current user: public

If you have questions about the server, please let us know.

Query: gi|6319258|ref|NP_009341.1| NAD-dependent (R,R)-butanediol dehydrogenase, catalyzes oxidation of (R,R)-2,3-butanediol to (3R)-acetoin, oxidation of meso-butanediol to (3S)-acetoin, and reduction of acetoin; enhances use of 2,3-butanediol as an aerobic carbon source; Bdh1p (YAL060W) [Saccharomyces cerevisiae], from S.cerevisiae

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380
# E-value Template Links and tools%idFirst MRALAYFKKGDIHFTNDIPRPEIQTDDEVIIDVSWCGICGSDLHEYLDGPIFMPKDGECHKLSNAALPLAMGHEMSGIVSKVGPKVTKVKVGDHVVVDAASSCADLHCWPHSKFYNSKPCDACQRGSENLCTHAGFVGLGVISGGFAEQVVVSQHHIIPVPKEIPLDVAALVEPLSVTWHAVKISGFKKGSSALVLGAGPIGLCTILVLKGMGASKIVVSEIAERRIEMAKKLGVEVFNPSKHGHKSIEILRGLTKSHDGFDYSYDCSGIQVTFETSLKALTFKGTATNIAVWGPKPVPFQPMDVTLQEKVMTGSIGYVVEAFEEVVRAIHNGDIAMEDCKQLITGKQRIEDGWEKGFQELMDHKESNVKILLTPNNHGEMKLast
1 0.000e+00UniRef50_T1K2P0 Uncharacterized protein n=3 Tax=Tetranychus urticae TaxID=32264 RepID=T1K2P0_TETUR  ali  29  6...LIFVKPGELRLDEYHKDDE-PSETEVLIDVAACGICGSDLHWHLEGNIGPWYARKEAS---------MGHEASGTVIKVGSKVTHLKPGDRVCCEPCEPC--------------WTCDLCRIGSNNLCADSTCAGADKT-GFFRTTNVWPAILCHKLPDNMTLKEGALVEPFACCIWAIRRAKLEGNEKILITGSGPIGIICLMIVKAFGASKVCITDLNEERLSASKNFGADYTLLVQTPQQIAEKVNQIMGGP--PDVAIDCTGVGSCINTGIIGVRRGGKVLLQGL-GSKGVNVDLSTASLRQVDLLGVARYN-NTFPAAIDLISSGRV---NAKGLVSHIVSLGD-YQQAFDLLKKGKG--MKILLAP....... 347
2 0.000e+00UniRef50_A0A0J1G4N2 Uncharacterized protein n=8 Tax=Lachnospiraceae TaxID=186803 RepID=A0A0J1G4N2_9FIRM  ali  30  1MKAYVYTAPFTIE-EQERPIP-VPDKNQVRIKVKAVSICGSDTGGFKG------------TSAMRQAPLVMGHEFSGVVDAYGEGVEHPAIGGRVVVYPNIPCGE--------------CPDCKAGLPNLCENRFIPGTGSYDGAMAEYVVVPADKLIELPDKISFEEGSMFEPTSVALRGAKMLKDVKGKTVTVFGAGPIGLLCVECLKYLGASEIISIDINSERLEVARECGASHTINSME-EDPVAKVMELT-GGNGAYAGMDAVGIAVSLNTSMKMVRNGGEVSMVGMGVERMDGFEYKYAVAHEMKLYGSYCYVDELYEIV-DLLMENKI---NLKALITSEVPMSEVQNKMME-LTSGKSKDVKVILK........ 345
3 0.000e+00UniRef50_M2Z164 Uncharacterized protein n=4 Tax=Mycosphaerellaceae TaxID=93133 RepID=M2Z164_PSEFD  ali  33  12.RSAQLYDAGDLRI-EKVPVPTIP-PKHVAIATKFCGICGSDLHFYHE-PAFAMSLKHPHPLTGCTAPIAFGHEFAGVVAEIGEGCSGLQVGDKVAAMATLTDG--------------TCTSCVEGHDNTCIRLGFVGINTKTGGMSEITVVAEDSLLKLPPSIDCDVGALIEPLAVAWHGVRLANLSPTSSALIIGAGPVGCAVLLSLKAQNLTKIAISDPSPEKRKFVSHLGASATYNPFESEINP----SSTLPRDSFDVVFDCAGVPTSFDTAIASIKPRRTVINLAI-QETPVSFNLMPMVLKEVGIKSSIAYTKRDYLDVISAIEGGRL---DARALITKRIKLEDVVEEGFLSLRRRGNVDCKVLVD........ 361
4 0.000e+00UniRef50_A0A2E9TA78 Uncharacterized protein n=16 Tax=Bacteria TaxID=2 RepID=A0A2E9TA78_9CHLR  ali  29  16MRALVYHGRNDIRL-EEIPVPEI-GPGEARIRVTNTSICATDIEEWKYGPTYITFT-----------PTVMGHEVAGRVVEIAPDASGLAVGDRVMVDNVIVCG--------------VCYWCRSGSQATCPNMEVAGL-GRDGGLAEFMTWPADHLIKLPDTVKDDEAPLIEPATVALHAVRRSGVRVGDQVAVIGIGTVGALTLQAFKAAGA-VVYAVDIRESSLQMAARLGADQVIDASRG-DAGDHLRDLTDG-IGPDIVVETAGAARTPLDAFDWVRRAGTVVLVGIYAVKP-EADFNVIVGKELRVIGSVAAGTGDMAAAVRLVAEREIR---LSELVSDRISLGRVIPDGFERMAAESKEVFRILVSPD...... 356
5 0.000e+00UniRef50_A0A085HMZ7 Zn-dependent dehydrogenase n=13 Tax=Bacteria TaxID=2 RepID=A0A085HMZ7_9GAMM  ali  30  1MKAIVYHGSNNVSL-DNVPVPEI-KAHEVLIKVHYAGICGSDLNIYVGAHP------------RAKAPLVPGHEFSGVIEE-GNG--HFPKGTKVTVRPLISCG--------------RCYACESGNSHVCATLKLYGIDT-DGGMAEYVKVPADVVHVLPDNMPMTIGAFVEPLAVGVHAVSRAKMQAGDSVVVFGAGTIGFCVASVAATCGAKQVIVVETNPFRLGLAKEAGF-IAINPAETG-VVDKVLELT-GGTGADVVFDCAAHPTVAAVLTKLVRVQGTIEIVGSY-KKPAEVALLDIEFKELTIVGTRVYVKRDFETAIKLIQAG----FPYERLIT-VYPPEKA-KEGFDICLNG-GNVIKVM.......... 329
6 0.000e+00UniRef50_A0A1M4TLE4 L-iditol 2-dehydrogenase n=2 Tax=Alkalibacter TaxID=274470 RepID=A0A1M4TLE4_9FIRM  ali  23  1MKAALLYGPEDLRI-EDVKTP-VCKKEEVLIRVHGVGLCGSDIRTIIHGH------------HRLEYPQILGHEIAGEIVEIGEGVKGFSPGERVYVSPLVPCYE--------------CPACKRGWLGQCENLTVPGT-TIPGGFAEYMIVTEDQVIKMPHDMSYEEAVMTEPLSSVFSCQEYANVTLGDTVVVIGMGPIGCLQLELAKLRGAKRVIAVEPSRIRLEKAREFGADFIIDPFE-VDPVKRVREIT-GGWGAEVVISANPSTKAQGQAIKMACKRGKVVFFGGVPKGEMTIDSNFVHYEQITILGHFGYDHMQNARSFDLIADKKIKAD---RYVTHVLPLEDAM-KGVEMAKS--GEAIKVVLKP....... 344
7 0.000e+00UniRef50_A0A2A4K6E5 Uncharacterized protein n=5 Tax=Obtectomera TaxID=104431 RepID=A0A2A4K6E5_HELVI  ali  26  1................................MDCVGICGSDVKFYTTG---------ACGMEAVSEPIIIGHEGAGVVVKVGSNVTSLAVGDRVSIEPTQPC--------------RACEYCKVGRYNLCVAPHYCSTVGASGNLCRYYKHVADFCHKMPDNLSMEEGAAVQPLAIAMHACNRAGIRLGQRVLILGAGPIGILCAMTARAMGASKILITDVVQSRLDTARELGADYALLVKRDYSDEEVVDGIAQLGCQPDVTIDACAYASVQRVAMLVTKTAGVVLVVGI-GDNKVELPLSQALLREVDVRGSFR-IVNTYPPAIAAVSTGAIP---LKKFITHHFPLEKTRE-ALELAKS--GNAMKIIIHVQS..... 315
8 0.000e+00UniRef50_A0A2N5XV05 Zn-dependent alcohol dehydrogenase n=2 Tax=Rhizobiales TaxID=356 RepID=A0A2N5XV05_9RHIZ  ali  27  1MRQAIMVEPGKIEFHNDIEAPK-PAANEILMKVSRIGVCGSDIHVNHGKHPFTP------------YPVIQGHEFCAEIVAVGTDVDQFPIGSLATALPQVTCG--------------KCEPCKRGDFNICDELKVRGFQ-APGVAQDYVTFPQDMVLVLPEGMSAEFGAFVEPLAVAVHAVSRAGDINGKDVLVTGAGTIGNVIAQVAKAKGA-NILISDISDYRLNKAKECGILHTVNPTT-EDIAEVVQK-TFGPSRFDLAFEVAGVESALDTTIQLVAKGGTVVAVAVYGGKP-RVDMSVLGDREIILKGTLMYKHADYREAIELISSGKIQ---LSSLITKHFSFDD-YSKAYEYIDADADMTMKTMIVM....... 341
9 0.000e+00UniRef50_A0A120MK93 Putative zinc-type alcohol dehydrogenase-like protein YjmD n=2 Tax=Lachnospiraceae TaxID=186803 RepID=A0A120MK93_CLOPR  ali  29  26MKSGIIEKVGVIKIKET-PMPKIEKANDVIIKVKYVGICGSDIHIYHGQNAF------------AKYPLVWGHEIVGHVHEVGSEVTSVKVGDRVVVEPFIACG--------------KCYSCKNGRRNACQELKVFGAH-IDGGCSEYFKVPESNAHILPDNVSLEDAVLIEPFTIGAQACYRGQVTKDDFVFVMGGGTIGLTVAENAKILGA-RVILSDIVDEKLDFAKKHGAEFTINAMK-ENVADRIFEIT-GGMGANVVIDSICNKKSFEDALTFVSNAGRVVELS-FNTTPSEIAPILLSKGEVSIMGS-RHQTNRFPVVIDYVRDEKIVFEN---FITAFYPLED-MEKAFKYIEQHLDKTRKVVIK........ 362
10 0.000e+00UniRef50_A0A2T7NFA1 Uncharacterized protein n=1 Tax=Pomacea canaliculata TaxID=400727 RepID=A0A2T7NFA1_POMCA  ali  24  8...AVVYGKRDLR-VESRAVPQA-GLGELQIKVRAVGICGSDVSLWKNAAI---------GQFPLKDPLVVGHEPCGTVAGVGPGVTGFAVGDFVAMNPNITCG--------------ACGACREGRQNLCDCGIIMATPPTNGSIANFIVWPSRLCYKLPPSVTPNEGAFIQPIALAVHGCQRAGIKPGHRVLICGAGPLGMAMAMVARVSGASKLCITDINEARLQFITKCSIVHV-QGEPPEDTAERVRKELAGF--ADVTLECSAAPTSIATAINATKSGGCVLIAGISPDAETRIPLRSAMTREVDVKGMFRF-ANEYETAVELISSRVI---DVRPLVTHTFQLEN-VTEAFEAAA--KGEGGKIVILCSKE.... 350
11 0.000e+00UniRef50_D4MW22 Sorbitol dehydrogenase n=176 Tax=Bacteria TaxID=2 RepID=D4MW22_ANAHA  ali  28  1MKAGVVHAKNDIRY-EEIEKPQ-PKKGQVLIKVKYTGICGSDV-------------PRVNGDACHFFPNVLGHEFSGTIEEVGEGVTTLKKGDRVAGVPLVPCME--------------CEDCQKGNYSLCKHYSFIG-SREFGSFAEYVTVPEKNAVKFEDEVSFEQGAFFEPATVALHGLNRVDYHAGECVAILGGGTIGLFTAQWAKIFGAKKVVVFDISPERLELAKKLGVDEGINTL-DEDFMNQAMAVTDGK-GFGYIYETAGVTTTMKYAFELAANKASVCFIG-TPTRELNFSWENINRKEFTLTGSWMFPGKEWILTAHYFKTGQLKFED--SLIFKKIPLSR-IDEAFEMYKTPGTVKGKILID........ 346
12 0.000e+00UniRef50_A0A1V5YD91 D-arabitol-phosphate dehydrogenase n=1 Tax=Firmicutes bacterium ADurb.Bin182 TaxID=1852884 RepID=A0A1V5YD91_9FIRM  ali  27  1............................MLIKVKAVSICGSDIGAYR----------LPSISKRWNPPLVLGHEFSGTIAAIGDGVKGRKIGQRVTANPILYCGN--------------CHYCNSGMINLCTHRNSLGTSPKDGAMQEYMLIRDSAIVPLDDNVTFEQGALLEPLAVTYCASKCGSTGRGERVCIIGAGPIGLMTVKFLKAFGASQIFASDILDDRLKKASEYGADEVINGR--ENVADTVLKLTNG-IGVDRVIICADAPDAVHNAFRMVRSGGNIVLVALM-HREITIDPMQIACRAVNILGSYMFT-HEMNTVMSMLAEKKLNTDG---IITSKFPFEKG-EEVFKLLASKECKDIKILLTMNE..... 320
13 0.000e+00UniRef50_A0A090E8J3 L-idonate 5-dehydrogenase, NAD-binding n=4 Tax=Rhizobiales TaxID=356 RepID=A0A090E8J3_9RHIZ  ali  29  1MRAVVLRRPLDLD-VEERATPE-PGPGEVLVRVTHGGICGSDLHYFRHGGF---------GTVRMKEPMILGHEIAGRVEALGAGVSGPAVGTAVAVNPANPCG--------------VCAFCRAGQPIHCLDMRFLGTPHVQGGFAEHLVCRAENAVPLPKGSDPTAGAFAEPLAVTLHAVAQAPVY-GSRVLIMGAGPIGTLLVLAARFAGAREIVVTDVQDRPLQYAAKVGADRTINVATQ---AETMDGYAANKGYFDVVFEAAGQGATVASALPVIKPRGTLVAVG--QGATAELSMSMIVTKEIQVKGSFRFDTE-FALAVDLIGSGRI---DVAPLLSNTLPLAEA-RKAFD-LASDKSQSMKVQIAFD...... 343
14 0.000e+00UniRef50_A0A202E210 L-threonine 3-dehydrogenase n=9 Tax=Bacteria TaxID=2 RepID=A0A202E210_9BACT  ali  25  1MKALVKKYPEEGLWMEDIPKPQIE-PTEVLIKIHKTAICGTDIHIYK---------WNEWSQKNVPTPMQIGHEFMGEIVEVGQAVKDLQVGQRVSGEGHLVCGH--------------CRNCSGGRRHLCSHTQGVGVNR-PGAFAEYLAIPESNVFIIPDGVSDEEASILDPLGNAVHTT-LSFDLVGEDVLITGAGPIGIMAGAIAKHAGARHVVITDVNPYRLQLANEIGIKHCINIKEHK--ITEVMKDLKMVEGFDVGLEMSGNNEALSDQLENMSHGGKIALLGLLP-PETKINWDHVIFKGLKIKGIYGREFETWYKMCAMIQSG----LNIKPIFTHRFPVDQ-FEEGFQAMSS--GNSGKVILE........ 339
