMGYAFNAWLPLLTYPAKEAPRFKKGFIWTTSAYVAQFGITGLVAWLQM...................................... 471
249 0.000e+00UniRef50_A0A086TK66 Uncharacterized protein n=1 Tax=Mortierella verticillata NRRL 6337 TaxID=1069443 RepID=A0A086TK66_9FUNG  ali  18  2....................................................................SSPSTTTQFDPEHQHIIESNDGPALELMAPMSNLDLDQYEKDNQETHSVIEDFDLNSEAIKKIRWKVDKRFMPMLSLLYLCSYLDRSNIGNAKVFNLEEDLQLRPGIFNTALSIFFVGYVIGEIPANIMLKKMGPKKWITIVMLCWGTVSMSMAAVTNGAGLLATRFFLGLAEAGYAPGPVYIISLWYRRTEQALRVGXXXXXXXXXXXXX-XXXXXXXAHLHGVGGLNAWQXXXXXXXXXXXXXXXXXXXXXPNFPDTAN--FLTKEEKELNLRRLLIDAGPATETT---FSWEEVRSVFADWKVYLHTATNLLH-SIAFSSLGLFIPSIVRGFDFDPVTTQIMTAPIYVIACIVTITMAFSSDRFSERGYHAAASEALATLGYFLLIITSSTAAKYVSLIVCAAGVYSYIPIQLSWPSSNVGGQ-TKKGVAIAFVMSIGQ-IGSIVGGQLYRADDAPKYVRGNTICCTLLAINTLGNLAIKILLRRENKRRDRL---TPEQYNQECATSGQTDKHP....... 510
250 0.000e+00UniRef50_A0A1R3RHK2 Uncharacterized protein n=5 Tax=Aspergillus TaxID=5052 RepID=A0A1R3RHK2_ASPC5  ali  19  4.................................................................................................DPVEKGVAVEPEPATAMKPGESSIYIDRDAERSYVRKVDCCVLPLLCLMYFFDCMDRSNLANAKTDGLDQYIHLKGNDYSLMVLLFYIPFGLCDLPWNLLLKRYGGRLTLSFMTVVWGILALCQCAVKDFGGMIAVRLILGVFEAGFFAGATFYLTLFYTRGEMGFRLAIMQSFAVLASAFSGLISFGVFQIHDPA--VQGWQWLFIIEGSMTFLMGIVSFFWLPGHPRTA--WFLNERERAAATARQLRDTSSEVDT---GLDLKAAFETWKDWKFPVWCII-TFTYPVAYATAMNFFPLIVERLGYSTVKTNLWTVAPNLVGAVVLLCVAKSSDYFRERTXXXXXXXXXXXXXXXXXXXXDHKGVAYFACFLMAAGSYIPSCLVHAWHNNNNMHENS-RAANTGFFVGLGNLAG-ILSAATFRTE----YIPTLVATCCCNGVCIVVVTSLGWWMRRENGRRDRIQG........................... 461
251 0.000e+00UniRef50_A0A168I4L8 Uncharacterized protein (Fragment) n=1 Tax=Mucor circinelloides f. lusitanicus CBS 277.49 TaxID=747725 RepID=A0A168I4L8_MUCCL  ali  23  1..................................................................................................................................LYRKLDRRLLPLLCILYLLSYIDRSNIGNAKLGGLEEDLNMSKSEYQWSLSIFYFSYVIFDLPSNIIMRRWRPSHWLGILMFCWGAVATAMAASTSFAGLAVCRFLLGVFEAGFFPGVIYFMSLWYTRKEYGRRIGFFWSFSSLAGAFGGLIAFGISQIKNDA--LATWQWLFIIEGVPSVLLAALSAWYLPNKPETAT--FLTEEERELAVNRLANDAGASNDHS---WSWAQVVSVFTDWKTYVYMCIYILG-TVALQGVTLFLPSIVANMGWSKPVAQALTVPPYFLAFLATVAISWSSDKYFERAYHMVGLNSIAGFLLLMFLSSDNVAGNYIAACLVTISVYGNVAVKVAWFNNN....................................................................................................... 355
252 0.000e+00UniRef50_Q4W9P1 MFS transporter, putative n=6 Tax=leotiomyceta TaxID=716546 RepID=Q4W9P1_ASPFU  ali  20  44..............................................................................................................................QEKALVWKQDLRIVPLCAAIYLLCYLDRSNIGNAKILNLLSETKMTSYQYTIALMVFLIAYALFEVPSNYFLKKLRPSRWIAFLMLSWGACTMGLGGTHNFAQVTGIRFLLGVMEAGLFPGLVYYLTFWYRHSERSIRXXXXXXXXXXXXXXXXXXXXGV-GHMNQVHGLSAWRWLFIIEGAPSCASAVLVWFFLPDYPESAR--WLTREEKDLAAQRLRTEGSKG---EAKAMTWEDAKAVLTDWRLYAHYAIY-FGISAPFSSLSLFTPAITSGLGYTNLRAQLMTVPPWAVAYVVTTAAA-------CRGLHSALFSFIGAMGFLASAVLPPDAHRYGCLIVATSGSFACIPPLLGWLSSNLHSTAGT-GLAIALNVSFG-APGQIVGVWIYKANEAKRYPTGHWTNAGLLLFVCAGCIMLRCYYGWLNRR................................. 476
253 0.000e+00UniRef50_A0A292PRT6 Uncharacterized protein n=2 Tax=Tuber aestivum TaxID=59557 RepID=A0A292PRT6_9PEZI  ali  18  2....................................................................................................EGENTAKEILDHTDEAVPHWESWLPEEEACVRRQLDWRLLPLLTIQYMLCFLDRGWIENARIQGMQKDLDLVGFRFNWALTVFYIPYLLVEIPSNVLLKRIGPKXXXXXXXXXXXXXXXXXXXXQSFPGLCVARAFLGLTEGGTMPGMAFFMSCFYKRNELLFRXXXXXXXXXXXXXXXXXXXXXXSRIPEGTKGVHTWRNIFFFEGAITVGLGVWGYFLMPDSPQTC--MFLSGRERWIAAERIRIEHKELTREQTELW---HVKRAILNVNN-VICCMGFFCTNITVQSFSLFLPTILNALGWRATKAQLLTVPPYLVGCCFSICIAWLSDRYRKRGIFVLVCTVLTLTGYCILVSVDEANVKYGAVFFAASGAFPLGPAFLSWGLNNAAGP-SIRAITGAYIVSVGTC-GAILATWTYIPSDAPNYTRGHSINLGGQIGAALMGILGILYIRRENTFRERGGREHRLTGLVGEQVHKLGYRHP....... 485
254 0.000e+00UniRef50_A0A2P5HXQ4 Major facilitator superfamily transporter n=2 Tax=Dikarya TaxID=451864 RepID=A0A2P5HXQ4_9PEZI  ali  17  3..............................................................................DQISRAVSHGSVSSNKQTEQTLENAPASVPEGAEHLNVAHMTPEHRVRVEKSLKRKLDLR-CSLFVAIYIMNYLDRNNISAARLKGLQDDLSLNNTEYSTCLSILYVGYILMQIPSNMLINGLRPSRYLSIVMLIWGLISTLSGVVNDFKGMVVTRFFLGFVEAAFLPGVLLILSKWYTRRELTLRNAILFCGNLISNAFSALVGAGVLSNMQGTLGHAAWRXXXXXXXXXXXXXXXXXXXXXXDLPHNTRG--FTEEERQVAQLRMIEDVGEADTDSKEMGVTGGLVMAMKDGKVWLMMIT--LCAYVVGLSFNAFFPTLTGTLGFEYVPTLLMSSPPWLFACIVSLLNALHSDRTGEKFWHIVGPIVGGLVGFVISMSTLNIAARYVALFL-QASSYAGFIVFFSWISSSFPRPPAKRAVALAAINAFSQ-LGNIAGSYVWDLSEN-GFRKSYGIVTAMFGITIAGCWVFRLTLTRLNKKLEQGELVDWGEREDVAQQTA............. 526
255 0.000e+00UniRef50_U5HCV8 Uncharacterized protein n=6 Tax=Microbotryum TaxID=34416 RepID=U5HCV8_USTV1  ali  21  17..................................................................................................SHAGSGVEDDEKASEIAVAGPGVPFSKAAEQRLLRKIDWKVVPFLSLLYLMSFLDRVNIGQARLNGLEKDLHLKGNQFSIALLVFFTSYVFFETPAVIFVRRLRPSRXXXXXXXXXXXXXXXXXXXXNFTGLTTARFFLGFAEAPLFPAACFYLTSWYKRKEQNIRISFFFSAATLAGAFGGLIAHG-LSMMNGLGGLAGWRXXXXXXXXXXXXXXXXXXXXMTDFPEEAN--FLTQDEQQEVLRRLKADRGPSSQTE---FAWSQVRAAFTDWKTYCFTLIYI-GVAEPFYSIALFIPTIVAALGFSLSQSQLMSTPPFFLGFATTLFSALYSDRLGHRXXXXXXXXXXXXXXXXXXXXRDDPKVAYFALFLCVGGLCPCISNSISWIGNNYPN-RTKRSAAMGLFFSVGNA-GGIVSSLVYFKQDSPRFIRGHSVGLGFALMTLILSLGLTLHLRSENLAKEAKYGPAQDGDEDFDQLS.............. 492
