current user: public

If you have questions about the server, please let us know.

Query: gi|6319253|ref|NP_009336.1| Fungal-specific protein of unknown function; Yal064w-bp (YAL064W-B) [Saccharomyces cerevisiae], from S.cerevisiae

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# E-value Template Links and tools%idFirst MAGEAVSEHTPDSQEVTVTSVVCCLDSVVEIGHHVVYSVVTPLIVAVLIDTMAGEAVLEHTSDSQEEIVTTVVCSVVPLVCFVVSVVCFVISVVEIGHHVVYSVVAPLTVTVAVETIAEEMDSVHTLast
1 2.000e-24UniRef50_O13512 Uncharacterized membrane protein YAL064W-B n=6 Tax=Saccharomyces cerevisiae TaxID=4932 RepID=YA64B_YEAST  ali  100  1MAGEAVSEHTPDSQEVTVTSVVCCLDSVVEIGHHVVYSVVTPLIVAVLIDTMAGEAVLEHTSDSQEEIVTTVVCSVVPLVCFVVSVVCFVISVVEIGHHVVYSVVAPLTVTVAVETIAEEMDSVHT 126
2 5.000e-16UniRef50_A0A1E3NYZ7 Uncharacterized protein (Fragment) n=1 Tax=Wickerhamomyces anomalus NRRL Y-366-8 TaxID=683960 RepID=A0A1E3NYZ7_WICAO  ali  45  1...EWVEKHEVASQELNVTNVVCYSDSVAVNGHQVVYSVTIPTEVVVAMETKAGE-VVSLQSVCEQEVTVTIVVSFKTLPVLETEVAIEELSVAVSGHHVVYSVTTPTEVVVAIETRAGEVE.... 128
3 4.000e-12UniRef50_G2W8H0 K7_09977p n=1 Tax=Saccharomyces cerevisiae (strain Kyokai no. 7 / NBRC 101557) TaxID=721032 RepID=G2W8H0_YEASK  ali  98  1MAGEAVSEHTPDSQEVTVTSVVCCLDSVVEIGHHVVYSVVTPLIVAVLVDTMAGEAVLEHTSDSQEEI.......................................................... 68

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 2   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35