15 0.000e+00UniRef50_A0A0F2SM49 Uncharacterized protein n=1 Tax=Peptococcaceae bacterium BRH_c23 TaxID=1629714 RepID=A0A0F2SM49_9FIRM  ali  25  1MRALVKYEKGIGKLMREVPVPS-PGPGEVLVKVEAVGICGTDLKI-------------RDDHFIYNPPVILGHEFSGAVAIVGEGVKQWKIGDRVVSEQHLACGH--------------CRYCLTGKRQFCLSKRSPGY-LIDGAFTEYIKVPASLLHRMPEGMSFEEAAVIEPMAVAAYGIGRCGIEPEDYVVILGCGPIALLALQLVVAEGASRVLLTGIDADRFPAAKGFGAYRTVNVMK-EDPVSIVMADT-GGMGADVVIDLSGAPKAIVQGFDLLRRDGRFCALGL-PTSDVPMPWAKVALKAVNLVFSYSSDFESWERCLSMIQLGKV---NLREFTSDIYSLE-SWEEAFDKAAS--GEALKVIIKP....... 343
16 0.000e+00UniRef50_B2A4W9 L-threonine 3-dehydrogenase n=2 Tax=Natranaerobius TaxID=375928 RepID=B2A4W9_NATTJ  ali  27  5MKALMKQDRSSGAVLEQVDIPK-PKSNEVLIKVESAAICGTDLHIY---------NWDQWADSRINPPLIFGHEFSGEVVELGADVKDIETGTRVTAEGHFVCG--------------KCFFCKTGQAHICENVEIIGVDTT-GCFAEYVVVPRDNVWILDKSIPPEIGAIHDPIGNAIHSALIDEITAKD-VLVTGCGPIGLASIAIARKAGASKIFATEVNSYRIELAKKMGADEIINPME-QDTVELVKSKTNG-AGVDVLLEMAGKDTAINEGLAALKGGGWVSFLGLPPGKT-QIDLNGLIFKGAKAYGINGRMYETWFKMHNLLKSRL--ADDLMPMVTHKFSFEQ-FEEAFQLAQE--GNTGKIILHP....... 347
17 0.000e+00UniRef50_A0A2I2FVZ6 GroES-like protein n=11 Tax=leotiomyceta TaxID=716546 RepID=A0A2I2FVZ6_9EURO  ali  38  11..ALRYYGQKDPRL-EQIPA-RACGPNEVRVKVAYCGICGSDIHEYLGGPIFPPKPGERHPWTGQSLPVTLGHEMSGVVVELGSAVTGLQAGSKVSVNPAL---------DDRHYGTEPCTTCQLGKRNICKRYASYGMSAEGGGFASEIVVNAINCIILPDSVSLRVGALLEPLAVAWHSIRLSGFQIKQT---------------------ARTIVVSEVTPSRKRMAVQFGADVVVDPSEKSNEDPVLSAIYNNVDGADVVFDATGLQVTLDTAIAAVRPGGTVFNVAVH-EKPLQLNLNDLVCFEKRLMGGICYTMEDFIGVLQALESGNAPAED---MITSIVSLNEVVEKGFLELINNKAAHVKILVDPAMNTELR 376
18 0.000e+00UniRef50_A0A0C2XGN1 Uncharacterized protein n=3 Tax=Agaricomycetes TaxID=155619 RepID=A0A0C2XGN1_AMAMU  ali  26  1....................................................................MILGHESAGVIASVGSAVRHLKVGDRVAVEPGASC--------------RVCELCKSGQYELCPYMAFAATPPYDGTLQRYYKVPADLAYALPEGLTLEEGAMMEPLSVAVHSVKLGSLRACESVIVFGCGPVGLLCMAVAKASGASRIIGVDIVSSRLDFAKQYAATDIFLPKEGETNLEELKQKLNGKDAIDLVVDASGAEVSIQTALYAIKTGGRIIQVG-FGKPDVTIDIGMLMTKEVKYQGSFRYGPGDYPLAISLVAQGRV---DLKPLITHRFTFENA-KVAFEATKTGKSEDGKGVIK........ 302
19 0.000e+00UniRef50_F2NAK8 Alcohol dehydrogenase GroES domain protein n=16 Tax=Terrabacteria group TaxID=1783272 RepID=F2NAK8_CORGP  ali  30  1MKALAITASKNMELV-DIEVPS-PGPDEVLIRVSYVGVCGSDLRYFEGG--------------VHQYPQVLGHEFSGVIERTGEGVCGLTPGTAVVVAPLVPCG--------------TCDQCQQGNPQLCENYSFIG-SRRPGAMAEYVTAPAKNCLKVPDALPLDIASTIEPLTVALHGMERVRIRPGARALILGAGTIGLMAVLALRALGIGEITVVDINESRLGVAREVGADRTINPARVD------LDDHFGRYGLEVVFETAGNHVTQVQAIRYADRCGKVVFIGTC-TQPIDFDPELILRRELELTGSWMFPGYVWNAALRYLATGEI---DTSALITSTWSLEDAAEP-FERMRAPGSSEVKVL.......... 340
20 0.000e+00UniRef50_A0A1F8Q4M4 Uncharacterized protein n=2 Tax=unclassified Chloroflexi (miscellaneous) TaxID=189774 RepID=A0A1F8Q4M4_9CHLR  ali  28  1MKAAVTRAIGNINM-EEVPDPE-TGPNQIKVKIAFCGLCGTD-------PENLEGRFGLMPPEAYKQARILGHEASGTIAAIGSDVKGFKVGQRVAMNFRGSCG--------------ACYYCQNGLEHYCRRG-----SGASGSFAEYAVYPESAVYPLSDDISLEIGSLLEPVSVAVHAIDQANVYTGSSVAICGGGPIGLLCLEMALKAGAARALLSEPIAEKRALARKLGADVVVDPFK-EDLLEAGKKLTDGR-GFNTVIDASGSVAAAKQAVYLADNKGTVLWAAVYGKDEIGVPPFLMYAKELTITSTFV-SPYSFPRALALL-----PRLELKPLITDIVSLKD-IQKAFEL--HKKGKSIKILIQP....... 338
21 0.000e+00UniRef50_UPI0004134048 hypothetical protein n=1 Tax=Ruminococcus gauvreauii TaxID=438033 RepID=UPI0004134048  ali  32  1MKALQYEGAKELRFIE-IPIPE-PKEDEVRIKVKAVAICGSDLNGYKG------------VNSLRVAPLIMGHEFSGEIDCCGEKVKKLKKGVRVTVNPTLYCGE--------------CENCIKANYNLCDKKTVPGTSNVPGAMAEYICVREKNVIPLLDSITFEEAAMLEPMGVSLHGVKRAGNLKNQKVAVIGAGPIGLMAIQCICNFQAEEIVCMDLIDRRLQASLECGAGRAINLKADALPEEK----------FDVVFDCVGNEKTITQAAQIVRNDGKIIVIGM-AASEIHFPIKKFVANEFKMYGSYQYL-DEMKEAMELLANKKI---DVKKMITSVLPLEKA-EDAFESLCSPETKEIKIVLKP....... 335
22 0.000e+00UniRef50_A0A2V8UAI4 Alcohol dehydrogenase n=1 Tax=Acidobacteria bacterium TaxID=1978231 RepID=A0A2V8UAI4_9BACT  ali  26  1MRSIQLVARRTLEECE-MPQPPDPEHGQITVRIRAVGVCGSDLHWYLDGRV---------GEFPAKYPQVLGHEPAGEVVAVGKGVETYAPGDRVVIEPSLTCGC--------------CEHCLRGQHNNCIHCVFLGGPQAPGMFREYVTLPAANATHFPKEFSYATATLAEPVAVMMHMLELVDIHAGDTVAVTGSGPIGMLCAAVARAAGASRVFIADRLGYRLKLALRMGADVAID-TTSQSLIETVMDATRGR-GVDKVLEAAGSAETVNGAIRIARPGGTVMLIGILSELYPKIDIHTAMAKELRLQTLKRSNHRA-REALSLMAAGRIPT----ALITHSLPLEDT-PKAFEMLTHYTDGVGKAIIE........ 342
23 0.000e+00UniRef50_A0A1C5RKU5 L-threonine 3-dehydrogenase n=25 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1C5RKU5_9FIRM  ali  29  1MKALVKYGPGNLEI-REVEEPKVSG-DLVKIRVVYAGICGSDLHTWAGEYASN------------KPPVTLGHEFSGIVEEVGPDVKELKVGDRVTSETTFTCG--------------KCIYCKNEEYNLCSSRQGLGTQ-ADGGFAEYVINHEARIHKLPEKVSLLQASLTEPLACCVHAMETSQVKPGETVLIFGPGAMGLLTGMVCKSQGA-KVVIAGLDEKRFEVARTLGFDRIVDQMK-EDLGTVMNEMTDG-IGPDKIYECSGAIPALNRSFELIRKKGEVVQIGVFAKDINEVNVGIFFPKEIHYMGTRTQKPSAWRTSLKLMEEGLVHPEKVVTMITD---LDN-WEEGF--TKSKNAEEVKVVIQVADTDEI. 349
24 0.000e+00UniRef50_A0A1F8NGK2 L-threonine 3-dehydrogenase n=1 Tax=Chloroflexi bacterium RBG_13_68_17 TaxID=1797638 RepID=A0A1F8NGK2_9CHLR  ali  27  5MKAVRKLRPEPGFDLTEVEIPRIQ-PDEVLVKVAATALCGSDIHFY---------NWDDFAQKRLKLPLTLGHEFCGDIVEVGKAVREYKVGDYVTADSHIVCG--------------KCDVCKMGLQHICQHLKIFG-NDVEGSFAQYLPVPATSLWRLTRDIPAEVGAVMEPLGGATQAVLIEPVTA-KSVVIFGDGPIALFAAGVASTAGARKVYLIGMVPSRLEIARRMGAQVTFNINDPVDPVQAIQEDTHG-IGADVVVEMAGAAQSMKNAFEVVRKGGRVTTFGLTP-KPIEFDINAVTLRQVTVRGVARHMWDTWKLVDGLLASGKL---DPRPVITHRIPLED-FDKGFKLMTTGSRDTGKVVMFPNG..... 351
25 0.000e+00UniRef50_A0A2U3CIT2 Alcohol dehydrogenase n=1 Tax=Candidatus Heimdallarchaeota archaeon B3-JM-08 TaxID=2012493 RepID=A0A2U3CIT2_9ARCH  ali  26  6...ALFTEPKSINL-QTIDIPKI-KESEILVKTAYCGLCGTDIHLYDGKVPF------------ANYPLVPGHEFSGEIIKVGSKVKNLKIGDRVAINPNLSCYDLQKKL---------CYYCEKNRKHFCVAWEAIGV-TLNGAFAEYVICPSTVAYKIPDNVSLKAAAFMEPLACCLHGLNNMTIMDSDVVFIIGCGPIGLLMLSVIKATTSCKVIVSEPVNSRRNLARKIGADVILNPLSDE-IVPIINSETCDK-GVDVAIECVGLSNTAKQAIGSLNKGGKALIFGVADPSTIDLDIHRLYSNEISIFGSFT-NPNTNMRALDLLSKDILTPI---PIISHEFPIKR-IEEAISLIKSHVDNVNKILINP....... 348
26 0.000e+00UniRef50_B0TNM4 L-threonine 3-dehydrogenase n=188 Tax=Bacteria TaxID=2 RepID=TDH_SHEHH  ali  25  1MKALSKLKPEEGIWMVDAPKPEV-GHNDLLIKIRKTAICGTDVHIY---------NWDEWSQNTIPVPMVVGHEYVGEVVGMGQEVRGFTIGDRVSGEGHITCGH--------------CRNCRGGRTHLCRNTSGVGVNRE-GAFAEYLVIPAFNAFKIPDDISDDLASIFDPFGNAVHTA-LSFDLVGEDVLITGAGPIGIMAAAVCRHVGARHVVITDVNEYRLELAQKMGATRAVNVAKEK--LEDVMQELGMTEGFDVGLEMSGVPSAFHSMLDTMNHGGKIAMLGIPGG-EMAIDWSKVIFKGLIIKGIYGRMFETWYKMASLIQSG----LDISPIITHHFSIDE-FQQGFDAMRS--GQSGKVILN........ 339
27 0.000e+00UniRef50_A0A075LLC3 Sorbitol dehydrogenase n=10 Tax=Bacillaceae TaxID=186817 RepID=A0A075LLC3_9BACI  ali  31  1MHALVKKELGFGNLVENKPEP-YPEDDQVKIKVTYAGICGSDIHTYEG-------------SYRVAAPVTLGHEFAGVVVSVGSNVSHLKPGDRVTSETTFYCGQ--------------CSYCEQKDYNLCKYRKGLGTQ-QDGGFATYVIARAESIHHIPNNVDDQSAAMTEALACTHHAVAKTTIKPNDIVVVIGPGPIGLLTAQVAKSKGA-MVVITGLSSDRLEKAKSLGIDYVVNVQE-ESLEEIISGLTDGY-GADVVFECSGAIPAARQGLSLLRKKGQYAQVGLFTEAAIPFDMEQVIQKELKIIGSRSQKPADWEPSLHLMESGAV---DAAALVTHIFDITE-WEKAYQLIKS--GEAIKVLLTPKKE.... 344
28 0.000e+00UniRef50_A0A0K8PBB7 Threonine dehydrogenase n=15 Tax=root TaxID=1 RepID=A0A0K8PBB7_9CHLR  ali  27  1MLAAVYYGKEDIRMM-DVPKPEI-GPGELLIKVSSASICGTDLRIYQGGHRYYPEGTI----------RIPGHEVVGIAEKIGEGVEGLSIGQKVFIAPNMGCGH--------------CKQCITGNNNLCSNFDAIGI-TIDGGFAEYMRVPANCVIKIHDDVDPAVAALIEPFACVLRGQKAVHIQPGDVVLVIGAGPIGIMHAKLAKVWGAGRVIVSETIPFRAEQAKRMGADRVVDP-TNEDLESAIKEESEGR-GADVIIVAAPARGAQEGSLSLAAVGGRINFFGGLPKDNISFDSNIVHYKELLVTTTACSTDNCWQAA-QIINSGRV---DLSDLVSKRFPLKEA-KEAFAEALQKK--ALKIVIEP....... 348
29 0.000e+00UniRef50_I8R7E2 Alcohol dehydrogenase, MDR family n=7 Tax=Lactobacillaceae TaxID=33958 RepID=I8R7E2_LACPE  ali  29  1MLAARVYGKQDLRLV-DIDEPSISNPNDVIVQVKAIGICGSDNAIYNGNNPF------------AELPRIMGHEFVGMIHEVGQNVSEFNVGDHVVVEPISYCG--------------KCYACRAGMPNACENLKVLGVH-KDGGMQQFIKVPLKQIHKISSKIPWTTAVLAEPYTIAGNATMRSQVGLGKTVLIQGAGTIGQLALRVAKVKGA-RVMISDVAASKLEFAQKNGADAVVDVTT-EDLKQRVSDWTNG-EMANIVIDAVGSVQTFQSCLDLASVAGRIVPLG-FSTQPVTITQKPIMQKQLTICGS-RHQAYQFEPIIKALENGQLGDHG---MVNQKFAFKD-IQTAFDLMNNHPEQARKIVLLF....... 338