256 0.000e+00UniRef50_A0A0P7BB01 Carboxylic ester hydrolase n=1 Tax=Neonectria ditissima TaxID=78410 RepID=A0A0P7BB01_9HYPO  ali  15  15.........................................................SDYEGSTDSVPPLGAPSEERRFWFQRVKAYDPDAIATQPSVFDDSTTAEKYQPPSHWERFDPLARWTWREETAIVRKIDLKIMIFACVMFMTLELDRANISQALTDNFLDDLKMNTNDYNLGNSVFKLAFLCAELPSQLVSKWMGPDRWIPTQMCLWSIVAFSQFWLTGRDSFLTCRALLGLLQGGFIPDVILYLSYFYKHHELSIRLSFFWAMMSLADIISALLAAGLLK-MRGLNGHAGWRYLFLIDGLLTLVFGLVAYGLMPPGPTQTKTGWFTEREETIIVNRVIREDPKSSMHNREPITPRLLWRSLKDYDLWPLYILGLLHAIPATPVQQYLTLSL-KGLGFNTFQSNMLTIPYTVLHMINLLIITYVAEVFKNLSLVAVFSQIWILPFMIYYQVVDTTTVNRWIIFAVSSAYPYPHAIQVAWNSRN-SNSVRSRTVSAACYNMFVQA-GAIIASNIFRADDAPQYRRGKKQLLAIVCMNIVVYVLVKVYYVFRNKKRDKWGSMSEAERVDYLNTTKDVGNKRLDFS... 557
257 0.000e+00UniRef50_A0A0C7N5U5 LALA0S01e19218g1_1 n=39 Tax=Saccharomycetaceae TaxID=4893 RepID=A0A0C7N5U5_9SACH  ali  20  12.................................................................................ETITVKEPSPSKDLTVQSNEEDQVCLISASDGSHTIAKSLTIDVEEEKALVRKLDRRFVPVLAFAYFLQSLDKTNIGNAYTSGMKEDLNLTSRQYSNAVSVLYSTFLATQIPTTLYLRIIPPRYFMSAMVFCWSIITMCSGFVKSYHSLLALRVLLGLFEGGYFPAMVLLVSMVYKPEEQAKRIAFFFGCAALAGAFGGLIATG-MATVRGAAGLNGWRXXXXXXXXXXXXXXXXXXXXLPNDVEN--PDFLDEHERKLLQLRSKQ--RLQYVGAKQEFSWTFVWDALKDFKVYTGLLIQ-FCQNIILYAITTFLPAILKGLGYTSREAQYMSVPVYVLAATVFLSSAYLSDRFNLRGPFILGFNMVTIVGYILMLTVKSNGVKYFACYLMTFSAYTGPGLNVTWVSNNIA-PHYKRATAIGLSQTFGNLAGAIAG-QVYIE---PPYVLGNSFALGCVVFSSILVAFQIITFYSINGRRASILRGERIDKGTIKEGDK............. 500
258 0.000e+00UniRef50_A0A094GGX4 Uncharacterized protein n=2 Tax=Pseudogymnoascus TaxID=78156 RepID=A0A094GGX4_9PEZI  ali  18 1776.............................................................................................EDKAGEEIFKNDDGEKKDGYRVAEEDVSLEQRQMEARIMRKVDWRLIPILGILYSVSGLDRVNISNARVAGMDKDLHFNGNRYSIALLVFFITYLLFEMPSTLIMRYIGPRVQLSALAMSFGAVMLGMGFANDWRVIVVCRMLIGMFEAGFLPCCMYLLSCWYMRYEVQKRMAMWYVVNLFVSAFGNILAYGIVK-LDGAHGIAGWRXXXXXXXXXXXXXXXXXXXXXXNFPDSIKNGYFTQAELEVVMDRVERDRG---DSLPDKLTKEKFFRHISSWQLWVYGFM-FLCCSAPIYAFAYFIQTILKTMGYSTAVVLLLCAPPYLFSAIWTVAVAWAADKTKLRMPYMVLNAVITLVGLLLTAYCKNNGVRYFGIFLGVSGCNGNLPTIIAFQSNNVRSD-SRRSVGSGIQFAFA-AIGGIYASCTFIQKEAPSYPTGIWCAVATQFLLAILVGVMTLHFKRVNKKADEEGFVLQED...................... 2251
259 0.000e+00UniRef50_A0A0F7S093 Related to nicotinamide mononucleotide permease n=10 Tax=Ustilaginaceae TaxID=5268 RepID=A0A0F7S093_9BASI  ali  20  51..........................................................................................................................WSDDEESAIRRKLDIRIVTTSFALYLVALLDRSNIGNAKTAGMEASLGMSDAQFQWLLTIFYIGYIVFQF-QVLVYKLVPPRVWIAFCVFAWGVAGVCQAATTNWAGMMVARFFLAVAEAGYGTGWALYLSFFYPRTEIGVRFACFVSGGAVSAAIAGSIAYGLV---HAHTALAKWRLLFLIEGIPTLLMVPVAFFLLPNSIQSAS--FLTAREKQIAEARMEPNNQSWTSRLKRQINWSQAGTAFLDPTSYISGIL-LFIINVGYSSVPVYTPTLISQMGFGNIKAQGLSAPPYVLAFILSIILCYLTDRWQIRGPICTLLLLLGAVGYIMLACLRSTAPRXXXXXXXXXXXXXXXXXXXXXXXXNQASSESKRGLGLVIFATIGQC-GTLLGTHLFPAREKPYYVKGTAVSAGLLLLGVVVSAAGSFEFWRINRRRDREEAMADVATDTGGKSDGDEEK......... 512
260 0.000e+00UniRef50_A0A238FA26 BQ2448_2011 protein n=3 Tax=Microbotryum TaxID=34416 RepID=A0A238FA26_9BASI  ali  16  3.................................................................DGTKPTMQHVEDRNARFAPEREATTTDGQLAQTVTNDTEKGTKSTYADSAAGVELRAERHKRERRLVRKQDFVILPLAVFLYLSAYLDRGNLGAARLQGLQKELDNSDNKYSIALSCFFITYIVFSIPGTLLAKAINPSTSISIGALIWSTAATCQAAAQTPRGLYTARLFVGLGEAMFGQAMAFHLSLWYTKKELAKRVGLFISAGATAGAFSGLIAYGVAHI--HSAKMEQWRILFLIEGLPSLALAVVVFFCLPPRPSTSK--FLNEDERTLAHTRLNE---QSSYEASSGIEWSGVRHAFFDWKTYAFAVMY-SCMNLTLGSVGGFLPTIIKGLGYSNANAQLFSVPPYVVALAFMLLLSSFSDRKQTRXXXXXXXXXXXXXXXXXXATHTQLHVRYFGCICIVTAGYSAIPLIISWVSANT-GTESQRAVSLGMLNTIGQCLS-VLAAFSFPSKQGPQYRKGIIINLAFEALGFGMAIGLSLYFQWENKRRERLEGEPQKG...................... 535
261 0.000e+00UniRef50_A0A194XAH2 MFS transporter n=2 Tax=leotiomyceta TaxID=716546 RepID=A0A194XAH2_9HELO  ali  20  1.................................................................................MASVEKMNDAEYPVDSK-EAPGSESDIERGNGLVQVASNYVVDRKLEKKMLFKFDIHILPMLAIMYLFNSIDKSNLGNAKTDGLTKDLHFTGNQYNILLSIFYVPLVLTAVPMNMLTKKFGAKXXXXXXXXXXXXXXXXXXXXTNFGGIVTTRWFLGMAESGFYPGVIFYLTTFYKRNELAGRLSIFYAASEVAGAFTGLIAFGVFQIKD---ALYGWQXXXXXXXXXXXXXXXXXXXXXXKSAATA--YFLNEDEKALAYHRIAANSSTVVDSE---FSFRQAIRVFKQDRLWPVYMSIGFCVGVPLFSVSNFLPQIVAQLGYSTVKTNLYTVAPNIVGACFVVFVAFSSDYWGDRSCHLAATLATTAVGFVVLACVDVPGVGYFACFLLCAGGFITSPLLSTWYNNNTP-DENQRAILTPVMVCTANAMG-LVAANIFTEQSAPRYVMASIICACFGFAGVAIVLSLGFWMKYDNARRNRAQGVNTKAGDVPTSELKGGQKDP....... 497
262 0.000e+00UniRef50_A0A0L1HLT6 Rna-directed rna polymerase (Sad-1) n=1 Tax=Stemphylium lycopersici TaxID=183478 RepID=A0A0L1HLT6_9PLEO  ali  20  1..............................................................................MAGTNSLEDTEKNVPLQVDDIATSEKNLKTQAVLDGADYTGAIAKTDPAEIALVRKLDMRVMPALFCMYFLNKLDQNAIANARLNDLEEDLGLVGNQYNTCISILYVGYLFAQIPSNMLMKKVRPSLYMALCCCVWGCVAALTALVKNYTGLVLVRFFLGFVEAPFYPGALYVLSMFYTRKEIATRVSILYAGNIFAVSFAGLIAAATFATLDDKHGMHGWQXXXXXXXXXXXXXXXXXXXXLPDEPLTTK--WLTPEQRQLAHDRIQRDTVGL---EPSKGARAGFMQALQDPRLYLLVFMQNMHL--SATSFNQFFPTVVKSLGFSTTITLVLTAPPSLVAGAVGICIGISSGRFNDRTWHITGMMGLAVIGFAISASTLNLAARYVSCFLFASGVYSVNSVILGWVSGTLGQTTEKKAVSLSIVNVVS-MASFIYTPYLYPKSDGPK................................................................. 444