30 0.000e+00UniRef50_B8FFL0 Alcohol dehydrogenase zinc-binding domain protein n=3 Tax=Desulfatibacillum TaxID=218207 RepID=B8FFL0_DESAA  ali  27  4MKAACLTKPKEIE-VQEIPVPEI-GENEFLVKMHACSLCYTDVKACVHGKHFYIELYG--------LPWTPGHEMAGEIAAVGDQVTGYSVGQRVAVAPFNPCLE--------------CPPCKLGAYRFC--HKAPGSFVQPGGFAEYFKVPGEGAHVLQDSVSYEEAALVEPVASCLHAVRKAGVPQGSTAAVIGAGPMGLILMQLAKAEGAAKVFMVDVDDQRLEQALDFGADEVINSAK-ENANQAIRLKT-GFMGADVVFEAVGSAQTYLLALEMARGGGAVSLFGMPGGSTVEIPSELLHYHELTITGTSSFSPDDYKNALELIEAGKI---DVKRLISHRFDSLDGVLEAINLSLDKQGLK-KVVL......... 350
31 0.000e+00UniRef50_A0A1G3R6C5 Uncharacterized protein n=2 Tax=unclassified Spirochaetes TaxID=1130380 RepID=A0A1G3R6C5_9SPIR  ali  26  1MLAVVKEQPGEGWALREVARPG-PAAGEVLLRVHRIGICGSDLAIFDG------------REKDLRLPVIPGHEFAGEVVERGAEVQGLPIGARVAVNLVRNCGH--------------CYQCRKGQGNLCLDPNLIGFH-SNGGFAEFACVPAGNCHPLPEGMSWEAAASIDPLTSALAAVQKAGVGPGDRVAILGPGPIGLYACQLARLQGAREIFVIGTRAHLLEKARELGADRAFKVDRADMTACLILEASDGR-GAEVVVEATGNPAALDLALAVASKGGRIALVSIYHERT-EIEPNSVVFKELRILGSFDYRWIDFENALRLIAGGRVRT---EPLITHRLPLSR-IQEGIALMQSR--QAIKVLLEP....... 341
32 0.000e+00UniRef50_A0A284QPN6 Related to sorbitol dehydrogenase n=4 Tax=Agaricomycetes TaxID=155619 RepID=A0A284QPN6_9AGAR  ali  23  8...LVLHAPRDLRLSR-RPLP-APPPHHVQIAILSTGLCGSDLHYYLHAR---------NGAFALQAPLVLGHESAGVITAVGPLVTDFCPGQYVAIEAGIPC--------------ESCEWCKTNRYNLCEGMRFRSFPHLDGTMQTKINHPAKRVHALPPGVSCEQGALAEPLSVLLHASRRAGLTQHRKVLVFGAGAIGMLAAGLARSRGIEAITMVDINRERLAFAKEHGVGKVFCPMKGLDGLERSRQALAFGGGYDIVYECTGAEPCIQMAVFSTKTGGKVLLIGM-GTPNALIPISNAATREVDIIGSFRY-ADTYKEALQLLAGGTLPP--ITDLITHRVPFADAVKGAFEAMAKGRDEVIKVIV......... 367
33 0.000e+00UniRef50_K0YNJ7 Chlorophyll synthesis pathway, bchC n=5 Tax=Actinobacteria TaxID=201174 RepID=K0YNJ7_9ACTO  ali  28  10MRANVLLGQQKMQM-EERPVPT-PSAGQLLIKVLSVGVCGSDVHYYKTG---------ECAGFQVEEPLILGHEASGVVVAAGSPEDENRVGERVSIDPQVPC--------------RKCRYCKTGHLNLCPQMQFYATPPVDGTFCDYVLAPADFAFTVPTQMSNNAAALLEPFNVGLWANMEAHTTLGSRVYITGAGPIGTLTALAAKSFGASEIIVSEPNPTRREMILKHGATKVVDPTED--------GFTTDGIEADVFIECTGVTDAIQSGLYALAPAGTCVFVGM-GSNIVPLDVARISVRELIVTGLFRYV-HTWPKSIAAASQ---PFVNLDELVTAEFTLEEA-EEA--LTSTGDPTSLKSVVVVNKE.... 346
34 0.000e+00UniRef50_A0A0S7XJM9 Uncharacterized protein n=1 Tax=Planctomycetes bacterium DG_23 TaxID=1703414 RepID=A0A0S7XJM9_9BACT  ali  29  1MKAGVYYGTGDIRI-EDMPLPEI-GDEEALVQVKSCGLCGTDLQKYLHG--------------LVEPGVVLGHEVAGNVVEAGEKVSRLGAGDRVIVPHHIPC--------------FVCRFCRHGNHTMCE--AFKPTRISPGGFAEFIKVAGPSVLKIPDEISYDEAALVENTACCLRALEKCRLLPGDCVVVVGAGPAGLIHIQLSRALGAGKVLALDLLDWRLEVAKRMGADVVLNA-RNDDVVAAVKEET-GGLGADVVMVAVGSTKALAQAISLARKGGVVNFFAECPPGSLKIDPNIIYGSEIILLGSYSSTPLELKSALELIHSGRI---DVAGLISHRLKLEE-LKRAFDLASQRK-EALKIIINP....... 341
35 0.000e+00UniRef50_A0A059NXE1 Putative zinc-type alcohol dehydrogenase-like protein YjmD n=39 Tax=Firmicutes TaxID=1239 RepID=A0A059NXE1_9BACI  ali  27  1MKAIQVKEPGNLQVVE-MEAPEIIHPSEVKIRMKVMGICGSDMHILHGENPF------------ASYPRVIGHEVAGEIVEIGEEVTALKVGDKVVIEPMTSCGE--------------CYACQQGRPNVCEKVEVYGVHREGGG-RETMVMPESLVHKVDESLDWKEIALIEPFTIGAQSIYRGQVQEGDHVFIIGAGPIGLCCLKMAKQAGA-KVAISDINEKRLAFAERWGADDLINPQQ-ENVEEQVSRWTSG-MGANVVIDAVGLPQTVEQAIAVTSVAARVVLLG-FDQKFSEIAQVGITKKELTICGS-RLQTHRFGPVVEMFNSQQLHVED---LVSHQYDLNEA-KEAFQLMEEAHPEVRKVIIK........ 337
36 0.000e+00UniRef50_A0A2H5Y428 Erythritol/L-threitol dehydrogenase n=5 Tax=Bacteria TaxID=2 RepID=A0A2H5Y428_9BACT  ali  27  5MPAVVFLGEGRWAL-EERPVPSLRNPDDVLLQVEACGICGTDLHILE-----------VPPGHPATPGVVLGHEVIGRVVEVGPAVTHLRPGDRVAVAPNLYCG--------------VCRFCQRGLYNHCERFTTLGI-FLDGGLAPYEVAPARALFPISPEVPLERAIFTEVVSTVVGGTLHARLHPGEHAVVLGCGPVGLLFLQILRASGAGSLIAADIAPFRLEFARRAGADWAVDPRE-QDLEGLVREVT--GIGADVVVDAVG--SLMGTALRLVRPGGTVILFGMNARARAEIAQYDITRREIRVVGSYV-GRHTFPLAIQMLERGVIRP---EELVTHRLPLSR-FGEGLEHL--RRGEAVKVMMVP....... 340
37 0.000e+00UniRef50_A0A0T6B5U9 Uncharacterized protein (Fragment) n=4 Tax=Protostomia TaxID=33317 RepID=A0A0T6B5U9_9SCAR  ali  27  11...AILYGVNDLRL-EQTPIP-VPNDDQVLLRMEAVGICGSDVHYLVKGYI---------GHFVLRQPMVIGHEAAGTVVEVGKNVKNLKPGDRVAIEPGVSC--------------RRCSYCKEGRYHLCPDMVFCATPPVHGNLARYYVHDADFCFKLPDHVSFEEGAVLEPLSVGVHGCKRXXXKA------FGA----------------STVLITDILQRRLDLAKEMGADHTLLVDKNVSDEEIIKQVVEKLGGPTISMDCSGAEQSVRIAIQATKSGGCALLIGM-GLSEMTVPLANALIREVDIRGVFRYC-NDYPTSLDLIATGKI---NVKPLITHHYTLEQTL............................ 332
38 0.000e+00UniRef50_A0A1E2ZZP6 Alcohol dehydrogenase n=68 Tax=Bacteria TaxID=2 RepID=A0A1E2ZZP6_9FIRM  ali  24  1MKSAVFYGKHDLR-VEEYAQPEV-GPEDVLIQVKACGICGTDVHIYEG----------DKGAAEVTPPTILGHEFSGVVVKTGDKVTEYRAGDRVCIDPNCYCG--------------ACDACRNGEAHFCENMIGYGT-TVNGGFAEYCAVNYKQVYRLGENTTFEQGAMAEPVACCLHGLDMCEIRPGHQVVVIGGGMIGLLMVQLAKLAGAAKVALLEPVEGKREVGKKLGADICIDPVNGDV---KVALAGSGMNWVQTVIECVGRPSTIEQAIEIAGKKAVVMMFGLTPEETIAVKPFQIFQKELVLKASYI-NPYTQKRALDLIDSGRL---DVSSMIYDVCGLDRLG----DILSQPQLRAGKYIISPEK..... 341
39 0.000e+00UniRef50_A0A1M6M7A7 L-iditol 2-dehydrogenase n=1 Tax=Hespellia stercorisuis DSM 15480 TaxID=1121950 RepID=A0A1M6M7A7_9FIRM  ali  31  5MKALVYQGPGKLE-VETRQIP-IPQKGEVQIKIKKVSICGSDLGAYR------------FASDRFAPPLVLGHEFSGDITQVGEGVTMLKEGQRVTVNPMVLCND--------------CYFCKRGEGNLCGNRKSMGTTQTDGAMREYVTVPDWMVVPVADNVSYEAAALLEPCGVTLACAKKEMSRDEKSTVVLGAGPIGLLIVKFLKALGIEKVIVSDIIDKRLAKAKECGADYIINSKK-EDAVFAVKKLTDGY-GADRVINAAG-EFLINQSFEMVKNGGTSVLVAL-AHKKVEIDPMEIVGRGLKFVGSYMFTTE-MKEAAQMLADEKLVVED---LITSTYTLENG-KAAFDVLNTPDNEEIKVQIE........ 345
40 0.000e+00UniRef50_Q01VI1 Alcohol dehydrogenase GroES domain protein n=4 Tax=Acidobacteria TaxID=57723 RepID=Q01VI1_SOLUE  ali  27  1MLVAELIAQRQFRFTE-IPI-EDPGPGEVQVRVNAVGICGSDLHSYAEGAI---------GDTPCEYPMVLGHEPAGTVVKTGTGVGGWSRGDRAALEPALYCYH--------------CEFCRSGRHNICANIRFLSNPGTPGFFREFVNLPVSNLLAIPPELSLELATIVEPLAVALHSLKFAAIQPRETVAVFGAGPIGLLTIACLKDAGAGRIWVVEPVSHRRELALRMGAAAALDPTHL-DAARQILSDTA-RRGVDCAIDCAAREDTTNAAIRAARNGGRVVLTGIHSAAFVPFEVSPMRRKELAIFNVRRSCHESHE-ALSMLTS---QMSSFAPLVTHTRPL-HALPDAFTLTEHYADGVAKMVVVP....... 343
41 0.000e+00UniRef50_I9LAX5 Alcohol dehydrogenase GroES domain protein n=1 Tax=Pelosinus fermentans B4 TaxID=1149862 RepID=I9LAX5_9FIRM  ali  31  1MLQAVLEKPKTI-VFHEIPIPE-PGKDEVLLKVSRIGICGSDIHVYHGKHKY------------ATLPVVQGHEGSGVIAKAGSEVSGLMIGEKVTIRPQLFCKE--------------CIMCRKGRYNLCLDYKVIGVLGSTTGMAEYFLIKASLVHKLPQGITLDQGAMVEPAAVAVHSVKLGAAPVGNKTLVVGAGPVGNLVAQAAKALGAEKVIIVDISQERLELAKKCGVDICVNSRDR--SLADIIAEHFGSDGADVILDCAGAPVLVEQMVHAARRGTNIVLTGNYYDK-VPVELGLVQRREINLVGVMNYLAEDYEDTIRFIARGDMK---VDPLISTYFDIKD-YNEAYQYIDENMAKVMKVLIK........ 340
42 0.000e+00UniRef50_A0A257AUB4 Uncharacterized protein n=1 Tax=Thaumarchaeota archaeon ex4484_121 TaxID=2012532 RepID=A0A257AUB4_9ARCH  ali  26  10MKAAVLLGPRNIE-VRELPVPKV-GVNDVLVKVRACGVCGSDIAYYRRGRADVP------------PPIVLGHEFSGTIVELGETAKKLKEGDRVVAEPVMACG--------------ACESCKKGYPNMCEHPTVLGV-TVNGGMAEYCLVRYNYLHLIPEKLSFEEAAFTEPLACALNGVRKLKLNPGNSAAVIGPGPIGLMVVQYLKHSGASPLILIGTRDYRLEAGLRLGADYAINVREAEDPVERVKELTDGK-GVERIFVATGNLEANQLAVGIGGARSVTVFFGGAAYEPISIPLWDSTLGEKEYVFSW-LSPYTFPEALHAIEAGLV---DVKPLLTHSFGIEEAG-RAIETAEKRLGNALKVQIK........ 360
43 0.000e+00UniRef50_A0A2P8CAT6 L-iditol 2-dehydrogenase n=4 Tax=Bacteria TaxID=2 RepID=A0A2P8CAT6_9BACT  ali  25  5MKTFALTGKEKMEI-QERPMPEIANDTDVLIRMIRVGVCGSDMHYYKEGGI---------GSQVISYPFTPGHEGAGIIAAVGKGVKHVAVGDRVAIDPAMPCGH--------------CDQCEAGRPHTCRNLKFLGNPGAEGCLSEYIVIPEGSCFPINNRLGFDEAVISEPLAIGYYATKLAGDLRGKSIGILGFGPIGMSVLLPAQVQEPAKVYVTDKLEHRLKIAHETGANWTGNPDET-NIVLEINRL--EPLQLDYVFECCGKQEAVDQAIQLLKPGGTLLIVGIPEFSHWSFPVDELRRKEITIQNVRRQNGFT-RPALDLIAD---STMDVTPMVTHHFPFEET-DKAYATVANYEDGVMKAMIDF....... 348
44 0.000e+00UniRef50_UPI0005E8E8B7 butanediol dehydrogenase n=1 Tax=Streptococcus pneumoniae TaxID=1313 RepID=UPI0005E8E8B7  ali  35  4MKAVRWHAAKDVRI-QEIEVPEVL-PHQVKVAVKFTGICGTDL-----------------------------HEFSGEIIEVGSDVTCVKVGDRVAVEPILAKNNLV------------------GDYNLDPNLNFVGL-AADGGFAKYCVLDGDLVHVIPDSLSYEQAALTEPAAVAVYAVRQSSLKAGDTAVVFGLGPIGLLIVEALRAAGASKIYAVELSPERQAKAEELGA-IVVRPEEGETAVEAIHRLTNG--GVDVSYEVTGVPVVLGQALAAVHKAGECMVISIW-EREANINPNEFAIQEKTLKGIIAY-RHIFPKVLELMEQGYFSA---EKLVTKKIKLENIVEEGFIELTQDKSQ-IKILVEPE...... 320
45 0.000e+00UniRef50_A0A1M4UU11 L-iditol 2-dehydrogenase n=3 Tax=Alkalibacter TaxID=274470 RepID=A0A1M4UU11_9FIRM  ali  26  1MKSAALTNVGIIEMVEK-AVPEI-NESEVLIKPMVVGICGTDI-------------ERMWHTGTWKFPTVLGHEFCGVVEKTGEKVTNVKAGDHVVVNPMVTCG--------------VCRYCVSGHQNMCVDYDYLG-SRSDGGLQEYVNVAAKNVIKIPKNMPFEKAALADPLVIGIHTLSKAEIQPGNTVCIMGAGPIGNLMIQLAKNYGAGKVIAVDLIDEKLDCAKQSGADICINAIK-DDVHKVIEKETNG-LMADVVIESAGAVKTVENSMLVAGKQGRVVFMG-TPHSDVLINFEGILRKELTVRGSWCYDYDEWQVGIDYLNIGKIK---VDHLITHRFDFDNVME-AYNTVKSRDRYFNKVLIYVNEKLEK. 352
46 0.000e+00UniRef50_A0A067EYF3 Uncharacterized protein n=12 Tax=rosids TaxID=71275 RepID=A0A067EYF3_CITSI  ali  28  20..AAWLLGVNTLKI-QPFELPSL-GPYDVLVRMKAVGICGSDVHYLKTLR---------CADFVVKEPMVIGHECAGVIEKVGSEVKTLVPGDRVALEPGISC--------------WRCDHCKGGRYNLCPEMKFFATPPVHGSLANQVVHPADLCFKLPDNVSLEEGAMCEPLSVGLHACRRANIGPETNVLIMGAGPIGLVTMLGARAFGAPRIVIVDVDDYRLSVAKELGADNIVKVSTNQDIAEEVEKIQAMGTGIDVSFDCAGFNKTMSTALSATRAGGKVCLVGM-GHLEMTVPLTPAAAR.......................................................................... 301
47 0.000e+00UniRef50_E1V4Y1 L-gulonate dehydrogenase n=54 Tax=Bacteria TaxID=2 RepID=E1V4Y1_HALED  ali  27  1MQAFQVNAPQDYRLVET-EIPDA-APGEVLVRVAFAGICGSDMHIIHGDNAF------------VRFPRITGHEFAGLVEAVGEGVEGVAIGDRVCVDPVISCG--------------RCYPCRIDRPNVCTALEVIGVHR-NGGFEERVNVPAGNVHRLPEGLGLDAAALVEPYTIAANVLDRMQPHPGDRLLILGAGVIGLTILQVARALGIEDVTVSDVIDARLATARELGATRTFNGAE-QDVEAEIQALTDGEGMPLIA-DAACVPALLPQMLRMASPAGRIGLLGFTPT-PSDLSQLEVIKKELTLVGS-RLNNRKFPEVIELMASGRL---DPLALISHRLPFDD-MPGAIEMLDHHPERARKVLIQ........ 337
48 0.000e+00UniRef50_A0A0F7S215 Probable xylitol dehydrogenase n=14 Tax=Ustilaginomycotina TaxID=452284 RepID=A0A0F7S215_9BASI  ali  24  27......THKKELELIK--SAPAAPGPGMALVHVRATGVCGSDVHFWKHAGLGPWKIESQCA---------LGHESGGIVIAVGEGVDNVAPGDRVAIEPGVPC------------FKATCDYCRTGKYNLCPTVDFYSVPPKDGTLKRYHEHPAGWLHKVPDNMSYEEIALLEPLSVTLQATLQAEISLGTPVLITGAGPIGIVQLLCASAAGATPIVITDVVKDRLDFAQKVVFTYQIDPKKTESAAEICKSKATGKHVAEITMECTGVESSVQTAAYATASSGLVFVIGV-GANFQSIPFMALSVKEVALKFLFRY-RNTWPRAIRLVSSGKI---DVKQIVTSRFSLEQA-KEAVEHAADRSTFSVKTIIY........ 380
49 0.000e+00UniRef50_A0A151VFD1 L-arabinitol 4-dehydrogenase n=64 Tax=Dikarya TaxID=451864 RepID=A0A151VFD1_HYPMA  ali  27  41..AAFYNPAHEIHLVEK-PRPT-PGPGQVLLHVHATGICGSDVHFWQHGRIGDSMVVTDECGS--------GHESAGEVVEVGEGVTQWKIGDRVAIEAGVPC------------SQPACDACRTGRYNACPDVVFFSTPPFHGTLTRWHLHPAQWLHRLPDAVSYEEGSLCEPLAVALAGIERSGLRLGDPLLVCGAGPIGLISLLSARAAGAEPIVITDLFQSRLDFAKKLGVHTVLRGTTSKEQAEQVKAAAGGPLK--LALECTGVESSVHTAIYSMAFGGKVFIIGV-GKNEQLFPFMHLSANEIDVSFQYRY-ANQYPKAIRLVAGGLI---NIRPLVTHRFALEDAV-AAFHVAADPSQGAIKVQIQ........ 386
50 0.000e+00UniRef50_A0A072P1E8 Uncharacterized protein n=1 Tax=Exophiala aquamarina CBS 119918 TaxID=1182545 RepID=A0A072P1E8_9EURO  ali  35  1MKALRYHGRGDLRL-DEIDEP-ICGEDQVKLKPEYVGICGTDLNEYLSGPFIIPT--SAHPLTGEQLPVTLGHEISATVTEVGSKITDIQKGDKVAVFPLL--------------ADNTCGPCQRGLPNCCANFGSIGFSGA-GGLSESLVTSRGNVLKLPADVSLEAGALAEPLTVAWHALSRSPFQRGDDALIVGAGPVGLAVIQVLRARGAGKILVSELSPRRQELAQHFGADYILDP-TNPDTVQMCKTLCSG-EGPALVFDAAGVQSGLDLALAASRTGATIVNIATWKTQPL-ISSVPFIMGEKNYIGTMVYVKGDFDKVIEAMGSGESSSVDLLTL....................................... 321
51 0.000e+00UniRef50_A0A0H2M622 L-idonate 5-dehydrogenase (NAD(P)(+)) n=147 Tax=cellular organisms TaxID=131567 RepID=A0A0H2M622_VARPD  ali  26  1MLNCEIHGALDLRLAERPAEP--LAPTQVRVAVKAVGICGSDLHYYRHGRV---------GDFVIRAPLTPGHEASGQVIEVGAQVSSVKPGDRVALNPSRACG--------------VCRFCRAGASNHCENVHFFGWPHMQGAMREQVVVEATQCLAVPDTLSFELAAFGEPLAVALHAVQEAGSLLGKTVMVVGAGPIGALILMAAKLAGASQLIAVDIVDETLAACTRVGATRTINAAKEPD---ALQALAADKGQVDASFEVSGHYDGLANCIRSTRPRGTIVQVGTLGGNSEGCPFNQIMVKSLHLVGSFRFV-DEYAWAVDYLSRGLL---DVSPLLTEAVPVAR-VHDAF-ALAADRHRAMKVLVTF....... 345
52 0.000e+00UniRef50_P36624 Putative sorbitol dehydrogenase n=4 Tax=Schizosaccharomyces TaxID=4895 RepID=DHSO_SCHPO  ali  29  6.KAFVLRKKMDTAI-EDRPGQTLTDDHQVKVAIKATGICGSDVHYWKEGGI---------GDFILKKPMILGHESAGVVVEVGKGVSSLKPGDPVAVEPGCVC--------------RLCDYCRSGRYNLCPHMEFAATPPYDGTLRTYYITTEDFCTKLPKQISVEEGALFEPMSVAVHAMTRGNLKCGSRVLVMGCGTVGLLMMAVAKAYGAIDIVAVDASPSRVEFAQKYGAKPFIAAKENEDYAQRYKQAIIEKYGFDFAVDATGVGICIHTAVLALKRGGTFVQAGN-GKPVIDFPINHIINYEINVLGSFRYAHGCYKQSLFLVSNGLV---DVKPLITHRFAFKDAL-KAYETVASGEEGVLKVII......... 355
53 0.000e+00UniRef50_A0A1V5SKL5 Sorbitol dehydrogenase n=2 Tax=Bacteria TaxID=2 RepID=A0A1V5SKL5_9BACT  ali  26  8..........DLRKFEEGPIPEV-KPDEIRIKVQRVGVCGSDMHAYQGTHPF------------VHPPMVLGHEVAGIVDEVGSQVKNLAKGDLVTIEPNLVCGE--------------CYNCRTGRYNICEKLQVIGCVGYYGGQSEYLVVKADEVFKLPKDWDADKAVLIEPLAVGVHAVRQAKMLTGAN----------QATLQAAFVAGAKQILVSDPVDIRLELAKKSGATMVVNPKK-EDIYQVAKKYF-GSDGPDMVFDCVGNEITLDTAINLARKGSKIIMVGV-PEGKIPVNMAYVQDRELEIIGTIMYTAVDYEATIQYLNDGRMKTDG---LVTHHFSLDQVYD-AFETALNPSRGSLKVLIDVSE..... 342
54 0.000e+00UniRef50_A0A2E9F3R9 Alcohol dehydrogenase n=6 Tax=Bacteria TaxID=2 RepID=A0A2E9F3R9_9BACT  ali  28  1MKVA--SGFGNIEL-RDXDEPSLQ-AGQVKXKVHSAGICGTDLHIYKDEYPSF-------------PPVVLGHEVAGEITEISEXANXYQIGDRVTTE-------------TYFSTXRVCAYCRDGYXNLXLNRLSIG-SGVNGGFTQYLVVPVTNLHLXPDNVSFEAGALTEPLACVVNGVKHPTVTPGDVAVIAGPGAIGLLTLQVIKSAGATVVTLTDADQQRLELAQQLGSDYTLNVQQ-QDPLDXIXQITNEGLGADIVYECSGAGPAAMQLIDLVRRQGRYVQIGLFGHX-VSWDLDQLCYKELIATGSFAXTPESWRKAIRLXADGTVQTM---PLITDIFXVND-WXKAFDSFEQRNG--IKTLLXP....... 339
55 0.000e+00UniRef50_D5WT05 Alcohol dehydrogenase GroES domain protein n=38 Tax=Bacillales TaxID=1385 RepID=D5WT05_KYRT2  ali  27  1MKAMVIPEPGR-AVIREVPEPE-PGPGEVVVSVKAAGICGTDFHIFEG-------------DSLGSYPIIPGHEFAGVVAKVGPAVTSLAVGDRVAVDPSLFCG--------------RCRYCLTNRGNHCENWGGIGT-TVPGGFAEQVAVPESSAFRLPDALSFQEGAFVEPVACVVHGINRLNLRPGERVLLFGAGAMGQQLVQALVHAGAAELTAVDVDPGKLALARRFGATRTVLAAALE------KELGGELESFDAVVDATGAPAVIETALRFLGPAGKFLQFGVAPKRKISLSPFDLYRRDWTLIGSMA-INHTFLPALEWVAAGRIQ---VKPLLSKTIPLEELP----EFLGRPKPELLKVQVVF....... 333
56 0.000e+00UniRef50_A0A2S4KLT0 Sorbitol dehydrogenase n=1 Tax=Tolypocladium paradoxum TaxID=94208 RepID=A0A2S4KLT0_9HYPO  ali  25  307..ASVLYGPEDIRA--ETRTLGAPSPDELQVSIKATGICGSDLHYYKHFR---------NGDILVREPMSLGHESAGVVEAVGSGVTGFKAGDRVALEVGLSCGG--------------CKLCDAGRYNLCPRMKFRGFPHFQGTLQKRINHPASMCYKLPENVTLEEGALLEPLSVAIHAVRRAALKPGVNALILGSGAVGLLVAAMLRVEKASSITIADIEEQRVNFATSNGADVVVPRGRAEDTSALLMGGTD--QQFDVVFECTGAETCVQAAIYSAAPSGRVMIIGM-GTPVQTLPLLAAALREVDIVGVFRY-ANTYQYGIHLLANGELGLPDVLKLVTQRYSGLNNVPSAFAAAARPVDDVIKVLIE........ 673
57 0.000e+00UniRef50_Q59545 D-xylulose reductase n=606 Tax=cellular organisms TaxID=131567 RepID=XYLD_MORMO  ali  25  3MKALVLEKAGKIAI-QDWQSNEVLGDDDVEIKIHTVGICGSDVHYYQHGRI---------GPFVVDEPMVLGHEASGVITAAGKNVKHLKVGDRVCMEPGIPDLQSPQS--------------RAGIYNLDPAVRFWATPPIDGCLRESVIHPAAFTFKLPDNVSFAQGAMVEPLAIGMQSATKAGIKPGDIGLVIGAGTIGIIT-QSALAGGCSDVIICDVFDEKLKVAEKYQGLHAVNSKDQQALADKVRELT-GGEGVNVLFECSGAKPVIASISDHIAPGGTAVLVGM-PIDPAPLDIVAAQAKEVTFKTILRY-ANMYPRTIRLLSSGKL---NVAPLLSATYKFKDSVE-AYERAAEP.................. 334
58 0.000e+00UniRef50_A0A1B7JVZ3 Sorbitol dehydrogenase n=38 Tax=Bacteria TaxID=2 RepID=A0A1B7JVZ3_9GAMM  ali  27  5MKAAVLYAPNELKVAE-IKYPQL-GKGDVIIRIKAAAICGTD------GRIVSGRKTK-----GVRYPSVIGHEFSGEIVEVGENVSEFHLGDAIAVDPVIPC--------------RSCVYCRIGKENVCLNRQAIGY-EFDGAFAEYVRIPAGNVFKMPKGMSYEAAALAEPLACCINGQKNVGIELGDTVVVIGAGPIGLMHILLARFSGATNIIVSELNEQRRKAAIDCGATHTVNSQQ-ENLLDTVKGVT-GGVGADVVIVAIGIPQLVNPALELARKGGRVNLFAGFSKDDMQIDVNIIHYNELIVTGASALSREGYKQALSLISSGLI---DIEKLITHRFSLDQINEA---MVSAQKGDAIKIIIY........ 348
59 0.000e+00UniRef50_A0A090FV03 Alcohol dehydrogenase, zinc-binding domain protein n=4 Tax=cellular organisms TaxID=131567 RepID=A0A090FV03_9RHIZ  ali  31  1MKALRFHAARDLRL-EDIDPPAAPEPNDVIVAVSHCGICGTDIHEYLDGPIFV--STRPHPLTGASAPIVLGHEFSGRIVAIGRAVSRFSEGDRVAILPHL--------------NKPGDYFVRRGIGHISDTTALVGLSSAYGGMGEYAVLPQDNIVKLPDGVSDEQGALFEPMAVAINAIDRGGVDAGSTVLVTGAGPIGILAAMAAKAAGASRVVVSEANPARRLRLEELGYEVVDP--TSANFGDAVLGPTEEGLGVDVAIECAGNERALADCIRLLRRGGTIVQVGIFVEPP-RVDMRLLVSKAVTLTTSWGFPITIGPRVVQMIAAGQVQP---EKIITGRVAMADAIARGFDALARPDQDHLKILI......... 352
60 0.000e+00UniRef50_A0A1V4SFW9 Galactitol-1-phosphate 5-dehydrogenase n=10 Tax=Bacteria TaxID=2 RepID=A0A1V4SFW9_CLOHU  ali  26  5MRAVQLFAPGRVS-CELIDIPAITNPKNLIIKVQACGVCGSDI-------------PRVMSKGAYRYPIVIGHEFAGEVVEAGPDVKTAKKGDRVTAMPLVNCKE--------------CDFCKIGQAVACDNYDYYG-SRIDGAMAEYIEVSEENIVHIPDSVSYYEAAMADPVSVALHAVRKANVEAGQTVVVFGLGAIGFIAVQWLKNLGCHKVIAVDIIDEKLELAEKLGADLCLNGAKC-DAVKSIMEYTDGR-GADAAIELAGSTFTQVQAIDSVRKLGTVVFCGIAYNDLM-LPLGKILRGELNIKGSWNSSINEWKSALMFVETGKIKLKD---LITHVVRLEDC-QDAFEMMYHKKEMFTKVIFDPNKK.... 354