263 0.000e+00UniRef50_H6BQL3 Retrograde regulation protein 2 n=6 Tax=Eurotiomycetes TaxID=147545 RepID=H6BQL3_EXODN  ali  19  26......................................................................................................................DEAFVDPAVEKRALRKFDYIMIPQIIILVIIAQLDRSNIGNAKVFGLEKGLKLHGSQFNDIVTLFYPTYIVCEVPWVVALKRYGVNRILSISMVGWSVVTLGSGFVNNYSQMLACRILLGVFEGALNPCLIMTISTIWDRNSQAKRVSVIYVASGLSGAFGGLIAYAI-QSMGRKHGLDPWRWLFIVEGIISVVLCGLSWLSMPTSA--AKAWFLTHEEKEAMLVRAANNVRFQGTE--QKLAWSHIRAAVFEPYVWLGG-ITLFANSTATLGFGVFLPTIIRGMGYTSLQANYLTIPVYLFVALCCFVCAFGADKLKSRXXXXXXXXXXXXXXXXXXXXXXKKGVGYAAMFLCGGGMFCLSTLLLVWISINIS-PDYKRSVGVGIMGMLGNCAG-VLSAQIYQTTDAPRYVTGNAISLGMEGVAWVGVALMYLMLRLRGNKKDKMKAD.......................... 466
264 0.000e+00UniRef50_S7RLW5 MFS general substrate transporter n=4 Tax=Agaricomycotina TaxID=5302 RepID=S7RLW5_GLOTA  ali  19  5.........................................................................................DAEKGPSPVVEVDAVDEGRREYDFTPEEVDAYELDPEVSKAVRRAYDRRIMPVIFFMYLFSALDRGNLGNAKTDTLEQDLHLVGNQYNNVLTVLSLMFATMAICGGFVTKRFGPPRMLPIYMLGWGSMAMINAAVKDYGGIVAVRFFLGTFEGFFGPSVPIYLSSFYTRGELAKRLAIWYSSTALSGAFAGLLSYGIFQI---KGSMSGWRXXXXXXXXXXXXXXXXXXXXXPTYPQ--YVDFLTPKQKEAAVMRLLKDASKRVDA---PFNAREFFAPAKEWKFYVF-IIFALCYGTASSTATTFLPQLIGRFGFSKVKTNLYTVAPNVVAALYLYLLAFMSDKVRQRTPFLALALGTTMIGCIMLAALPATGPGYFACFLIQCGAFVPTSLFHSWHNNNDPSENG-RAFRTGFLTFSANA-GSLISSNIFLDSWAPKYTKALIISACLQVLGITLVLSMRTYMALDNRRRNRKQGVNWTSKDVPTAVLAEGPKNP....... 492
265 0.000e+00UniRef50_J5SDG9 Uncharacterized protein n=24 Tax=Dikarya TaxID=451864 RepID=J5SDG9_TRIAS  ali  20  2............................................................................AQPTAEKLPAYAAPAPGGLDDHTSASDTKGDLTQIDSAEVQDFVYVPDTEEERKLVRKIDIRLIPMLWVMYILNYLDRSNIGNAKVGGMEQDLQLDSTKYSVVLLIFFIGYLLFEVPSNMILARSRPSXXXXXXXXXXXXXXXXXXXXHNFGGMVAFRFILGLIEAGFFPGVMLLLSCWYKPRELSKRIALFYTAALLSGAFGGLLAGGIISSLNGRSGIAGWRXXXXXXXXXXXXXXXXXXXXXXDYPATTK--WLTPRERQLATMRLQA-PESQGEEEPHMGHWKAFLASISDLKTWVFVIIYNLINMVG--TIQYFYPTLMQSLGYTGKMAQYMTVPIYTVTLVVSVICGFIADRTHNKGPITMFGCALACVSFIITVAVPNDHAKYAFICFGAAGIWTAVPCCLSWAVTMFDG-REKRGVSIALINGLGN-LASVYGSWFWPSDTAPKYIMGFALCSGFAGFVFFVTWFAYWRY....................................... 472
266 0.000e+00UniRef50_F0XG13 Flap endonuclease 1 n=1 Tax=Grosmannia clavigera (strain kw1407 / UAMH 11150) TaxID=655863 RepID=F0XG13_GROCL  ali  21  37...............................................................................................................................EKRMIRKIDFALIPLVMGLYMFSFLDRVNIGNARLYSLEEDLGMHGHQYQTAVSILFVTYITFEIPSNLVLKKFTPSRWIGFITTAWGIIATLTGLVHSYGGLVACRVLLGTVEAGLFPGLNIYLTLFYTRRELAVRXXXXXXXXXXXXXXX-XXXXXXXXHMDGLDGRHGWSWILIIEGIPSFVLGIACFFLLPNSPESA--YFFTETEKKAVALRWAGEYGRT--ESAQEFSKKDMYKAFTDWKVWVFCA-GQFGADTMLYGFSTFLPTIINGLGWTTAQVQLLTIPVYFLGAATYMTMAVLSDRIQQRXXXXXXXXXXXXXXXXXXXXDSSAGVHYXXXXXXXXXXXXXXXXXXXXXXXXCPR-YGKRTTASGMQLTFGNAAG-IMAPFIYATKDKPRYIRGHAITLSLVGLSTCIYVFVWWSLSKANRARDAAEREAEEQGQLPEELEELGDESP....... 491
267 0.000e+00UniRef50_A0A284RCY9 Uncharacterized protein n=1 Tax=Armillaria ostoyae TaxID=47428 RepID=A0A284RCY9_9AGAR  ali  21  3......................................................................................................SDSGKPEQEWQEEFANAVYEPGSEVEKRLVRKIDRHIVPTVWVLYTLSYLDRADIGNAKSGGMEEALSLTSNQYSIILLVFFISYVIFEVPTNMFLTRVRPSYYLSGLCFIWGAVAASMAAASSYRQLAGVRFCLGVVEAGFAPGIAFYLSSWYKRHELAKRFAIYYTATAVSGAFSGLLAGVITDNLDGARGIDGWKWLLLIEGVASSFGACFTWMILPDWPSTTK--WLTPEERFIAIQRLAYEGIGNTATGKSPSHKEAFYLAINDWRTWALSFMYMLA--TGAQMIQYFIPSLVGQLGYIGYTKQXXXXXXXXXXXXXXXXXXXXXDIRKERGNYVTITSLIAGVSFIITVAVDNQKVKYAFLCFAVAGIYAACPLTLLWVSSVIDHPAEKRAVAIAIVNGLGNSAS-IYGSFLWPSNTGPRYVQGFATTTAFVLALAVSAQILKVLLKR..................................... 455
268 0.000e+00UniRef50_A0A0E9N9X6 Uncharacterized protein n=1 Tax=Saitoella complicata NRRL Y-17804 TaxID=698492 RepID=A0A0E9N9X6_9ASCO  ali  20  24..............................................................................................SDRSSSQHEFKSGTNAALLSAASQFTPEERKSIEKRLLRKVDLRMMPLLVLIYILNYLDRNGIAQARLQGLEKDTKLVGTDYNTVISILYAGYILCQVPSNLFLSKSKPSVFLPACMVVWAIVSGCTAATHNYTGLVVVRFFLGIVEAPFFPGALYLLSSWYTPRELGQRTALLYSGSLLSGAFGGLISAGILKGMQGAGGLDAXXXXXXXXXXXXXXXXXXXXXXXXDFPATTK--WLTEEERIIAQYRLIEASGATPGVPTEDVGWKGFRMGLKDYKIYVLMLIQ--TAITTSACFTNYFPTMVKTLGYDSTRTLLLTAPPYLAAFFSTYLVCRHADIHRERXXXXXXXXXXXXXXXXXXXXXXXXXXRYVALFLMTAGIYPAYNNVLTWVSSSIPGPPAKRATALALVNGFSN-IANLYGSYLFPAQDGPK................................................................. 455
269 0.000e+00UniRef50_G3YC48 Uncharacterized protein n=16 Tax=Aspergillaceae TaxID=1131492 RepID=G3YC48_ASPNA  ali  19  6...........................................................................KREAPGDATGHVDAIVEAPGPDPEKQQVAHDEDFHTALPQIPQATPTIDPAVEARLLRKLDLRVPTLLGFLYLLSLLDRSNIGNAKLAGMEEDLHLTGNRYTWLLTIFYISYTLFEFLA-LMWKIMPPHRWAAITVMTWGIVATCQAATQNWGGMMALRFLLGMSEAAFGPGSPYLLSFFYRRQELGLRCGLFLSAAPLANTFAGALAYGITS---GHAKIANWRLLFLVEGSPSLVAAFLAWFYLPDHPASAR--FLTEEEKEVARARSLR--RSGESERVTGINWKELWQTLLDAKAWLTALMYFSC-NVSFSSLPVFLPTILEDMGFTAINAQGLTAPPYFASFLVTIATTWLADRLQQRXXXXXXXXXXXXXXXXXXXXCTSVGVRYFXXXXXXXXXXXXXXXXXX-XXXNNQGSDTRRGMGIVILNVIGQC-GPFLGTNVFPASDAPRYIRGQSICXXXXXXXXXXXXXXXXXXXXENRRLDKGTAAERAAQATSKGDLTLGEEN........ 506