61 0.000e+00UniRef50_A0A1X2I596 Sorbitol dehydrogenase n=1 Tax=Absidia repens TaxID=90262 RepID=A0A1X2I596_9FUNG  ali  26  14..ACVIYGANNM-FLEPRPILK-PETDEVQINIRATGICGSDLHYHFEGRLGARILDPAV-------PMVLGHESSGVVTEVGATSTTFKVGDRVVLEPAKSCGQ--------------CHCCQIQRYNICPPMKYSSTGKNDGTLRRSICYPTHLLHKMPDTMTFEEGALIEPLAVAMHAVARSPVTQGSSVVVYGAGTIGLLVAASAYAQGATKVTIMDINTSRLAFASEYLPDVTIQSDEEEDLFTWAQQHTMGKDGCDVVFDCTGVESCVVLSFFMVKSGGSVVLVGL-GKTKIALPVDVIATKEINVIGSYRY-ANIHAKAIATVASGKIR---LLPLVSHRFALEET-PAAFETLRKGGDGVLKVQI......... 370
62 0.000e+00UniRef50_A0A1C3SDM9 L-threonine 3-dehydrogenase n=5 Tax=Bacillus glycinifermentans TaxID=1664069 RepID=A0A1C3SDM9_9BACI  ali  31  5MKALIKTPGEPGAVCDLVPIPEI-GQNEVLIKVKAASICGTDVHIY---------NWDEWAKNRVKPPYVFGHEFSGEVAAVGENVSSVKEGDFVSAETHFVCG--------------KCIPCLTGKQHVCSKTMILGVDT-DGCFAEYVKVPESNIWKNPPGMPEDLASIQEPLGNAVHTV-LSGIAAGSKTAIVGCGPIGLMAVAVAKAAGASQVIAIDKNEYRLELAVKMGATATI-SIEKEDPLKNVSVLTNG-EGADLVCEMSGHPTAICQSLKMAANGGRVHILSL-PEHPVCIDMNDIVFKGLTVQGITGRMFETWRQVSGLLHSGAIQ---IKPVITHHFSLEE-YEKGFELM--RKGQCGKVILIP....... 346
63 0.000e+00UniRef50_A0A2H5WUG7 D-arabitol-phosphate dehydrogenase n=6 Tax=Bacteria TaxID=2 RepID=A0A2H5WUG7_9BACT  ali  25  1MKAVVNYAPEPCSVEREIAEP-APRAGEVLIRVRAVGVCGSDLHQYHGTH-----------SWKVNYPVVLGHEFAGVIEAIGEGVEGWQVGDRVVCETAAFCGQ--------------CAYCRTGRYNLCPQRLGFGY-GTHGAMARYVRAPARVLHRLPDDLTFEEGAMTEPCCVAAHAVELSCPKPGDLIVVFGSGPIGLLCLQMAKLFSPRMVILVALSGERLRIAESVGAAPILCADR-DDVEGFVRRASDG-LGADLVIDAVGSSAVLEPCLQVVRPDGQITKVG-WGPEPLGFSLDPLVGKNVRLQGSFSHTWGTWERVLTLMRTGKLTLAPMRRL----FPLAE-WRAAFHAMETR--QAVKSMLIPE...... 344
64 0.000e+00UniRef50_A0A2E6NLC0 Galactitol-1-phosphate 5-dehydrogenase n=15 Tax=Bacteria TaxID=2 RepID=A0A2E6NLC0_9BACT  ali  25  8MQALVLHGVGDLRL-EAVPRPDPPGSRGVLVRIGSCGVCGSDI-------------PRIFSKGTYSFPTVCGHEFAGTVEAVAAGIDTVAPGDRVAVFPLLWCGE--------------CGPCREEKYAQCVDYDYLG-SRCDGAFAEYVTAPPANLVPVPDGVSLEEAAMTEPAAVALHAVRRGGCSEGETVAIFGIGPIGLMVAQWVRAAGASRILLFDIEAAKLEQARKMGFEDVFDSS-AADPVEVVEER-SGGEGVDLAFDGAGVPQTLLEAMASACRGGRVVMLGNPSAD-VNLPISQLMRREATLYGTWNSDTDDWRDVLSAMAEGTL---DLEPLITHRIPLDGAVD-VLEGMKERREFFSKVLIQPARRD... 361
65 0.000e+00UniRef50_A0A1G4FHK5 Sorbitol dehydrogenase n=9 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1G4FHK5_9FIRM  ali  23  5MWAQVFYKPEDVRF-EQIDVPR-PGDDEILVKIKAATTCGTDLKTYRRGHPTIIQ----------KVPSTFGHEFSGDVVEVGKNVKNFKVGDRVVGANSVPCFH--------------CYFCKRKEYSLCENLQYL-----NGAYAEYIVIPSQILLHIPDDLDYKEAALVEPLACVLHGIDEINIKLGDTVSVIGCGPIGLMFVKLSSLKGA-RVIAADFSEYRLKQAEKFGAVKTINAS-YKDYPQRIKDITEESKGVDVAIEATGYPEAWENAINMIRPGGQVLTFGGTKKGTFKIDCVKFHYEEIKIKAMYHHTPYHIKKALDILATRQV---DGSEFITGEYPLSKTID-ALESI--GRQEGIKYAIIP....... 345
66 0.000e+00UniRef50_A0A2N2MWN9 L-threonine 3-dehydrogenase n=4 Tax=Bacteria TaxID=2 RepID=A0A2N2MWN9_9CHLR  ali  26  1MKSMMIHKPGELSLIEDLPTPAHL---EVLIEVKASGICGTDLHIFKGEYLG-------------SYPVIPGHEFAGVVRAVGSGVKRFKVGDRVAVEPNIAC--------------DNCSHCLNNRQNFCKNWQAVGV-TLPGGMEQFVCAPEKAVFSIGD-LPFEKGAFVEPLSCVIHGIERARIHLADKVAILGAGPIGDLLLQMVRLQGAANITMLETNPGRIALARELGADQV--MRRMEDLPQ---------DEFDVVIDATGAIPVMNRTIDFVRKGGTVLLFGVPPGKLMELDAFKIFQKGLTFLSSFTSVRNSIQ-AVRLLQSGEVK---VESLISHRLPLEDLL-VGLELMDKHDPGVKKVMILPNG..... 331
67 0.000e+00UniRef50_A0A0F2Q5P1 Uncharacterized protein n=1 Tax=Clostridiaceae bacterium BRH_c20a TaxID=1629719 RepID=A0A0F2Q5P1_9CLOT  ali  27  1MKVAVLKAPYQV-VIEDRPKPELQS-GELLIRVRATGICGSDVHAYQGFHP------------RRKPPAILGHELAGEVVAAGST-TDFKVGDRVTVLPQKKCGI--------------CFPCSQGLTNLCDNKTLLGTNKWPGSFAEYIVAPKELVYKIPKEVGYDLGALAEPLAVGLHAANRAGIKPDENVIILGAGPIGLMSQIAAQHMGAKDVIVADLSDMKLKTAEQLGASITINNSSIDLSSQ--LENYYGNRGVDVAIIAVGVPELITQVFPLVRKQGRVVLVGQFDKPGV-IDIEKSRLKEQLITGSSTYTEENFLNAVNLLASEKYA---LQSIISHRIVMEE-IGGGLDLLLKENKNVIKVMVE........ 341
68 0.000e+00UniRef50_A0A0P7ASP9 L-arabinitol 4-dehydrogenase n=1 Tax=Neonectria ditissima TaxID=78410 RepID=A0A0P7ASP9_9HYPO  ali  23  54......................APRTGEVLVHVKATGICGSDVHFWKTGRIGTLVFEGDC---------IIGHEAAGVVVRCGPGVADLQPGDRVAIEPGVPCG--------------SCFLCLEGRYNLCEAVEFSGVYPHAGTLQRYKVHPAKWLHKLPDAVSFAEGALLEPLSVALHGINSARITIGTPVVVCGAGPIGLLALAGARASGAHPIVITDVEPTRLAFAKQMVPTVVDVAKSNEDNGKAVRQLFGDAEYVQVALECTGVESSVCSAAYMVRRGGLLMVVGVGKSIMNNLPFMHLSLAEIDLRFINRY-RDTWPAGIACIEGGLV---DVKKLVSHVFPLEKALE-GLTLSSDPRNGCIKVQI......... 403
69 0.000e+00UniRef50_A0A1Q5UBM9 Uncharacterized protein n=1 Tax=Penicillium subrubescens TaxID=1316194 RepID=A0A1Q5UBM9_9EURO  ali  36  1......................................................................MGHEFSGIIEEVGEGVTQFSPGQRAVVRPTIY--------------DETCAACTQGSRHCCKNIGFIGLSGYGGGMAEYIVAPASHYYLLPDNISFEDASLVEPLAVAWHAVKRAPFKSGNNVLVLGAGPIGIGAVQVLKLKGANNIIVVELLQNRKDLARQYGATHTLDPKET-DIPKAVNDLT-GGRGVEIVFDTAGVEIALNGIIDATQVQGTIVNIAVWEERPAT-DVNDLMYREINYMGATLYDEASFKEVIENLHTGKLKPH---AMISTKIKLQDAVEKGFKKLIESRDSYCKILVDPQS..... 287
70 0.000e+00UniRef50_A0A0D6EH40 SPOSA6832_00352-mRNA-1:cds (Fragment) n=3 Tax=Dikarya TaxID=451864 RepID=A0A0D6EH40_SPOSA  ali  24  51....VLHGVHDVRY-ESRPVPQDCGPDDAIVAPKKITLCGSDVHYLEHGRI---------GDFVVNAPMILGHETAGIVTEVGNNVKNVKPGDRVALEPGKSC--------------RVCGDCKGGHYERCPEMIFAATPPYDGTLTSFYTLPADLCYPIPANMSLEEGALIEPMSVAVHAVNVAQMPHAANVVVFGAGPVGLLTCAVAKGLGARQVIAVDVQEPRLQFAKELIYDYFVSPKPAKDEAKRCAEEMQGPAGVDLVIDCSGAEVCIQTGVFLLRHGGQLVHVGM-GPSAINVPVSAILVKELTIKGSFRYGPDVYRLALDLVARGAV---NLKSLISHRYAFKDA-KLAFEANKAGKGQDGKPLIK........ 424
71 0.000e+00UniRef50_A0A1G2XV18 Uncharacterized protein n=2 Tax=unclassified Planctomycetes TaxID=473814 RepID=A0A1G2XV18_9BACT  ali  27  3MKALVKYGPNQLEI-RDVPVPKI-DADDVLLEVKAAGICGWDIEMWQHKMATSFNVS-----------IIQGHEFCGVIKEIGKNIKDFKIGERVVSETAVICG--------------KCTQCLTGNYHLCPGRKGFGY-GVDGAFADYVKVPGRCLHRIPEGVSFDHAALTEPACVAYQAVVLSKIQAGKAVLIIGPGPIGLFSVQVAAACGAYPIMVTDKDIARLEKAKQLGSDFVINVS-LENAVEFVKDQT-GGEGVPLVVDAAGNEKSLRMALDAVSSGGQITKIG-WGPKPVNFSLDTLLSKAARLQGTFSHNWPTWQAVLAMMSRGLIK---IEPMISHRIALDK-WEETFKLIEEC--HATKAIILFNR..... 348
72 0.000e+00UniRef50_A0A2U1TX07 L-threonine 3-dehydrogenase n=1 Tax=Brenneria sp. CFCC 11842 TaxID=2173106 RepID=A0A2U1TX07_9GAMM  ali  26  6MKALIKTKGEPFCMVAQIPIPEI-DPTQCLIEVKACGICGTDHSLWH------WNEAIAKSYPSMKFPMVFGHEFCGVIAEVGREVKNWRVGDRVVVNPGLHC--------------NACHYCAEGGHEVCDHRPFIGT-TVFGAFAEYCAVRSENLLKLDDNISFKVGALLEPFCVSLNAIDRVKPDFGDTVVVMGPGAIGLLMVIILKSIGVQKIIVTDADGDRLTVAKNFGAHYVINASKT-DAAAEVMELTNG-QGAEVIYDMTGFFGAVPQAVQMAAKRGRIGVTGL-PAKSSEIPMTTIAMREISIIGNRAYGNRTWFKALSMLATGQVKIDDVASYV---FPLND-FEKAMKLLDEKKG--LRILLEP....... 352
73 0.000e+00UniRef50_D1CF31 Alcohol dehydrogenase GroES domain protein n=2 Tax=Thermobaculum TaxID=262406 RepID=D1CF31_THET1  ali  28  1MKALVWQGPYSLEIVEDVPKP---DPGFALVKVEACGICGSDIHGYTG------------ESGRRTPGMIMGHEFAGTVTEVNGEARDVAVGQRVAVNPLWGCG--------------KCFYCLRGDPQICPNRLTIGVNTESGAFSEYVTVPVSNLVPIADHVSFEEASTAEPLAVALRGFHLSGLSQNDVTLICGAGTIGLCALLVCKAHGLETVFITDKLSHRLEVAEKIGG---ISVAPEDNPAERVLSSTSG-LGAKATLDAVGIGATITQSLMATMRGGKVVLIGL-ATPKVDIALYELVPQERLIQGSYAYTPDEYRQAVQLIEDGIV---DVKPLIEKVVPLSQA-PESFAALASGGDKSVKVVVKP....... 339
74 0.000e+00UniRef50_UPI0007404324 hypothetical protein n=1 Tax=Catabacter hongkongensis TaxID=270498 RepID=UPI0007404324  ali  29  5MKAAVFVADGDLRILE-VEKPEITHPNEVLIKVEGCAICGSDV-----------SVVSVPRRHPATPGTVIGHEYMGTVVETGNGVNGFSVGERVVVEPNIVCG--------------KCDMCKTGHSNLCRNMLLTGFH-YNGGMAEYSVMPDTQLHKLNQNIDFELAVLAEPLACIVNSLNKFKISAGDYCVVLGAGPIGLMYVELLKASGAAKIVVSECIDIRKEAAEKLGA-IVVDPRR-ESLAGAVMEKSNG-AGADVVIDCVG--GLMNDALGCCAAGGQVILFGLNEAAENMVRPFDISHREIRVLGSYV-VKESFPRAIRLLEDGVVRFDDV---VTHIYHLDD-IQKGFDAIKN--GEAIKVIIKCNQ..... 343
75 0.000e+00UniRef50_A0A0U2L0L1 Alcohol dehydrogenase n=3 Tax=Bacillales TaxID=1385 RepID=A0A0U2L0L1_9BACL  ali  27  7MQAVQITGPRIIRCGEEVPV---CREDEVLVKVHCLGVCATDLEIYQGTMVYFQTNQS-------SFPVIPGHEWSGEIIALGSEVQDFNVGDRVVGETTIACGH--------------CSYCQKGRYNLCPKRLENGVLGKDGAAAEYMVYPAHALHRFDASLSYEEACLIEPAAVAFRGVSKISITPEDTVAVIGAGPVGLLAVQMAKAFGAKKVVLFDIRHRRLEMGLRLGADETMNVKDGT--------RTDL---FTAVVEATGNASVVESLLDYIVPGGRISLLGLCGGKRAAFDVDQFVTYDLEMHGSLG-SPGVWKTVIELLQSGKINT---APLISHRFELHE-LEKAFQLMENKDPDILKIVLN........ 341