270 0.000e+00UniRef50_A0A1A6A032 Uncharacterized protein n=6 Tax=Agaricomycotina TaxID=5302 RepID=A0A1A6A032_9TREE  ali  24  2.......................................................................................NNDHIVPNAVAQDLEKTEVSHNEHAVVDPTSEEYLIDKKAERKLLLKLDAVILPMTVLMYLSANLDRGNIGNARLQGLQAEL-LDGSDYSVVLLCFYVTYMLVSIPGTLLSKAFPPNYALGAGCLIWAIAATCMAGCQNYASIIVCRLFIGVGEAIFGQAVVLHYSLWYKKNEIATRXXXXXXXXXXXXX---XXXXXXXXXSHIKSGIETWRILFLIEGAPSVVLGICVALFLPGRPD--RSRFLNEHERELEFLRL---RSQNLDEGNTGIDWDGVKRAFTDWKSYVITFIY-SCMQLTLSSISGFFPTIISSLGYTNADAQLYTVPPYAVGFVAMVLINHFSDRLRMRXXXXXXXXXXXXXXXXXXXXXHNNKVRYFGTFCIVIGGYATIPLIQSWVSNNT-GSQSQRAVHLGFLNSLAN-WAALTSPFIFPTKNKPYWHLGFGMNLGFSIAAIIVTACMMLYYSRENARRDSLEGKPLPGQKVDQARLHD............ 486
271 0.000e+00UniRef50_B2ANX2 Podospora anserina S mat+ genomic DNA chromosome 7, supercontig 3 n=2 Tax=Sordariomycetes TaxID=147550 RepID=B2ANX2_PODAN  ali  17  6....................................................................................................DSALPAEDAIHTEKALGTLPHEENPRLDKILNRKFDLHILPWLFGIWLFSFIDRSNIGNARLAGLPEDLGIVGTQFNLALLVFYIPYILVDVPSNLLLKKFRAGVYLPSLITAWGVVCLSIGFVKSYAGLIVCRLLLGLFEGGILGGVIIYLAMFYKRHEMLYRSGLFYCAAPLSGAFGGLLAGALGNI--EVGGYKRWPWIFFVEGAATVVFGIVCLFFMPDTP--AASRFLTEEERDWALKRMKIDASGSTTVDEEKFDWFWVWMAIKSPQM----------------CFSLFLPSIVAGMGYTSTTAQLFTVPPNMAGFVVVILTAHFSDKVKNRXXXXXXXXXXXXXXXXXXXXXEQNAVKYAGTFLIAMGVFQASPMLMTWFPCQQPGSSLRQGSGSGHCDIHRQLLGIHWNVYLLATRPRPKYALGHSISLGALVITLFLTGLQVAYLSWENRKRDSGERDVR---LVEGSVHRLGHRHP....... 513
272 0.000e+00UniRef50_M3AWJ9 Uncharacterized protein (Fragment) n=5 Tax=Capnodiales TaxID=134362 RepID=M3AWJ9_PSEFD  ali  22  4........................................................................................................................TPSTPNLDTHILHKLDKTLLPLLWLLFTISFADRTAIGNAKIQGMSHDLILTGNRYNLAVMTFTLAYVLFAIPSNLLFRKLGPQT-LPAMMILWGICALGQGLVKTWRELVVCRFLLGTFEAGFVPGAACLIGSYYRKDEFLKRYAVFFSGAIFAGAFNGFVSYALAKA-DGVGGIAGWRWIFLVEGILTCVVALPTFWLIPAFPEETKM--FKGEEKVALLERLREDGGSEPTEGM----WTHVMEALLDWKIWLATLAYI-GVEENVASVVAFLPSILNGLGFTSISAQVHSIPIYMTAFAMTLIVAYLSERLRQRXXXXXXXXXXXXXXXXXXXXQPGSASKYAGTFLLTAGCYIAMPILVVWNAINV-GKGYKRVVSFAMTTAIGNC-GAFISSNVFITHEAPGYPTGFKVGMGMNCLAILSMTVLYVVLLWTNRRRKMEGSTDFERVGSNEPFSDDRDRR........ 458
273 0.000e+00UniRef50_A0A1Z5TRK8 Uncharacterized protein n=1 Tax=Hortaea werneckii EXF-2000 TaxID=1157616 RepID=A0A1Z5TRK8_HORWE  ali  16  13.........................................................................................ESGKQAAGHVEVVDNTERALLDRYALLKDLSQEELDKLDKAVVRKLDWVFLPCVTLMLLMNYLDRINVSNARLAGMQSDLNMTDVEWSAGISLFYVGYIISQIPANVFIAKGKPRVLLPACMLGWSCVTICMPAMKSPWAFMLCRFLVGITEGPFLPAVSVITSSWYTRQESPMRMGLWHAGNVTSNIFSGLMAAGILTGMDNLAGLHSWQXXXXXXXXXXXXXXXXXXXXXXNWPHNTPTYYFSPQMAEMAQYRSAVSAGGRSEDDEGGY-FDGIRQAAKDPFTWMFAALHFFL--ILSQSFKDFLPSIVKTFGFSEVGTYLIQAPPYLVAYIVMLALSWSSGRTGDHAFHIIGAILMCMVGAVIMISTLNPGARYFSVFLLCSGPFLGLNLQLAWETTVVPRPRTKRAALVAIANCVS-SVTHWFSPYAFLRSQEPRYATGGGLMIAGCGLTVFAALLLRWWAQRKNKQIDRREEQTGE....................... 489
274 0.000e+00UniRef50_A0A1V8SUW9 Uncharacterized protein n=1 Tax=Rachicladosporium antarcticum TaxID=1507870 RepID=A0A1V8SUW9_9PEZI  ali  16  8....................................................................................................EGGHAAAIADEKDVSPSPYNHVDDPATERRITRKLDFHILPWIFALWLLAFIDRSNIGNAKIDGLTTDLKLTGNKYNIALTVFYILYILIDIPSNWLLKIVGGGKYLPFLALAWGIVGTCMGAVKSYGGLIVCRMLLGACEGGMFGGIILYLSMYYRRHNLMFRLGIFYCAAPLSGAFGGLLATGLAEI--NYGGYKSXXXXXXXXXXXXXXXXXXXXXXXPDTPGKAK--FLTEEEQWYITHVLREDLGGATSEDDEKFSWSAVRMALLNINTIGLSV-NFFLILIPIYSYSLFLPSIISGLGYKRITAQLFTVPPNFLAFLMVLIASWTSDRIKMRXXXXXXXXXXXXXXXXXXXXXHTSGAKYVGTFFVAMGMFPCSPLVLAWLSNNLA-PHYVKATGLGFQVAFGNC-GAFVATFSYLSTDAPKYTKGHAINLGAIGLSLILTLSMMAYQKAENAARASGKRDARLNEGKGE................. 495
275 0.000e+00UniRef50_Q5K7A1 Uncharacterized protein n=19 Tax=Dikarya TaxID=451864 RepID=Q5K7A1_CRYNJ  ali  18  2...........................................................................................SRTPTDEEEGNVKYDEKITVADVGEELTIEDIDYSEEKRILRKIDWNLIPVFGALYMMSFLDRSNIGNAKLTTFSADLGLVDNQFGAATSVVYATYVVFEPFWTVLLKMIKPRYLLTATTICWASITIGSAFIKNYDQLLAVRILLGAFEAGMIPCTTLYLTMTYNRDEYVSRQTVVFVFSAISSAFGGLLAFGLSHI---KGNLAGWQWLFLVEGIISMCLVPITWFQIPN--EVTEARWLKPHEKETLIAR--RQRNKMTYDDNEEFSWGAIISVLKDYRLYI-SAISHFGIDSTLYSLTTFVPSLLAGLGFSTTDAQLLTVPVYAVGAIAFIFCGRMSDKTKLRXXXXXXXXXXXXXXXXXXXXXXQVGVRYAAVFIAAIALYTTTSLNVLWAADNFSG-HYRRAFAMGFIQLVGNSAGACIG-FIFTSQSAPRYLKGIYYDIGVTIMSICFTCILMFIAWTRNKKKREAIAAGAPNQ------PELGDANP....... 481
276 0.000e+00UniRef50_A0A2V1ASH4 Uncharacterized protein n=1 Tax=[Candida] haemulonis TaxID=45357 RepID=A0A2V1ASH4_9ASCO  ali  16  183.........................................................EDKKDGAKTIEVKELEDSEDSSELELQQRSKQENPFLDPFLAEYYARIYEESKYECRSAFDPHFEWTEAEDKKLMRKIDRRVILSACIMFAALQVNRGNLHEAVADNLLEDLNMDTNDYNMGNTINLLCFLAAELPSQVISKALGPDIFIPIQICSWCIVSTCQGAMHNKTGFLICRALIGLFQGGFIPDMVLWLSYFYKSGELPLRLSYFWTALAITQVVTSLLAYAILR-MRGVGGLAGWQWLFILEGAGSLLIGIWSFYLMVPSAVQTRKGWFTEREEKITVNRILRDDPSKGMHNRQSLSLKMILGSLCDYNLWPLFVIGLFAYMPMRTVSPYMVLAM-KNLGFSTFDVNLLTIPSHVLQIIFMLGVTWFSEWVNERGFVCLSLPVVTVPFLAAMRWWSGTAWVTWFLVTMVLSAPYVHTICVAWVSRN-SNSIQSRSICSALYNMFVQA-GSIIASNIYREDDLPKYRRGNMQLFFIMVSLIPIILLTKLFYVRKNRERAKWDAMSEEEQQTYISETKDRGNMRLDF.... 720
277 0.000e+00UniRef50_A0A1X2HVI9 Major facilitator superfamily domain-containing protein n=1 Tax=Syncephalastrum racemosum TaxID=13706 RepID=A0A1X2HVI9_SYNRA  ali  18  10.............................................................................................................................................YLSLNFFFSATHRSNIGNAKLGGLLTDLHMSSHDYSWALSIFYFGYVIFDIPSNIVMRRWRPSIWLGMLMFTWGVVATCMSLAKNAATIMALRFLMGVFEA-----------------EYGQRAGFFWSCGSLAGAFGGLIAYGITHIPTDT--LHTWQWLFIIEGLPSVVLAAFSAWYLPNNPETAK--FLTDAEREKEVRRLAKDQGAANDHT---WSWSLAASVFLDWKTYMYMFIYITGTS-ALQGVTLFLPSIVKEMGWDSAISQLLTTPPYFAAFFATIGLSYSSDRFFDRCYHMVGVNIFGLAGFLMLMFVPHVGVHYFAAILVTVAVYANVSVKVAWFNNNFAG-LTRRALASAAIVSVGTVGGAIGGQIYY---DPPLYFGGNTIAFACLAAQTVADLVCRFLLARENKRRENLREERELEIAKYGGEENAGDRHP....... 432
278 0.000e+00UniRef50_A0A238FLE9 BQ2448_4380 protein n=1 Tax=Microbotryum intermedium TaxID=269621 RepID=A0A238FLE9_9BASI  ali  16  6.............................................................................................TESKDGQKEGEMTKSSTGQTCVSSSSLAGIDCKAERRLVRKLEIWIMPLLSLVFSLNFIDRSAVGNANVAGLSKDLKLVGYQYNIALTLFYVFFMLVEPFSNLLLKRVGA-MWLSTMVVLFGTFTITTAFIRNYHQFLAVRILLGLAEGGSIPAITFVLGRFYRRRELVLRIGIYMAGPSLSGAFGGLLAGALVK--RTIGSVHGWRCIFFVEGLITTLVGLLSFFLIPTSPESAS--FLNKEERALAVKRIEFEHLGAPKDET---TYKSIRHALGNGITWLCCLCYGF-INISVQSSALFLPTVIHTLGFSVVEVQLRCVPPYMVATLWSIFIFWVCFRTRKHGIWIAFTCCFSVTGYIIFLTVHNSKILYFATFLTFSGSVTAGPIFLTWAVVN-ASPETSRXXXXXXXXXXXXXXXXXXXXTTLP-KYAPRYVPGNGLNVAACAIPAVISLGITAYCNWENHQRDLGKRDDRLEGLTQKEQEALGFKHP....... 520
279 0.000e+00UniRef50_A0A1Y2J549 MFS general substrate transporter n=1 Tax=Trametes coccinea BRFM310 TaxID=1353009 RepID=A0A1Y2J549_PYCCO  ali  18  42...............................................................................................................................ESQVLWKIDLRVVPVISVLYLLAFLDRINVSNAVLFNLKQDLNLTGNH--------FIPYILFEIPSNMLLKRFKPHIWLPLCMVVFGVITILQGFTHKFSGL-------------------------YRREEAQKRFSLFYSSTTLAGAFGGLLASAI-GKMDGMRGYHGWRWIFILEGTLTAIGAALAYLVIPDFPEDAT--WLAEDEKEFVKARLYEDVGDPRSH--DPLTVKSALSVFKDYKVLFGPLMY-LGVLVPSYSCSYFAPTIIQTFGHSTITTQLLSVPPAACASVATMLIATASDRLRRRXXXXXXXXXXXXXXXXXXXXXHDPRAQYAALYLAEGGAAAASPIVLCWFETNL-GNHHRRAVGTAAQIGFGNIGGI-IAAYSFLANDSPRFLPGFSICLGFTALAMVAACGYYVVVAAENRRRDRLAMDTPSAEKSAEERERLGDLNP....... 463
280 0.000e+00UniRef50_A0A1Y2B7T8 Putative nicotinamide mononucleotide permease n=3 Tax=Dikarya TaxID=451864 RepID=A0A1Y2B7T8_9TREE  ali  20  2...................................................................PTTRALQTSAPVEPQLYGEDDKHSIHHVDKDLDNDGVDRHLAVRVPEILLNLSPEELAAADRSATRKLDMLLMPTLILLYLLNYLDRQNISSAKIAGIATDLGLTADQYSTSVAILFAGYVSLQIPSNIIASKIKPATYICLMCAVWGLISGCTAAVQNYPGLTVCRCFLGFAEAAFYPGAIFLLSTFYEKKKIGMRSAALYLGSQSGNAFGGLFALGVIQ-LDGRLGIPGWRXXXXXXXXXXXXXXXXXXXXXPNKPETMR--WLTDVERAQLVHRLQIDR-ATVDATDETTIRQAFVLAVTDPKTWLLCGVEQM--ICIAASVTNFFPIVVKGLGFNTTITLVISAPPYLLCCVFMIINGWHSDKKQERTLHIIIPFCVTIIGNVIALSTTNVAARYFAMCILPPSFYGAFVIVISWISSSMTGPHIKRAIVFALINCLCNTP-NIWTSYLYGNN-GPRYIAAFSVDLAAAVGCVLFAAGTHLYLRRQNAKLDRGESLGQSGP..................... 499
281 0.000e+00UniRef50_A0A068S6U3 Mfs transporter n=2 Tax=Lichtheimia TaxID=688353 RepID=A0A068S6U3_9FUNG  ali  19  5............................................................................................PEDDKAQHDDAEQISMNGSTPMATEAGDKERRAMVEKKLLRKMDLRIIVPMSTLSFLIFLDRAIISNAKLGGIIEDLNLTPTEFSWTLSILYFGYFLFDIPSNIVLRKWVASYWLSLLTLFCGIVTMCMASCTNFAGLMVTRFLLGAIQTGFISGGLYFLSLWYTRDEYGKRASHFMGWATISGASSGLIAYGI--SMIPTNRLNTWQWLFLIEGVPTVLVSCFTLWYIPVKPETAK--FMTEEERIVEMERLAIDQNITID---QSWSWDIAVTVAKDWKTYMYTIICLFS-TIALQGVTLTLPSIVAGMGWTTVESQALTTPPYVMAFIGTLIVGWTSDRFYDRSXXXXXXXXXXXXXXXXXXXXDESGVRYFAVCLCTIATYANTTIKFSWFENNFSG-LTRRAIASATILSISN-IGGVVGSFIYY--DPPFYFAGNTITFCCFTAHAITVVIMRILLARENKRRAVMSPEQRQEEITKHGGESAGDRHP....... 490
282 0.000e+00UniRef50_A0A1Y1UCH2 Putative MFS transporter n=1 Tax=Kockovaella imperatae TaxID=4999 RepID=A0A1Y1UCH2_9TREE  ali  18  2....................................................................TTVQPAHVTNPGEDIKREEEIDMTDDLRLKHDNHATAILPEELQGMSQAELD-----AEEKKMVRKMDMIILPIIMTLYILNYIDRQNLAASKLQGIMEDLKMSTQDFATAISILYVGYLPFQLPSNYIISRVRPGLYICCAVMLWGTISACTAAASSYSALLGIRVLLGASEAVFFPGALYYLSAWYTKKELGKRYAALFIGQQLGNGFGGLVAAGILK-LAGKHGLAAWQWLFIVEGSITVGLGGIFACFMPEYPHNAKI--LSPTQRALAVWRLEQEAG-AAEGREDMSTTRAFLSALTDPKVY--CLIFCMMMSQAMGTVGNFFPTILNSFGFNSIITLCITCPPYIFACFVFYAMSYYSDKHGKXXXXXXXXXXXXXXXXXXXXXXXNVGARYFAIMWTPVSNVVPQLFIYNTLSLHVARPYPKRAAGLALINAIGGTSNIWGSYVWYRP---PHFYAGFGMVLAVNILFMCVITGYKIYVTRENKKLDAGGARAESA...................... 491
283 0.000e+00UniRef50_B8MF69 Allantoate permease, putative n=21 Tax=leotiomyceta TaxID=716546 RepID=B8MF69_TALSN  ali  25  2.............................................................................SGNPHKPRAGQQQRHPASSTPESVASSEITLTRWQKIESIIWDGGYRTPQERALVRRLDIFIMSWATIGYFVRLLDWANVTNAYVSGMKEDLHFTGADYNLLSTFFIIGYVIGQVPSQMVLTRVRPSYWLPTCELLWSIVTFCFAAVQNVRDVFALRIIMGFLEAPFAVGVLTIMGSWYTPRELSKRIAIFYSACYAASMFSGYLQAGIYNGMDNHLGLAGWRWLFIFCGVISLPFSIYGYIAIPDNPYNSKAFWMSAHQLEFARKRMEACDRRPPVL----LTWAKMRRIVTHWPLYAFTAI-MICQCLVTQPLNYFAVWLKSLHRFSVYQVNVIPTAGQAVGLITTLTYSWLADAWGERWKXXXXXXXXXXXXXXXXXXXXXXXATLFG-YLLNGASWGFWPICFAWTNEVCASDPEERAIVIGVAQTMGQAFVAWVPILILNTSYAPKFTMGWSILTGISVCQLAMVFVIRWLVMRDKRRTQQGDVGGFSDDHRGTDVE.............. 500