76 0.000e+00UniRef50_A0A1H7D675 Galactitol-1-phosphate 5-dehydrogenase n=5 Tax=Negativicutes TaxID=909932 RepID=A0A1H7D675_9FIRM  ali  26  4MKALLVEGVKEL-VYKDVPIPQV-KENEVLIKVHACGICGSDI-------------PRAKDGGVHSYPIIIGHEFSGEITELGTQVKNVKKGDRVTAAPLIPC--------------YTCDNCAKGKPAMCMNYSFIG-SRQNGAMAEYVVVPARNVVPIADNVSYEQAACIEPITVAIHGIERVKLDSGKSAIVYGCGTIGILTLQCLKAKGIEQVYVIDIDEAKLTLAKKLGAYKTINSGKVN-----VTAYFEEHGKVDYAFETAGVNALQTQILTLVKKNGHVVYIG-TAQRDITIPFELILRGELNITGSWMFPGNEWTAAVEYLKSGKVK---VDEIITHTFPLSAGYE-AFDTLLAKEKKTLKVM.......... 344
77 0.000e+00UniRef50_F4LW27 L-threonine 3-dehydrogenase n=6 Tax=Clostridia TaxID=186801 RepID=F4LW27_TEPAE  ali  27  5MKGIIKEKPEVGAAYRDLPVPEV-RDNEMLVRVKATAICGTDMHIY---------NWEKYAQERLKLPMVFGHEFAGDVVKVGSMVKNFKIGDRVAGETHIPC--------------NICYQCQTGNKHICEDMKIIGVHT-PGSFAEYISIPEDCAWRLDDSLSYETGSILEPMGVAVHGV-LSGEIGGKTIAIYGCGPIGLMAVGTAAACGASQIFAMDVFEKKLEVAKKMRADVVLKSGQ-DDVVKTVLDATYGR-GVDVVLDYSGNAKAIQEGFKILQKGGRFTMVGL-PNSPVELDLSEIIYKEAHVNGSTRLMYETWWQCSELLKSGKL---DIKPVIGGIYPIKD-YEKAFEALKNGAPG--KMIFIP....... 347
78 0.000e+00UniRef50_A0A2E7JNP5 Uncharacterized protein n=2 Tax=Gemmatimonadetes TaxID=219685 RepID=A0A2E7JNP5_9BACT  ali  29  1MQGVVKFERGDG-FVELRDLPEPPGRDQVKVEVKATGICGSDLHVYRD-----------TINYNIQTPVVMGHEFSGVVVDKGAAVDEIKIGDRVTGEPSIYCGQ--------------CDFCLSEHYNLCPDRKVMGYYH-DGCFAPYCN--ATFVHKLPAGVGFEAGALTELLACCVHSVEQAGVTAGDFVAITGPGPVGLFSALVAKAEGGTVILCTERDQERLRVAGELGIHHTIDI-EAHDPVERVRELT-GGYGADVVVECAGVAPAMRLALELVRKRGRYVQMGLPG-VPVEIDFEKIAYNELQVSGGIGQRRPAWKRALRLMEEGFIPS---AKLITHHFPLGE-WQKAFDMGEAQEG--IKLMFMPHG..... 344
79 0.000e+00UniRef50_A0A1V5YL05 Sorbitol dehydrogenase n=1 Tax=Chloroflexi bacterium ADurb.Bin180 TaxID=1852857 RepID=A0A1V5YL05_9CHLR  ali  26  12MRALVLLAPHRYEI-RQVPVPR-PGPGEVLCFVRATAICGSDPKVIDGKIAGWPPG----------YPFIAGHEWAGQVVELGEGVTGWKPGDRVVGEPHKGCG--------------TCQQCLSGNYNLCDNYGRPETGHRHGSYADYIVVGARALHRLPDSIAYAEGTMVGSAGVALHGLRLAGVEPAATGLVIGPGAIGLCAIQLLKAMGATRVICVGRAGARLNMAKQLGADAVVDVLAGQ-AVEEVLDLT-GGRGVDISVETAAADDGPTNAIKMTRLGGKVVLIGFYTPPERTIPLQSVVLKQLTLYGVKA-DPNSYRQVLSYVEAGQLT---LKPLLSHVFPLTD-FAKALDTFVNRREGAMKVVIE........ 358
80 0.000e+00UniRef50_A0A1M5EBH7 L-idonate 5-dehydrogenase n=4 Tax=Arenibacter TaxID=178469 RepID=A0A1M5EBH7_9FLAO  ali  28  1MKSYLLYGKTDIRFC-DIPYPENTDENEVIVKVRSVGICGSDIHYYKDGKI---------GDFIPKAPFALGHELSGEIEKESSLYPELKKGTRVSINPSRPC--------------KTCVHCKAGKQNLCPSMKYLGFPHLNGGFSEYVKIPAENCVPLKDFISYEMAALLEPLSVVLHALTIAGDLEGKSVLITGAGTIGQLCHMATSLYTSKPVVITDLRAAALEKASEIGVTAALNPLEP-NFEEGLFSLA--PNGFDILLEASGASTILTNTVKFVKKGGKIVQLGMH-HDNAQFPFAAFMKNELTFQPSFRFN-QEYTLALKLLEEQKI---DLTKIITKRFPFDE-IPEAMKKASNSNED-IKIVVQ........ 344
81 0.000e+00UniRef50_Q9KGB7 Sorbitol dehydrogenase n=112 Tax=Bacteria TaxID=2 RepID=Q9KGB7_BACHD  ali  27  1MKALNLYGIQDLRF-EETPAPSIEHDDDIIIKVKAVGICGSDLSRYKKLGPYV-------------PGMTFGHEFAGEVVKIGRSVTGFSIGDRVAACPTYTCGQ--------------CRYCQLGEPTRCERLSVIGA-RHPGAYAEYVKLPAKHVIPLPNVVNYDEAALIEPASVVAHGFYRTNIKPGASVAIMGVGSIGLLAVQWAKIFGATTVFAIDIDEQKLNVANQLGADVLISSLQRP-AHKQILEYTNG-IGVDVAVESAGTPSTSAQVFALPKKGGEVVFLGIPYADVQRFYFEKIVRNELHVYGSWNFPGKEWATTIHYMSSGQL---NVAPMISYRLPLAKGPET-FQQIAKGELKPTKVLFYPEKLSERK 354
82 0.000e+00UniRef50_A0A1H2W5V8 L-iditol 2-dehydrogenase n=1 Tax=Tepidimicrobium xylanilyticum TaxID=1123352 RepID=A0A1H2W5V8_9FIRM  ali  29  1MKAAVLEELKTI-VVKDVPDP-ICEDGDVIVKVHACAICGTDLRTFNFGH------------RNIVLPHILGHEISGEIVEVGKNVNNFKVGDTVSVYPAIACNE--------------CDWCRRGYQVRCENTLQIG-DELPGGFAQYVRIPEKSLIAIPKNMDHKQAALAEPLGCVLNGQELSDIGLGDTVVIIGAGPIGCMHAMLAKAQGANKVIMADIKDERLELAKRVNADYYVNSSK-ENLLEKILEFNDGRK-ADVVIVACNVTKVVEDSLELLDWEGRLSIFAGMPKDMVTVDANIVHYKDIKLVGSYGSTYWQHVTALNLIKDGVL---DIKNIITHELPLED-IDKGLELV--RKGESLKVVVIPW...... 346
83 0.000e+00UniRef50_UPI000DB9CF30 alcohol dehydrogenase n=1 Tax=Bacillus sp. YR335 TaxID=2135743 RepID=UPI000DB9CF30  ali  28  5MKAAMFIEPRKIEI-QQVNIPEI-ADDEVLIKVKYCGICGTDMHIYNGDY------------SKEKLPLIAGHEFSGIIEKTGSGVKRFRGGEKVTADINLSCG--------------TCYYCRLDQPFLCSEMKQLGIH-MNGAFAEYVVVPQDKVYVLPESMDFKDAALLEPISCVVRAAKKLNLSFAESVAIIGDGAVGLMHVQMAKICGAAPIIVIGLDEDKMKKAKELGADYVI--KSDADMYSKVKNLTEGR-GVDLVIEAVGLKITNEQAFELVRPGGRIMPFGLADQNIIGLKPLDMVLKELTMVASVAGANNDIAQAITLVQYNKFKLDDYK---TTVMSLDK-ISDAFHVIKTNK-NLFKVLIK........ 342
84 0.000e+00UniRef50_A0A0K9G8W9 Uncharacterized protein n=9 Tax=Firmicutes TaxID=1239 RepID=A0A0K9G8W9_9BACI  ali  29  1MKALLKTKKG-INGVEEIEEPQVKS-HELKVKIHATGICGTDMHIIHD-------------EYSCNYPVVMGHEYSGTVMEVGNKVTDYQVGDRVV-------------SLTAAVKCEDCVYCRSGLYMLCEERLSIG-SGVNGAFAECMVIPEKIAFKIPNNVTLDEAVLTEPLACMVRCVERGTVKAGDYVLVSGPGTIGLLTMQVAKANG-GNVIVIGTSQERLKLASELGAFATIVIDE-EDVHEKISKLTSN-LGVDVAFECAGVGPSAYNCLKLLKKTGLYVQVGLYGKK-VEFDMDLALTKEINITNGFASEPTSWERALRLLEMKQV---NVAPLISTKLPLDD-WKKAIEMVDNK--DAFKVLFVPNGEID.. 346
85 0.000e+00UniRef50_A0A0Q9N0S6 Uncharacterized protein n=8 Tax=Firmicutes TaxID=1239 RepID=A0A0Q9N0S6_9BACL  ali  27  1MKAAYYYGIGDIRI-EDVPIPDIQN-NEMLVKVKACSVCGTDNRIYRYGHFKVPEGVK----------RVLGHETSGEVVQVGSAIKGFQVGTRVALPPNVGCG--------------TCHMCIRGYNQLCPNYQAFGIS-MDGGFAEYVKVPSSNVIKIPDHVSYEEAAIAEPLSCVLHAYEAHRTVPGDTVLIIGPGPIGALHVMMNKMAG-GRIIVAGRSDARLEQIKQYGADIVINNRES-DLKEEIDRITDGR-GVDVVITSNSDPEMQKVALEVAGYHGRVSLFGGLPKGKVTLNTNLIHYKELLVTATTGSSLLDVHKAMDMISTGKI---DVKSLITAKFSIEDTV-AALDYAAQGAG--MKALIT........ 343
86 0.000e+00UniRef50_A0A2X4UA95 Sorbitol dehydrogenase n=3 Tax=Proteobacteria TaxID=1224 RepID=A0A2X4UA95_9GAMM  ali  25  6MSAAVLHAPGDLRY-QSVAMPELTEQRNVLVKVRATGICGSDI-------------GRVLNFGTYNFPTVPGHEFAGEITDLLPEVTQFKVGDRVAIAPLMPCHQ--------------CSSCQRGNYSLCDNYDFLG-SRSDGGFAEYVSVPEQNLIRLPDNVTYAEAALIEPAAILLHGIHKINLSLGDKVAVIGCGALGYFAIQFARLSGA-EVIAIDVAQDKLDLAKQAGADVCINAA-DVDAVKEVLALTAG-QGVDRVFECAGNNISRQTGLSVLRKQGTMLIFG-SAHSDVSFPFEKILRHELHIVGSWNFPGREWFEIVNLLGKRQLQML---PFVSHRFSLAEA-PAVFARFKEKTGSYNKILFEMKE..... 354
87 0.000e+00UniRef50_A0A1V5RU29 D-arabitol-phosphate dehydrogenase n=7 Tax=Bacteria TaxID=2 RepID=A0A1V5RU29_9SPIR  ali  27  1MNALVLTEYKNLSY-QKVPKPVITSPTQTLVRIKAASICGSDVHGYDG------------STGRRQPPLIMGHEGSGVIEEVGSMVTNFKVGDRVTFDSTIFCG--------------ACPFCKQGLFNLCDNRRVLGVGKQDGIFAEYAIIEERVLFHLPEGLSFEEAAMVEPAGVAAHALSLASPSLHDDVAVVGAGLIGLLVIKLLRTVTSGKIIALDIDEKRREMALKVGADYAFDSTDPA-LSRKIMKLT-GDLGLKVVYEAVGATAPIQTAVSLARKGGTVVLVGNVSPK-IELPLQSVVTRQIRLQGS-CAINGEYPAVLKMMADKVL---DVTDLISKTAPLSEG-KLWFDRLYNKEGDLLKVVLIP....... 344
88 0.000e+00UniRef50_A0A1H4A4M7 Galactitol-1-phosphate 5-dehydrogenase n=2 Tax=Selenomonas ruminantium TaxID=971 RepID=A0A1H4A4M7_SELRU  ali  30  7MKALVIEANDKL-VYKDIPVPPL-KDDEVLVKVKACGICGSDI-------------PRVLHNGTHFYPITIGHEFSGEIAATGAKVNKYQEGQRVTVAPLIPCRE--------------CEACEEGHPAMCSHYSFIG-SRQQGAMAQYVAVPARNIVPIAPEVSFVQAAVIEPITVAMHGVERAGITSGKSALVYGCGTIGLLTLECLRAKGLEKVYAIDIDDNKLAMADKLGAYKTINSQK-EDVEAFFKEL----GGVDYAFETAGVPFLQAQILELTKKKGTIVYIG-TAHGEVKFPPQKILRGELNITGSWQFPGSEWQAAAELLKSGKLQVDD---LITHQYPLSAGIE-AFHTLTDRQSGAIKVM.......... 347
89 0.000e+00UniRef50_F0YYI8 Alcohol dehydrogenase, zinc-dependent n=2 Tax=Clostridium sp. D5 TaxID=556261 RepID=F0YYI8_9CLOT  ali  28  1MKAAVIRNPRRIAI-EEMEIP-VCKPDEVLVHVKACGLCGSDIHGFMD-----------EASKGRVAGLVMGHEPSGIVAECGENVEGYRPGDRVVINPQFFCGE--------------CYACKHSWFNICENGGIIGSSFKQGAMAEYVTVPKENLHVLPEGLSFAEGAMIEPVANAIHAVNRAGVKIGDCVAVVGAGTIGLCMIQAAKLAGAGCVAAIDISDFHLDMARRLGADIVINSAKM-DSIEEVKKNFHG-IGADVTLEAVGIGETYRQASLMTRKRGTLVLFG-AAKETALIHLYPFLHRELNLVGCTGFDAEV-DIGLQMLLEGKMQ---VQPLITREYPIEETAE-AIHAAVSESNDILKIVL......... 342
90 0.000e+00UniRef50_A0A1C5WTT3 Sorbitol dehydrogenase n=20 Tax=Bacteria TaxID=2 RepID=A0A1C5WTT3_9CLOT  ali  25  11MKAIVAYAPGDYRF-EVVDTPRA-GEGEMILKVEACGICAGDVKAFHGAKSFWGGDGNPP---YIKAPMIPGHEFVGRVVEIGDKVKGWKIGDRICPEQIVPCGE--------------CMFCKTGRHWMCEKHDLFGFNNVNGGMAEYVRLKEALPYLVPADMPVEKAALIEPYACAFHCVDRAQPKTTDFVVQSGAGTLGLGMIGALRQANPKCLVVLDMNDERLKKAKEFGADIVMNPGK-EDVVSKIKEMT-GGYGCDIYIEATGHPSSVQQGLDCIRKLGRFVEFSVFGEK-VSVDWSIISRKELDLLGV-HLSPYCYDTVIEWIDNGKLPTAGV---VSHKFPLEK-WEEGFHLAQTGEDGAMKVVLVPGMEG... 366
91 0.000e+00UniRef50_A0A1B9IYQ1 Uncharacterized protein n=5 Tax=Dikarya TaxID=451864 RepID=A0A1B9IYQ1_9TREE  ali  26  25..............VEKRKGPSRPGPYEVVVAPQWNGLCGSDMHIYL---------TALLGEEKMKEPFVLGHEASGIVVQVGEEVRGLKVGDRVALEPGEGCG--------------RCGDCKKGAYNHCDSMRFAAADGLDGTLQGLYKLPADLCYKLPEILSLEEGALTEPLAVAVNAINIANLPHSANVVVFGAGPVGLLTMSVAKALGARRVIAIDVQQQRLDFAKSYVASDVFVARHAEDI-KRSLGITDGIESIDVVIDCSAAEVCMQTGMWLLRRKGTYVQVG-CGPLYVNLPMRIIADRELTVKGCFRYGPGVYPMAIDLVSRGLI---DLKPLITHKYDWRDAVS-AFKTTKAGTGEAIKVM.......... 373