284 0.000e+00UniRef50_P53322 High-affinity nicotinic acid transporter n=36 Tax=Saccharomycetaceae TaxID=4893 RepID=TNA1_YEAST  ali  17  15.............................................................DDVLFISPTNDGSEEKPTEVTFQEDEGHDASLHNRSHDKKSELATEREIMATTTDDDGIPSPSHPMEKRVLRKMDIYLIPLMGMLYFLSNLDKSNIGNAEVAGLSKDIHLVGTQYNTCVTVFFATYVLFDPIGTNLLKIMGPPLMMSICLTCFGAISLGTAWVKNYAQLIVVRLLLGAFEGMIYPAINMYLSVCYRREQYALRFAFVFSAACLSSSFGGLIAYGCSKI---SGSLKDWQYIYIVEGCISLGFVPFYAFGLSKNLEDS--WFFNKEEKEYISERYKTMNTFDPD---EKFEWFQVWQAVKDVKTWASAVA-LFGIDLTTFGLTVFLPIIITSMGFTNVRAQXXXXXXXXXXXXXXXXXXXXSDRIKLRSPFILGACLTTSIGIAIVLGSQVHGVRYFGVYILCMGIYVNAACNCLWLSGNT-GNYFKRATALGINLFFGSGSG-LVSGQIFVAKDKPRYIKGLSISLAFQVFSIFMTVVQIFLYKRENDKKKAIIDRCNELGEPIPYDERLSDKNP....... 528
285 0.000e+00UniRef50_B6QN72 MFS transporter, putative n=2 Tax=Talaromyces marneffei TaxID=37727 RepID=B6QN72_TALMQ  ali  16  2....................................................................ETDIENVGADKSLDSNTKFYADDPIKSMITEDLSEVIAPHPSYEGLHRFDPRATWTAKEERVVVWKTDLFFMSWICVMFLGLQLDRGNLSNALTDNFLVDLNLTTNDYNNGTTIQLICFLTAEFPVQLIIKRYGFRIVLPTMMIVWSMVSWAQAFMTSRASFYVTRALIGAFEGGFIPGTILFATYFYKAHELSVRLAFFWSTLNIARVISSLLAAGILQ-MRGVHGRTGWFYLFLIEGLLTLGIGIISLLYLPQSPTHTKSIWYTERQEVIMINRLLRDDPSKGLTKSEPATLKDVRNALSDRSMWGLYFIGLIAYIPQGPVQGYLSLTL-RRIGFSTFDSNMLSIPSAVLQIILMLLLAKSSERFDERTFHCFIGEFWSXXXXXXXXXXHGHNWGRFTITTMISGYPYFHPIVAAWISENT-FDVKKRAITTAAYNVIVQ-IGSVISSQIYRSNDSPYYYTGNKVLISICALSLVTFIVQREYLRHLNRQKERWSSMSEEEKQNDQAARELDGNKRLDFK... 531
286 0.000e+00UniRef50_W4K7W2 Major facilitator superfamily (Fragment) n=1 Tax=Heterobasidion irregulare TC 32-1 TaxID=747525 RepID=W4K7W2_9HOMO  ali  21  2...........................................................................................................................................................NIGNARIAGLQRDLKMTNHQFSTALTVTYVPYILMEIPMNLLMKRIGANITLPTMVILWGIVCACQGAVKTYGGLIACRFFLGAMEGGIFPGIVLYLSSFYKRHVLQTRFSLMFSVTSLAGAFSGLLAAAI-QNMDGIKGLAGWAWIFILEGACTTAFGLISMFFIPATPAD--MPWLTSDEKTIYLRELAEDWSG--DDETDIFSWSEVWSVFVDPHILLLCL-PMFLNGVMLFGLANFIPTIVNALGFSPTHSQLLAAPPYACSFVLSVMCSYFADRYRQRGPMCICVNLIAAAGYAIFLGTSNKHANYAALFLQIVGVYSTAPCIGTWSSNNVQ-PHYRRATAIGLNFICTNIGGTPLCAITFPQVQTPRY................................................................ 376
287 0.000e+00UniRef50_E4V6V7 Pantothenate transporter liz1 n=1 Tax=Arthroderma gypseum (strain ATCC MYA-4604 / CBS 118893) TaxID=535722 RepID=E4V6V7_ARTGP  ali  18  2..........................................................................................EKQQEPAQVEVLAVDAERGASPGSDPSPDAIYVDPELERRVVRKLDTRLLGLVSVLAVLAYLDRANIGNARIAGMDVDLQLYGDRFDWLSTVFFIPFVIFHF-QVVMWKRFRHDYMLVFTVFLWGLTSTLHGVARNWEGVMALRFFLGIAEAIFSTGTLYFFSFYYRREEIGLRCAIYLSSAPLSSSFSGALAYAITS---GTYKIASWRVLFLVEGIPSILMAPLALYLIPPSPD--KANFFTPEEKEVAVARLK--GQVGHVERVGSIDWNELGATILDINVWFPTVI-TFSAACCWGSLPIFLPTIIKSMGFSAVTAQGLTAPPYLVAALITIVLSWYSDRYQQRXXXXXXXXXXXXXXXXXXXXXESTWVCYLGVFLAAAGLFSGSACLSPWIMNNQ-GTDSRRGFTVAIMGVIG-MSGSIPGSRLYPLTDGPRYVKGNAVCAGVMFFQFLLAVVFRWLLVRQNRKLDKLYGTLEEQKLR----SNLGENERV...... 483
288 0.000e+00UniRef50_A0A094IBX7 Uncharacterized protein n=1 Tax=Pseudogymnoascus sp. VKM F-4519 (FW-2642) TaxID=1420914 RepID=A0A094IBX7_9PEZI  ali  19 1521...............................................................................................PVEKDGRDGSINHVEDGKMEAKAEFDVAATAAEKKLVRKIDMRIMPATALIYLLCYLDRSNIGNAKILNLLSSINMTTYEYTVALMVFLVAYSLFEAPSNLAMKIFSPPRWLGFLVFAFGALCAGIAGSRSVATITVLRFFLGAAEAGVFPGMIFYLSFWYRPHERATRIAGFLCSATLAGAFGGAIAYGV-GHMNLVGGLEAWRWLFIIEGAPSIICGIFIFFFLPQYPETVT--WLNAEEKLLQDARM----GANCSKGEEKLNWADAKATLKDLRLWVHYVTYM-ALGVGVSSLSLFSPTIVAGLGYVDLQAQLFTVPPYACAYVVTFAVAMYSDYKKTRGXXXXXXXXXXXXXXXXXXXXDAYKARYAFLVLSTCGVFGGLPPLCAWVSDNVRSTTAG-SLASGLNIAFTG-PGQIIGVWIYRVQDKPAYRLGHAINAGFLVLGGVLSFGLHIYYRRLNNKM................................ 1984
289 0.000e+00UniRef50_A0A151GA74 Gamma-glutamyltranspeptidase n=3 Tax=Ophiocordycipitaceae TaxID=474942 RepID=A0A151GA74_9HYPO  ali  18  3...................................................................RTERSCSDAGQPVDARSCRGATPTDVLEEKGVGAAAVSVSRVHANPRRAVVPDGERAKALEKRVLRKMDVRLIPTLALLYLLSFLDRGNIGNAKIEGLQEDLNMTSDQYNWCLTVFFFTYAAFEVPSNLLLRRLRPSRWLPLIMVSWGLVMTLMGIVRSYRGLLVARLFLGVTEAGLFPGVAYYLTMWYCRHEIQLRQALFFSAASIAGAFSGLLAFAI-GKMHGVGGLEGWRXXXXXXXXXXXXXXXXXXXXXYDFPDTA--PFLTEEEREFVLHRLKYQGQTVGTTEADEFRWTYVRQAFCDWQIWVNIFVY-WGVVCPLYGVSLFLPSIIKSLHYKASTAQLMTVPIYITAALFAVLFAYCSDRVGKRSPFIIGLMVVMMAGFAMCISSTSPRVVYGXXXXXXXXXXXXXXXXXXXXCNNLSGS-YKRGAGMAIQIGVGNLGGA-MASNFYRQKDIPRYFLGHXXXXXXXXXXXXXXXXXXXXXXXXXKKRRQAVQAGSHHGLTAEELSKQGDK......... 530
290 0.000e+00UniRef50_A0A179GZS2 MFS nicotinic acid transporter Tna1 n=1 Tax=Purpureocillium lilacinum TaxID=33203 RepID=A0A179GZS2_9HYPO  ali  17  8..............................................................................SSEKVGIHQVADTGATQTPEKQGSMTDVPLSHVKGLGAQARSPEENKELEKRVLWKMDIRLIPMLALLYLLSFLDRGNIGNAKIEGLQEDLNMQPAQYNWCLTVFFFTYAAFEVPSNLLLKRLRPSXXXXXXXXXXXXXXXXXXXXKSYHGLLVARLFLGVTEAGLFPGVAYYLTLWYCRHEIQLRQAMFFSAASIAGAFSGLLAFGISK-MDGVGGLEGWRXXXXXXXXXXXXXXXXXXXXXYDFPDTA--PFLTEEERDFVVRRLRYQGQTPVTGEADEFQWKYVRQAFADWQIWVNIFVY-WGIVCPLYGISLFLPTIIKNLGYKSSXXXXXXXXXXXXXXXXXXXXXXXSDRVGKRSPFMITLMCIMAVGFAMCISSSNPKVVYGGVFIAACAIYPAFPGVITWLSNNLSGS-YKRSAGMAIQIGVGNLGGA-MASNFYRQPDSPRYFLGHGLELGFIALGITAALVLLVSYRAINSKRQRRLAAGEHHSMTPEELSEQGDK......... 524