92 0.000e+00UniRef50_A0A2V1C8S5 Putative D-xylulose reductase A n=1 Tax=Cadophora sp. DSE1049 TaxID=1485229 RepID=A0A2V1C8S5_9HELO  ali  25  377.....LYSPG-VAKIEEAPYPTIKDQHDV-------------VHFWNHGGIINKVDPLH--------PLIMGHEASGTIHEIGTAVTSLKIGDKVAIEPGYPC--------------RRCKSCRAGRYNLCPKIKFAAAPPNHGALTKYFKLPEDFCYKLPDFMGLDEGVLVEPLAVAVHASRQADIKSGQTVVVFGAGTVGLLCAAVARAMGASKVVSVDVNDSRLEFAQKF-ADATYHPASAEDTANKIIDSNKLDEGADVVLEATGVASCIEAGISVAKRGGTYIQVGL-GKSKIEFPIVKLSEKEINMKGCFRYNAGDYDLALHFLESRKVSVKD---LITGVEPFERAT-VAWE--RTKKGDGIKNLIE........ 706
93 0.000e+00UniRef50_A0A1M4XVS9 L-iditol 2-dehydrogenase n=1 Tax=Thermoanaerobacter uzonensis DSM 18761 TaxID=1123369 RepID=A0A1M4XVS9_9THEO  ali  27  1MKALRLYGPNDLRY-EDIPIPEI-KEGELLVKIHSCAICGSDLRNVKAGG----------SSHGMTLPRVLGHEAAGEIVKIGQGVHDFKIGDRVLLSVTVPCG--------------KCDYCLKGITNLCDNKTALSYQ-YDGCFAEYVAVPSQLVIPIPDNVNYDAAAIVEPISCVLNGQELSQVGLNDTVVIIGAGPVGVFHAIIARILGAAEVIISEILEDRIEIVKQLNADRVINPQK-EDFISNVLKVTKG-QGADVVIVAAPSREAQEQALLVAKKRGRINFFGGLSKGNISIDSNLIHYKELFVHGTSDSTVIHMKKVLKLIKDGRINT---SKLITTTFNISE-YKEAFEFASSGK--ALKVIIKP....... 348
94 0.000e+00UniRef50_A0A1I0M299 L-gulonate 5-dehydrogenase n=2 Tax=Clostridiales TaxID=186802 RepID=A0A1I0M299_9FIRM  ali  29  1MKVMKVIEPGKLECLEE-PIPELKDEKSVLIKVHAAGICGSDISIYRGTSP------------VATYPRVIGHEFAGEIVKIGTEVTNVKLGDHVAVNPVIGCGC--------------CRICLKGRSNVCENLSVIGVH-VDGGYREYVDVPAMNCFAVSKDMPWEKAAIIEPYTVAAQVTSRGGVSEGDIVLILGAGQIALTVLQVCKLLGA-HVIITDLVEERLIRAKEYGADEVINTL-NQDIYERVLELTDG-IGADVSIDAACVGKTLEQAAKCTRNAGVVVTMG-FADRQVPITELQITKNELDIRGS-RLNNNKFPQVIEWIESGKL---DPTRIITDRLSFTEVL-TGINKVKEDPEHTMKVILT........ 337
95 0.000e+00UniRef50_Q1Q2R9 Similar to sorbitol dehydrogenase n=180 Tax=root TaxID=1 RepID=Q1Q2R9_KUEST  ali  29  1MRVAMYYNNNDVRI-EEMPTPQI-GPGELLVKIFASGICGSDVMEW---------------YRIKKAPLVLGHEIAGEIVAIGDAVKQFKVGDRVTVAHHVPC--------------NTCHYCLNGHHSVCDTLRT--TNFYPGGFAEFLRVPQINVFILPQEMSYDEGTFVEPLACSIRGQRLSNFKPGQSLLVIGSGISGLLHIQLARALGAGKIFATDINEYRLKFAKKIGADIAINAK--EDVPSIIRKDNNGRL-ADLAIVCTGAISATEQAFHSIERGGTILFFAPTPGVKIPIDLWNLWRNCNSIVMSYAGPPADMAVAIELIRTGRIAVND---LITHKLPLNDAA-KGFKLVADAK-ESVKVIIAP....... 339
96 0.000e+00UniRef50_D9TQJ5 Alcohol dehydrogenase GroES domain protein n=1 Tax=Thermoanaerobacterium thermosaccharolyticum (strain ATCC 7956 / DSM 571 / NCIB 938  ali  27  1MKAAVIKSKGVI-IFENIEKPK-PKQGEALIKIKACGVCGSDLRIYRETY---------------HYPLVAGHEMSGIVEEVGEDVDKSIIGKRVAIFPLIPC--------------RKCASCETGNYAQCSNYNYLG-SRTDGGMAEYVVAPIWNLCPFDDRVSFEEGAMIEPATVAQHALRNARIDIGSNVVIYGAGPIGLLVAKWAKISGATNVMMVDVDEMKIDFAKKVGFDLIINSGK-EDPIKWIKDIT--KDGADIAVEASGSYKALQQCIESIKNFGKVILLGN-PDSDMNIPLSKILRKEATLKGSWSLNKNEWKTTINTLESGRLKLSD---LITHKVKIEDLPET-IEKMHNKDIFYTKVL.......... 341
97 0.000e+00UniRef50_A0A2W6BC63 NAD(P)-dependent alcohol dehydrogenase n=1 Tax=Acidimicrobiales bacterium TaxID=2201156 RepID=A0A2W6BC63_9ACTN  ali  27  7.RTAVMDGIGRLHI-EERPVPQ-PGDRELLVEVRSVGVCGSDVHFFEHGPRLN----------VFKPPHVLGHEVSGVVAAHGPRATRPPIGTRVAIEPSRPCGI--------------CSLCRGGRYNLCPQMRYLAAPPTEGGFARYLTVPEDFAYPVPAQISDDAAALIEPLSVVVHAARCAEIGVGARVLVSGAGPIGLLMTQVARAIGAIEVNVSDINPFRLSLAETMGATRVIDVSAATPSAVRLE--------VDVFIECSGNPVALPDGIRCVRPGGVAAVVGMIPTEDATIPLAFMQTREIRLVPTFRF-ANSYAAAIGLVATRAVRP---EAIITGHLPLDR-VETALRAGRNDP-RSVKTMIT........ 339
98 0.000e+00UniRef50_I9L5W1 Alcohol dehydrogenase GroES domain protein n=2 Tax=Pelosinus TaxID=365348 RepID=I9L5W1_9FIRM  ali  25  2MRAVVLAGPNDFKAGQ-IEMPKV-GDHDILLQMKKAAICGTDIRILEGK-----------KTKDVRYPSVIGHEMCGIIKEAGKQVQGFNPGDKVAIANVIPC--------------HSCHSCLNGRENACLNRKAIGY-EFNGGFAEYVLVPSGNVIKLPEHVSFAEGALIEPLACCIRGLKNAGTGFNDTVLIVGAGPIGLMHLQLSKIVGARKVIISEPIASRREKAAKLGADLIVDPM-AENLHEIVMKETDG-LGVDVIVVAIGVPQVVNSTIKLCRKGGTVNLFAGFGTGECTIEVNTIHYGEINVNGSTAYKRQDYLEAAQMVIDQKV---NLEEIVTHRFKIEE-FQQAYEVCKSGEG--LKVVIEP....... 346
99 0.000e+00UniRef50_F9X9W6 Putative L-Arabinitol 4-dehydrogenase (Fragment) n=15 Tax=leotiomyceta TaxID=716546 RepID=F9X9W6_ZYMTI  ali  27  35....................PELPGPNDCVVRMRCNGICGSDVHFWHTGCIGPLT---------VTAPHVLGHEGSGSVVWAGSNVTHLLPGDRVAIEPGVPC--------------STCYQCTSGNYNLCADVAFSGVPPFSGSIRRWHVHPAAFLHKIPDELSFSDGALLEPLSVVLHGFERSPIKLGESTVICGAGPIGMCALAVAKASGAAPIVITDLDAGRLEFATEFAPGQIVPGVSAQDTAVDILQQKAGGDQPRVVYECTGVQGSVVTSCYLPRPAGEVMVIGVGRPIMNEMPFMHMSLAEVDLKFINRY-HHSWPMAIRLLQHKVI---DLQPLVTHRYKLEEA-QKALEASADRNSGSIKIHIE........ 367
100 0.000e+00UniRef50_E8N178 Putative L-threonine dehydrogenase n=4 Tax=Bacteria TaxID=2 RepID=E8N178_ANATU  ali  28  1MKAVRIVQPHQVEIV-DLPIPT-PGEKEILIRVEASGICGTDLHILRGEYMG-------------NYPVIPGHEFSGTVVETGAGVTRFRVGDRVAVEPNLSC--------------DACEECLNNRQNFCRNWQAVGV-TLPGGMAEYVVVPEKAAFAVGD-LPAEQAAFMEPLSCVLHGMENLSPRMGDRLLIIGAGPIGIQLMRVARLQGAAHITMVERNPARLMFAAEAGADRALSSLDDLSP-----------DSFDAVIDATGVPAVLARTLDYVRSGGKVLWFGVPSDATMALEPFKIFRKGLTVMGSFTSKRNSYQ-AVALLQSGALRVDD---LISHRLPLADFL-RGCELLEQGAEGVKKVMILPQ...... 330
101 0.000e+00UniRef50_K6DR25 Alcohol dehydrogenase GroES n=17 Tax=Bacillales TaxID=1385 RepID=K6DR25_BACAZ  ali  31  1MKALLKTEKGVGNVLLEVPEPD-CSKDKVKVNVAFTGICGTDLHIFHD-------------TFKSYPPVIMGHEFSGVVTDVGEEVENVKVGDRVAI------------LGSHAVTCKTCYYCKTGYYMFCESRRGMG-HGVDGSFTKQVIVREDMIYKVPESVSLEEAALSEPLACAVQAIELTDIKLGDTVLLSGPGPIGLLCLSLLTLKGC-KIIVAGTSQDRLEIAKQLGADIIVNINE-VKLQDVVMKETKGR-GVDVTIECAGVAASINSCLNALKKLGRHIQVGIAG-KEVTLDYDTILYKQIQLFGSLAHSMKTWDRVMQILEQKKI---NLEPIITHKLPLSQ-WKEAFNMCEEKS--CGKILLT........ 341
102 0.000e+00UniRef50_A0A2E1VLB0 Alcohol dehydrogenase n=12 Tax=Bacteria TaxID=2 RepID=A0A2E1VLB0_9PROT  ali  27  5MQAAVLHAENDLRY-EEVNRPN-PGPGQVLLRVHTCGICGTDSHIVKGRFPTP------------NKPVILGHEFAGEIAAVGSDVKHIKEGDRATADINTACGH--------------CEYCRNNQKLFCPEILQIGVHT-HGGLADYVIAPAENIYILPKNMPFNHAAYIEPLACAIHGQKRIQVDVGETVLILGAGPMGLTHTALSKKRGAGQVLVSEPNIKRREIAHKLGSDKEFDPTNPETL-DMIMEATNGR-GADVVIEAVGSSVTYKQSFDLVRRGGKILAYGAAATDVVEIKPFEIYAKELTIVGSYAGSYETWPAAIALISSG................................................. 307
103 0.000e+00UniRef50_O34788 (R,R)-butanediol dehydrogenase n=1424 Tax=root TaxID=1 RepID=BDHA_BACSU  ali  36  1MKAARWHNQKDIRI-EHIEEPK-TEPGKVKIKVKWCGICGSDLHEYLGGPIFIPV-DKPHPLTNETAPVTMGHEFSGEVVEVGEGVENYKVGDRVVVEPIFATHGH------------------QGAYNLDEQMGFLGLAGGGGGFSEYVSVDEELLFKLPDELSYEQGALVEPSAVALYAVRSSKLKAGDKAAVFGCGPIGLLVIEALKAAGATDIYAVELSPERQQKAEELGA-IIVDPSKTDDVVAEIAERTGG--GVDVAFEVTGVPVVLRQAIQSTTIAGETVIVSIWEKG-AEIHPNDIVIKERTVKGIIGY-RDIFPAVLSLMKEGYFSAD---KLVTKKIVLDDLIEEGFGALIKEKSQ-VKILVRPN...... 346
104 0.000e+00UniRef50_A0A0M0JEC3 Sorbitol dehydrogenase-like protein n=1 Tax=Chrysochromulina sp. CCMP291 TaxID=1460289 RepID=A0A0M0JEC3_9EUKA  ali  25  1MRAAILTGLKTIEIVE-RPV-ADPAKGEVALAINAVGICGSDLAYWAQGVAGGFKKLDFSAEGLCKYCGQMGHECAGTVIAVGEGVDSLVVGDRVALEPGVPCG--------------TCQHCRKGRYNLCKSMRFIGVNEVPGAMVTRFNHPAAFCYKLPTHISLDEGAMFEPLCVALQAVRRARVGIAMRVLITGAGPIGLMTLLAAKAAGATVLAITDMVDAKLVVARTLGATYTFKANTP-NLVSVAQQAVGGE--FDVTFECSGVVPALDLCVSATGSGGVLCVVANYKADEAPVRLQELARREIDLVGVYRYC-NLYPTALELVSSGAV---NLKPLISRKFSLEQAGH-AFEYFAT--GEPIKVLITPNE..... 358
105 0.000e+00UniRef50_A0A0T6A526 Threonine dehydrogenase n=21 Tax=root TaxID=1 RepID=A0A0T6A526_9BACT  ali  26  1MKAVVFYRPGDIRF-EEVATP-APGPGEVLVRIGSALTCGTDLKTYRRGHPVMIK----------KTPALFGHEWAGIVEAVGEGVESVRGGDRVVGANSAPC--------------HLCFPCRMGRVNLCEDLQFL-----NGAYAEYIRVPARNLLPLPEHLSFAEAALVEPLACSLHGIERSGVRLGETLCIFGAGPMGLLLTQLAKRQGV-KVIMVGKGQFRLTKAAEAGADEILDAAQGERVLAEVRRLSPEGRGAAVTIEATGRPEVWEQAVEVTRKAGTVVLFGGCPGTSFRVDTRRMHYEELMLIGVFHHTPRHIREALGLLEQGLVNT---KILLTHQMALS-SLPEAFELIA--RGEAIKVALTP....... 342
106 0.000e+00UniRef50_A0A0F0CGJ4 Putative zinc-type alcohol dehydrogenase-like protein YjmD n=29 Tax=Firmicutes TaxID=1239 RepID=A0A0F0CGJ4_9CLOT  ali  30  1MKGNYFLGDKKFRL-DEIPVPE-TGEHDVLIRVAACGICGTDVHIYHG----------SKGSAEVHPPVILGHELAGVVEKTGSAVTTVKPGDHVTVDPNSYC--------------SKCHYCKIGKKQVCESLYAVGVNR-DGGFAQYCAVPETQCYQLDKEIPLKYGAMTEPLACCIHGIDRIGLVPGNTVCVIGGGAIGLIMVQLAKLSGASKVVLSEPVSMRREIGMKVGADAVIDPVH-EEIGQRLTEIL-GTPGADVVIECVGIPAAAEQAFKAAGKGAVILLFSVPPGSTYAMHLEEIFQKELTIVGSII-NPDTHGRAVALINSNAIQ---LEPLITHSFPLDQ-LEQAI--LAQQSSESIKVIVEP....... 340