291 0.000e+00UniRef50_J3NZI3 Uncharacterized protein n=69 Tax=Dikarya TaxID=451864 RepID=J3NZI3_GAGT3  ali  17  37......................................................................................................EVLPPHETYEGRHRFDPAATWTRQEERRVVRKTDAYLLSWLCVMFFGLQLDRGNLSNALADKILPDLGLTTDDYNNGTTIQIVCFLAAEFPVQVLAKRYGFKYILPSLMMAWGTVSWGQAWIHDRTSFYVTRAFIGLCEGGFIPATILYATYFYTSKELAVRLATFWSTLNVARFVSALLAAGILQ-MRGVGGWPGWFWLFLLEGLLTCIIALISFFYLPTSPTGTKGGWYTEREEVIMVNRILRDDPAKGTSLKEPVTVKDVLDAWRDPSVWGLYLIGLIAYIPASPVQAYLTYSL-NQLGYTPFASNMLTIPSAVLQIFTMLALAFSSDYFNERTLHCIIGEGWLLPLLAGMLAIPDRPWERFSLVTLVAGYPYFHPIVSAWISENT-FDVKKRAVTAATYNVVVQ-VGSIISSQIYRSWDVPYYNTGNKVLISICAASLVTFVAQRQILCHLNKKKEKWSAMSHQERLAYQNDHTAREKEGNKRLDFR 532
292 0.000e+00UniRef50_Q5KBM4 Nicotinamide mononucleotide permease, putative n=50 Tax=Dikarya TaxID=451864 RepID=Q5KBM4_CRYNJ  ali  21  8...................................................................................SQEHLDRVISEKDKLDDGVDRHLAVKIPESLVGLSPEEVN--AIDRKATLKLDLLLMPVLMALYILNYLDRQNISSAKIAGIMDDLGLTTTQYNTCVAVLFAGYVSLQIFSNIFASKINPGVYICVMCAIWGVISGCTGAVQSYAGLAVCRVVLGFAESAFFPGAVYLNSCFYTKKQMALRTAILYSGSQIGNAFGGLFALAIL-NLDGAHGLEGWRXXXXXXXXXXXXXXXXXXXXXPNKPGTMK--WLSQQERDRLTYRLEVDRSSK-DATDEVTVWTAFKMASCDPKTWLLCAVLYCNYIAA--SVTNFFPVVVSGLGFNRTVTLAITCPPYVLCCFSILIIGWHSDKKNERTLHIICPFFITIIANILAISTTKIAPRYVAMCLLPSSFYGATCCVLSWISSSITGPAVKRAIAIAIINAVCNTPNIWTSYLYY---DAPRYVAAFGVDLAASVLTIAFAALTYLYLRRQNSKIERGE............................ 479
293 0.000e+00UniRef50_A0A0F7SD67 Uncharacterized protein n=14 Tax=Ustilaginomycotina TaxID=452284 RepID=A0A0F7SD67_9BASI  ali  19  13.......................................................................................SAPSYNPQQDTQDAHSINEIPLTAAPVAALDPNSEEYKQLEKRLVRKIDIRLMPILVLLYVLNHLDRNSITTARDNGLVRDLKLKDQEYQTAISILFVGYITFQIPSNMLMTKLRPSLYIPTFVALWGIVSACTAATAGYHSLLAVRICLGFVESAFFPGALALLGYFYKKEEMATRTAILFSGSIISNAFSGLISAGILGGMEGKAGLPAWKXXXXXXXXXXXXXXXXXXXXLPDMPGNSK--FLTGEEMQMAVNRLSVNAGTTLSPNDEEGTMQGFVMAAKDIKVWVLAFM--LTAVTVGVGFNQFFPTIVGSLGYSHTVTLLLTAPIWFFAFLACLFNGLHSDRVQERXXXXXXXXXXXXXXXXXXXXXXXXGARFFALF-IEASSYASYTCVLGWIAPSIPTPKYKKAIALALINAFSQ-LGNISASYVWPKKWGSKYWQSNTISSAMFVACIVLVLLHRTMLKMENNELDRIKSQLLSGGRVGSEKEEDEAKVTVDPES.. 512
294 0.000e+00UniRef50_V2XWV1 Pantothenate transporter liz1 n=4 Tax=Dikarya TaxID=451864 RepID=V2XWV1_MONRO  ali  28  2............................................................................................APSVGKVAEAPQNWTLWQKFKTYIWDADAHLKTPFERKLMRKLDFGILVVACLGFFMRYLDAANLANAYVSGMKEDLNITGNEYTYMGTCYTIAYAIFQIPGTLIVTRVRPSIYLFICEIGWGAFTFAQAGAKNSNQMYAFRFCVGAFEASFFPSILYLMGSWYNKHELAKRSAIFHLCGSLGSSFGGYLQAAVYTTLNGAHGIPGWRWLYIVCGCMTIPCGVALLFILPDLPSNTRAWYLTKEEKGYALER--AIGLGKAQPGEKRLNLDLIKRMLCSWRWYGLVLGYTI-YGTSCQATGFFGIWMKAA-GYSVVDRNVIPSCQNLISAFCIFLWGFGSDLTGSRFAFVFGPLAYGLIPNGILAFWPGSRELKLFAF-MTGGVQLMTAVFYSWANELLADDNDLRALTISSMNGFQYSVSAWLPIIIFPQTMAPDFRRGFPXXXXXXXXXXXXXXXXXXXXDRDARRATLLDEKASVPGDKDSQDSKTEDVERLSKK... 494
295 0.000e+00UniRef50_A0A1F5LH23 Uncharacterized protein n=1 Tax=Penicillium arizonense TaxID=1835702 RepID=A0A1F5LH23_9EURO  ali  19  364............................................................SGDRLVGSVGGLTVPSTTSQVMMDVEKPSTPLEMEKVKMSDIEYERAELANLSDPDAGKNDEERRQIDKKLMWKVDMALIPWLSLLYLLSFLDRTNIGNARLAGLENDLGMVKGDYNNNLTIFFVAYAVMEPATNALLKMITPRXXXXXXXXXXXXXXXXXXXXXNNAGLLAARFFLGVAEAGLFPGVNYYLSCWYKSSEIGIRSSXXXXXXXXXXXXX-XXXXXXXEKMDGLGGKDGWAWIFILEGLATVVAGCFCWWLVFDWPETAR--FLSADDRIRVQRRLIMDRQGRTAEDSDK---RHMYAALKDWKTYGYMFIYMGCL-TPLYAFSLFLPTIIAGMGHQGTKAQLLSVPPYAVAAALTVCVGFYADRTRQRGLCNIATVLLAIVGFAMLIASSNPTVQYAAVFLGAAGIYPTIPNTLSWLNNNTEGSL-KRAFVLGVVVGWGNLNG-VVSSNIYLAQQKPRYYTGHGVILGFTVFLLGGSIWMHLGLRKMNKDRRAGKLDEKWNALTNDQKWIQGDLRP....... 882
296 0.000e+00UniRef50_R8B9E0 Putative high-affinity nicotinic acid protein n=8 Tax=leotiomyceta TaxID=716546 RepID=R8B9E0_TOGMI  ali  19  1....................................................................MAAIRISTSKDRETGNDSSSDPEKQLGTTYVVGDTPAASAPEYVEFMRLKEHFESDPKAHRRLIRLLDFRILPFLFLYYLLNSLDKSNAGNVKIYTFLQDAHMTSHQFNLALTWYFFTYAGLEAPSNMLMRKYGPRYWLSGLVICWGAVTLGSAWVKSYGDYCAARIMLGFFEAGLFQGCFYTLSCWYLPSELQTRCAWWYSATMLSGAFGGLLAYAV-GPLQGHLGLKQWQYLFIIEGSLTMFFGILGLWLCPDFPEKWGSRWFKSDEMKYLQLRVKYKDGPIPPDDT--FRWSAFWEAVKDWKTYFIASLLAFGGSVPTYSVNYTLATMVKNLGYSSIRAQALTAPPYVFAFICVILIARYSDKYQCRARXXXXXXXXXXXXXXXXXXXSMAGVSYFALFLVVAGYNMQAPAVGSWLGTNVRNPA-KRAAAMGWQSTFGQLAGGCIGANIFVDNEAPTYKXXXXXXXXXXXXXXXXXXXXXXYCLRANKKKDAIPLEELEGKYSEEELAKMGEYSP....... 519
297 0.000e+00UniRef50_A0A0U5G2M2 Uncharacterized protein n=42 Tax=leotiomyceta TaxID=716546 RepID=A0A0U5G2M2_9EURO  ali  20  8.....................................................................................................EADLDSKRRSSQSEQIQELSLEEAEAEKRLIRKIDKRLLVPTAIIYLLCYLDRSNIGNARIMNLMDTNNITNHNYTIAMMLFLVAYSIFEAPSNLALKRFQPHRWLGFLVVAFGAFCTGIGFTHTYAELAVLRFLLGAAEAGVFPGMIFYFTFWYKPGERAIRIAIFLCSATLSGAFGGAIAYGV-GRLNGRQGLEGWRXXXXXXXXXXXXXXXXXXXXXPSYPE--KAGWLTPEEKELSARRL----GAHRSAGSDKLSWEDAKATLTDLRMYMHYLTY-LTVGTGVASLGYFAPTIIEGLGYSDLRAQLFTVPPYGIAYPVTLLLAWLSDRLKTRGLIATCSSGAACIAFIIQACLPADTARYAFLCISTIGVFGGLPSLNAWVGDNVRNTTAA-SLTIALNIAFSG-PGQIIGVWIYRAQDKPAYRLGHGVNAAMSFCSACLALGLTVYYRRLNRKMK............................... 466
298 0.000e+00UniRef50_UPI000455F554 MFS general substrate transporter n=1 Tax=Coniophora puteana (strain RWD-64-598) TaxID=741705 RepID=UPI000455F554  ali  18  22.............................................................................................................................ALERIAWRKMDRWVLPICTVFYLLSFLDRSNVANARVAGLQRGLNMSNTQYSIALTVTYVPYIIAEFPSNILLKRVGPNIMLPSMVAIWGVVTTLQGTVTTYGGLLACRFFLGLVEGDTFPGLVLYLSFFYPRDRLQIRVSTFFASASLAGAFSGLLAAAIIK-MDGIGGRPGWAWIFILEGLFTFL--------------------------------LKQDGAIAVDEEHDGFGWNDVVKSFKSPHV-LLVAAAFFFNGTTLYGLAYFEPSIVAGFGYSGARAQLMSVPPFCCSLPVSLISAVLSDRYHCRGLVATMFSLLCLIGLAMFLGFKSNDVRYGSLFLSVPGTYCVAPALSTWMANNSA-PYVRRATSIAIGFIMTNSGGILATWLLGSLSPAPDYRKATTTFVIMSALMAILSALNIVYLSRQNRTKAEKRRIFTLEQDEDHAGDR............. 459
299 0.000e+00UniRef50_A0A165EZ62 MFS general substrate transporter n=2 Tax=Agaricomycetes incertae sedis TaxID=355688 RepID=A0A165EZ62_EXIGL  ali  21  2..................................................................................................AEDRKESVEMREEIASPAELGEYVPGSPEERALLRKIDLRVFPAVWIMYLMNYLDRSNIGNARVAGMEDDLSLTDNRYSIALLIFFVGYLLGEVPSNMILSRSRPSXXXXXXXXXXXXXXXXXXXXQSYHGLIVARFFLGCIESGFFPGVMFFLSSWYRKAELAKRMAWFYSASMTSGAFGGLLAGGITEGLSNAHGIASWRWLFIIEGCMTVAVSIGCMFLLPDWPANTR--WLTPAEQRLATLRIQADHIGSG-GQRDLSHMEAFKAAVFEWRT--YMFMFMYMMIVGAGTISYFIPTITTFLGYTGHTAQFMTVPIYAVALVFSLAISTSADYFNERPLHAGIPALIAALCFIIEASIMNNAARXXXXXXXXXXXXXXXXXXXXXXXXXXSYPHEKRAISQAIVNMFAN-LSSVYGSFLWPSDTAPRYAMGWATTAAMCFACGVSTILMGWLDKR..................................... 453
300 0.000e+00UniRef50_A0A0D2A7A4 Uncharacterized protein n=1 Tax=Exophiala oligosperma TaxID=215243 RepID=A0A0D2A7A4_9EURO  ali  20  37.............................................................................................................................KLEKQVVRRLDIVVMPTVIVLYLLAYIDRANIGNARLAGLQKDLHMTDLQYKTAVTVTYIPLMLVDIPTNLLLKKIGAGKMLPILSITWGLITLLQSQVTSFGGLVTVRFFLGLVEGGLFPGMLLYLSSFYCRAELQVRXXXXXXXXXXXXXXX-XXXXXXXQQMDGLRGLRGWQWIFLLEGLLTICCGMVGIFVLPSTP--SKVLTFKKEHVDYCHHRLELD---SNLFDKEHITVKAVLSIFKDSNF-LIALPFYFASGSLGLGLSVFLPTIVAALGYSSTNTQLLTVPPYTMAFIAAVITSFISDRYRQRGLSAFTAGLVALAGGVILYCGRGFGVRYTGTCLLVIGTYTFAPCTLAWLPNNIAG-HARRATALATLAML-TSAGGLASTWIYPTSSAPYFAFAARFNIALICIMDTCVLLLLLRLRSQNRRKEEKPSELLRGLEEEEQFVVLGDHHP....... 491
301 0.000e+00UniRef50_A0A1Q3ELM4 MFS general substrate transporter n=3 Tax=Agaricales TaxID=5338 RepID=A0A1Q3ELM4_LENED  ali  19  5........................................................................................................................................................DRGNLANARLKGLQTDLNLNDTQYATCISVLFAGYILMQVPSTLIMNAIPPRLFMATVVGLWGIISALTSLCDNFSDLVVCRFFLGFVEAAFYPSAVYYLSRWYTRKEVGFRIAFLNAGNMLAQGLGGLFAAGILGGMENVKGIRGWRWLYIIEGSITVAFGLLLPFILADYPSSTN--WLSDRERVIAQGRLVTDVGIIDNPENDEKSMRGVLMTISDIKVWALAFMYF--TYIMGLSFASYMPTITATLGFSTTITLLLTFPPWAFATVYALANSWHSDRTGDKFWHIAGAYGFAILGYIVALTANTVSGKYVSLFGMCMG-YSGGIIILGWISTSIPRPPIKRAASIAFINAFAN-IGQIPTSYLWPTRWGKRYWQSFTTEICLMALSLTIAFAYRQYLISQNEKLDRGEAEAYITDEEIVKQSAD............ 448
302 0.000e+00UniRef50_A0A167S3N2 Major facilitator superfamily domain, general substrate transporter n=9 Tax=leotiomyceta TaxID=716546 RepID=A0A167S3N2_9PEZI  ali  21  23.....................................................................................................................SWSPEERQAREKKLKRKIDFRLLPILMVMYVLNYVDRNAVPAARVQGLEKDLGLKGNQYNVVLSITFVGYISMQIPSNMLLSFLRPSWYLSGVMIVWGLVSGCTAAVQGYSGLVVTRFFLGVAEAPFFAGVAFLFSGWYTRKEIGFRLGVFYCAAMLSGAFGGLFAAGIAAAFKHNR-IESWRXXXXXXXXXXXXXXXXXXXXXXDWPTTTK--WLTPEERALGVVRLLEDAG---EEEEDIGTRAAAKLAIKDYRVWLCIVNQLCMQAVA--SLTNFLPTLVANFGFNTINTLLLTAPPYIGTALFCLFNTWWSDRTHRRSDXXXXXXXXXXXXXXXXXXXXKTAPRYFAIFLMLPGLYGGFQVSNAWMANIASRPLRKRGIGLAMNNAFGN-LALVWTPYLYPSSAGPRYLTAWIVNLVLTVVCIASTALLSW......................................... 448
303 0.000e+00UniRef50_A0A2U3ELY9 5`-nucleotidase n=2 Tax=Purpureocillium lilacinum TaxID=33203 RepID=A0A2U3ELY9_9HYPO  ali  18  4..................................................................................RGATHGDNVDQEKQAIEYAHVDAAKDNVDNEVGKVNTHDEFTPQEQRKIIRRIDRRLVVTVGAMYCVSLMDRTNMSAANIAGMSVELDLHGYRYNIANLVFFIPYIIFQPPSTVLVRKLGPRVHLAGITLFWGAVMIGMGFVKDFGQLAGLRVILGLLEAGFFPSCVYLLSTWYTRYEVGKRYSLFYLLGCVASAFSGILAYGLMQ-LNGRENLTGWRWIFIIEGVLTCALAIGCYWLLVDFPDSTSWSFLGQRERQWVVDRIQRDRG---DSKVPPFNMRKFLGGGADWKIWAYAMI-FLNTTTMSYALAYTLPLILGNMGFSVGESQCLVAPPYAFAGIVMFLTGYYGDKFRFRXXXXXXXXXXXXXXXXXXXXHKDAAVRYFGVFLVTAGANSNIPATMAYQANNVRGQ-WKRAFCSATLVGFGGIGGI-VGSLVFREQDKTGYKPGMYTCIACSLLSIILVIVCDLDFRRLNRLADQGQKTLESHDED................... 492
304 0.000e+00UniRef50_A0A0F9XKG9 Uncharacterized protein n=1 Tax=Trichoderma harzianum TaxID=5544 RepID=A0A0F9XKG9_TRIHA  ali  20  13....................................................................................................DEDVEATKEHLSDIRDGSSLAHIDAARSRDLVRKQDLRIIPITAGIYLLCYLDRSNIGNAKVLNLLTETHMTTYQYTIALMVFLIAYAIFEVPSNYFLKKLKPSRWIAFLMFSWGTITMCIAATQNHSSVTAVRFLLGVVEAGLFPGLVYYLTFWYRVDERSIRXXXXXXXXXXXXXXX-XXXXXXXGHMNQVSGISAWRWLFIIEGAPSVASSLLVWFFLPDYPETVS--WLSTEEKDFAALRLSDQG---SHGSGKPLTWEEAKSTLFEWRLWAHYFIY-FGISTPFSSLSLFTPSIVAGLGFTDLKAQLMTVPPYAAAYVVTLLASWSGDHFNKRALHSAGFSLLGAVGFIASATLPHFASRYGCLIIATCGSFACIPPLLGWLSSNLYSTA---AIGLAILNISMGAPGQIVGVWIYKADEAKKYPTGHWTNAGLLLFVSASCVGMHCYY....................................... 466
305 0.000e+00UniRef50_V5FVY3 MFS transporter, putative n=1 Tax=Byssochlamys spectabilis (strain No. 5 / NBRC 109023) TaxID=1356009 RepID=V5FVY3_BYSSN  ali  19  479...VLEELRVEALRQVKPVHISTGNLEVLNTEPRQNCCQIMPTDVEQTRPLISKYSDFPRQSEVDSGTNSPGFSFSDFSIW