107 0.000e+00UniRef50_A0A1G3ANU7 Uncharacterized protein n=1 Tax=Planctomycetes bacterium RBG_16_64_12 TaxID=1801971 RepID=A0A1G3ANU7_9BACT  ali  27  1MNALVLYAVGDAR-SERVPRPKA-ASGEVLVRVAFCGVCGSDI-------------PRTFVKGTYHFPTICGHEFAGTVEACGEGVDDYAPGDRVVVFPLLWCG--------------RCASCELGSYVQCSDYDYYG-SRRDGAFAEYVAVPVRNVIPVPDGVSLEAASMTEPAAVALHALKRAGGGVGETVVIFGAGPIGLMTAQWARTMGAAQVILFDLIPEKLDMARRLGFQRAFDA-RGADPIEKVKELT-GGHGAEVCVEGAGVPVTLNQAIAAARVGGRVVILGNPSAD-VTLPISQAMRRELDILGTWNSNNDDWRAVL---AAAASGAVDLDGLVSHRVPLENAF-KALLMMRDQSEFFAKVLIQPQRN.... 351
108 0.000e+00UniRef50_N9ZPV1 Chlorophyll synthesis pathway protein BchC n=8 Tax=Bacteria TaxID=2 RepID=N9ZPV1_9FIRM  ali  28  1MKAGVVHAKNDIRF-EEIKTPK-PGRGQVKIKVKYTGICGSDV-------------PRVNGDACHFFPNVLGHEFSGTVVETGEGVESLKAGDRVAGVPLVPCME--------------CEDCLKGDYSLCKHYSFIG-SREYGSFAEYVVVPEKNAVKFDEDVSFEQGAFFEPATVALHGLMRLDYKGGKTVAILGGGTIGLFTMQWARIFGASKVVVFDITPERLDLAKKLGADAVVDTRE-EDYLKKAMELTDG-AGYDYVYETAGNTVTIKMAFGLAANKAGVCMIG-TPTRELSFSVAEMNRKEFMLTGSWMFPGKEWEMAAHYFQTGQLKFDD--SLIFKKVPLAK-IADAFEMYKVPGTVKGKILVDSEQEA... 351
109 0.000e+00UniRef50_R9P2L7 Uncharacterized protein n=4 Tax=Ustilaginomycotina TaxID=452284 RepID=R9P2L7_PSEHS  ali  24  132......THKKELELIK--SAPAAPGPGMALVHVRATGVCGSDVHFWKHAGLGPWKIESQCA---------LGHESGGIVIAVGEGVDNVSPGDRVAIEPGVPC------------FKATCDFCRTGKYNLCPTVDFYSVPPKDGTLKRYHEHPAGWLHKVPDNMSYEEIALLEPLSVTLQATLQAEISLGTPVLITGAGPIGIVQLLCASAAGATPIVITDVVQDRLDFAQKIVPTYQIDPKKSESATEICKSKASGKHIAEITMECTGIESSIQTAAYATAASGLVFVIGV-GANFQQIPFMHLSTNEITLKFLFRY-RDTWPRAIRLVSSGKI---DVKQIVTSRFPLEKA-KEAVEHAADRTKFSVKTIIYDDEE.... 489
110 0.000e+00UniRef50_A0A1C7ID01 Alcohol dehydrogenase n=7 Tax=Clostridiales TaxID=186802 RepID=A0A1C7ID01_9FIRM  ali  24  1MRSAVFYGKHDLR-VEEHEMPAV-GPHDVLIQVKACGVCGTDVHIYEG----------DKGAAEVTPPTILGHEFSGVIQEVGSQVKNYKAGDRVCIDPNCYCG--------------ACDPCRNGVAHYCENMIGYGT-TVDGGFAEYCAVDERQVYLLGGNTTFEQGAMAEPVACCLHGIDMCEIQPGHQVVVIGGGMIGLLMLQLAKLAGAAKVALLEPVENKREVGRKLGADVCIDPLK-EDIKGRLAE--CGMSWVNVVIECVGRPSTIEQAIDIAGNKAVVMMFGLTPDEEIAVKPFQIFQKELVLKASYI-NPYTQRRALDLINSGRL---DVSSMVYAVCGLEE-----LEDVLGRPEANGKYVIDPGK..... 341
111 0.000e+00UniRef50_UPI000A2A4779 sorbitol dehydrogenase-like n=1 Tax=Exaiptasia pallida TaxID=1720309 RepID=UPI000A2A4779  ali  28  9...VVLHGKDDLRIE---PRPVAPPNGEVQLAIQTVGICGTDIHFWKHG---------EAGGDVPNAPVVLGHESSGVVTALGEGVTHLQIGDRVTIEPIVPC--------------HTCQDCKEGRYNLCKKLRYFAVPPYQGSLCRRLNYSAHYCYKIPDHVSFEEAALMEPLSVAIHGCRRAGVTMADYVLICGAGAIGLMTLLTARACGAAKVAITDINESRLAKAKELGADYIIKV-ESKDGKEVAKKVIEVMGSVDKTVECTGVESSIHAALYATKTGGTVSIIG-XGENVIQIPIVEAIMREIDVKGVFGY................................................................ 296
112 0.000e+00UniRef50_A0A2L2XAJ9 Alcohol dehydrogenase n=2 Tax=Desulfocucumis palustris TaxID=1898651 RepID=A0A2L2XAJ9_9FIRM  ali  28  2..AAVVIEPGKLEI-QDLPVPGL-GKNDVLVKVASCGVCGSDVHAFEGNH------------FRTTYPRVLGHEFSGVVAEIGSGVTNFKCGDRVCAETNIPCG--------------VCKICNSGLPHLCKSVIVIGFN-ADGGYAQYVKVPADNLIPVPHNMTLDQATLTQPLGVGYKAVDHSCVEEGTTVAVLGAGPIGLGAIATASARG-GNVIAIDLFEHKLKTAKKMGAMEVIN-GKEEDVVSKVLELTDGH-GVDAVFECAGGDQTIQQATQIVRRRGEVIVVGTFGKKGARVRMNDLRAGEITIKGTRG-QYKKYAPCLEMVSNGQI---DVMPMLTHTVSLENTL-RGIELMAGKTNQVIKVLLKPND..... 343
113 0.000e+00UniRef50_G1XV21 Uncharacterized protein n=2 Tax=Orbiliaceae TaxID=47021 RepID=G1XV21_ARTOA  ali  33  5MKALRYHGAKDLR-VESVPIPELL-PGQVKVKPEWCGICGTDLHEYITGPILTPAVGKPHRLTGCTVPLIMGHEFAGEIVELGPGVERLKVGMKVCIEPALF--------------DDTCPPCLDRRRNCCDRGGFFGLSGWGGGFSEYACLQEKLVHPLPDNVPTDIGALVEPLAVAWHALKAAGHTPD-------------------RXRGCRQILISEVSPQRIKHALEIASSHVLDPTK-EDVVVRAKELCSGNQGPNVVYDCAGVQKSIDAAIGAVRKGGVVCNVAVWEKPP-SIDMNALVFGEKKLIGVALYDEGDFQEVIEAISTGKIR--NPEKLITAKVALDDAVTNGFEALLKSR-EHVKILVRP....... 367
114 0.000e+00UniRef50_UPI000A00C56C hypothetical protein n=1 Tax=Paenisporosarcina indica TaxID=650093 RepID=UPI000A00C56C  ali  28  5MRALTFYAPKDLKVVE-VPIPVI-NEDELLVRVSYAGVCGTDNRIYQGTKI-------------IEGPRIIGHEFSGVIEKVGTNVQSFSVGDHVTVYPMISCGD--------------CYTCKTGRKNICVNRKTIGY-EIDGGFAQYIKIPKGNVFKVSSNLDQKVVAITEPIAAALNGIKRANIQQGDCVVIIGAGPIGLFHVQLAKLKEPGILVVIEPDHAKREIALKLGATHTINPF-DENPEIRLKELTDG-EGADVVIIDVGIPKIIEESIEYVKKGGTYVIFAGAPHGKISLDPNLIHYKEINLTGSSAATPELHQEVLDLVESGQV---DVTLLISEVVGLDE-WERALEM--KNSFQKIKVIIDPW...... 348
115 0.000e+00UniRef50_J5SG43 Sorbitol dehydrogenase n=3 Tax=Tremellomycetes TaxID=155616 RepID=J5SG43_TRIAS  ali  26  15....VLHGVHDVKI-EERPIPEIEG-DQVLVAISKTGICGSDVHYLEHGAI---------GSFVVKEPMCLGHESSGKVVKLGPKVANLAVGDRVALEPGMGC--------------RVCEMCKSGKY-------------EYGTLCRYYKLPYDLLYKLSDNVSDEDGAMMEPLSVATHALNLAQLRSGENVVVFGAGPVGLLCMAVAKALGAARVVAVDIQKERLDFAKSYAATDIYLPKEGEDLAATLRETLNGLSALQVCIDATGAPVCIGTGLQLLAPAGRFVQVGM-GPSTVPIPMFAIVTKQLKVLGSFRYGEGDYPLSISLVSRGLV---DLKPLVTHRYAFKDA-EEAFNITKNGHGKDGKPVIKC....... 360
116 0.000e+00UniRef50_A0A163AGE2 Oxidoreductase n=1 Tax=Didymella rabiei TaxID=5454 RepID=A0A163AGE2_DIDRA  ali  35  55.KAAQYFGQCDIRVV-DVPAAE-PQAHEALIDIEWCGICGSDLHEYLHGPLACPPPSNPHPATKEHIPVTMGHEFTGRVLSAPAN-SGLAPGTPVIVDPRIFC--------------RSCSRCMDGHTHGCTVLGFKGLSGTGGGFSERICVDAKMCHVLPEGTDLSLATLIEPLAVAWHALATTGLNANRSVLIIGGGPVGVACTIVLRAFGCKCVVVSEPTEVRQKQNKKV-ADVVLNPIK-DDVGGRCRELTAG-EGVNVVLDCAGNQKGVEAGMDALRYRGMYMNVALWLGSPMQIPFFPFMLKEITIKCCLAYNDQEFKDVVEAFVAGKFH--GIESMISSKIHIDDIVEKGFEELITNKDQHVKIL.......... 405
117 0.000e+00UniRef50_D8J6I4 Zinc-binding dehydrogenase n=1 Tax=Halalkalicoccus jeotgali (strain DSM 18796 / CECT 7217 / JCM 14584 / KCTC 4019 / B3) TaxID=795797  ali  27  1MKAAELVDAGRFEL-RDRERP-APGPTDVLVEVSDVGICGSDVHWYDHGRM---------GERSIDEPLVLGHESAGQVVAVGRDVDRVAVGDEVAIEPGVPCGH--------------CRYCRDGRYNLCPDVEFMATPGTDGAFREYVSWPAEFVHELPPTVSTREGALCEPVSVGIQAVRRADLDVGDSVLVMGVGPIGLLTMDVARAAGAATVAVADIVPSKLDRATDRGADLAIDSRT-EDVGDTLREEFDG--GVDVVIEATGAPPAIEAALDAPRPGGTAVLVGLAPGETVPMDAFETVRRQIDIRGSYRF-ANTYPTALSLLGANEVDATGT---IDVEMPLER-IGDAFERAKTP--DVIKGLLSVN...... 341
118 0.000e+00UniRef50_A0A2I9CWG9 Threonine dehydrogenase-like Zn-dependent dehydrogenase n=4 Tax=Terrabacteria group TaxID=1783272 RepID=A0A2I9CWG9_9DEIO  ali  30  9.RALMFEAPWQMPL-REVEAPQ-PGPGEVLIRVRAAGVCGSDVHGFTG------------STGRRRPGVIMGHEFCGTVEALGEGVSGHAVGERVVVQPIISDG--------------TCPECRAGRPNLCLNRRGIGWS-VNGGYAEFVSVPGQNALPLPDEVGWQEGALVEPLAVALHAANLTPLSVGDTAVVLGAGPVGLLTVLALRLRGAGRVIVSDLSGHRLDLARRMGADEVIHAGE-VDPVETVRART-GGRGADAVLEVVGITATARQSVLMVRNGGNVTWVGNSAPA-VEVPMQEVVTREVTVRGAYAFV-EEFPRAVELLRSERV---DVTPLIELVAPLADG-PVLVHDLARGTLDAVKVVLEP....... 345
119 0.000e+00UniRef50_A0A0K3CIV2 BY PROTMAP:  ali  34  6MLAQVYRGTPALKL-EEVEVPPLEK-GEVRVKVSY---CGADLHEVYHGPLTCCPAGQPHPLTGRTIPETLGHEFSGTVVDVGEGVDGLKVGTRVCIEPVISCRE--------------CESCKQGLTPLCATIGLYGYSR-PGGLAPFVNVAQTNVHVVPDNVPLDIAALAEPLSVAWHAVGCSSFQTGETALVLGSGPIGALVTRVLVARGASAVYVSEPSPVRAQIAQSCRATEVVDPTK-EDVVRKVMELT-GGRGVDVAIDCAGMQRTLDAAMEGVRKKGRVVMVALWDKKKPTVDMWNLLSKESTLTSSCCFNAQDMREVLAALSAGTIKVDD---LITSRIRLEEVFDKGLEVLRSDPSQ-VKILVQL-EEGEEK 364
120 0.000e+00UniRef50_A0A1A7UDS0 Zinc-containing alcohol dehydrogenase n=14 Tax=Enterococcus TaxID=1350 RepID=A0A1A7UDS0_ENTFC  ali  32  1MKSLRKSGVGNVELC-DINKPSVKK-DEVLIKVLFSGICGSDIHALKG-------------EYNKKIPLTLGHEFIGIVSEKGDKVTQLDIGDRVVSE-------------TTYEVCEKCPYCLKEEYNLCSHRKGLGTQ-VDGSFATYVLAKADRCHHLPAELPSEVAALMEPLACCIHAVEKTIVQPNEKIAVFGPGPIGVLLALVLQSLNA-NVTLIGIDALRLAKARELGITKTFDSQKT-SLENLVEQETD-SLGFDQVFECSGSFQALQQSLEIVKKKGTVIQEGLFAKNPVPFDMSLLLNKEIQLIGSRTQKPSSWRKALEWLATAKI---DLSPMITRTLPLDQ-WEEAFELAMNGKE--LKILLKPE...... 343
121 0.000e+00UniRef50_H1V0Q6 L-arabinitol 4-dehydrogenase n=3 Tax=Dikarya TaxID=451864 RepID=H1V0Q6_COLHI  ali  26  18...AVYTNPQHELYLKQVDLPT-PGVGDCLIHVRATGICGSDVHFWKAGHIGEMVVTGENG---------LGHESAGVVIAIGENVTKFKIGDRVALECGIPCMKA------------SCFFCRTGKYNACPDVVFYSTPPHHGTLTRYHVHPEDWLHKIPDNISYEEGSLLEPLSVALTGIERSGVRLGDPVVICGSGPIGIVTLLAANAAGANPIVITDINETRLQMAKKAVPRVVTPGKEPHAVAEDVKDAL--GQEAKVVMECTGVESSVITGIYSCRFGGMVFVIG-CGKDFATIPLMYMAGKEIDLRFQFRY-RDIYPRAIGLVAERII---DLKLLVTHRFTLEEG-EEAFKIASDPSGLALKVQV......... 361
122 0.000e+00UniRef50_I0GIL8 L-threonine 3-dehydrogenase n=21 Tax=root TaxID=1 RepID=I0GIL8_CALEA  ali  30  1MKAVLKKERDVGFVIEDVPMPKI-GDDEILVKVEVASICGTDVHIY---------DWNEWAQNRINPPLIVGHEFAGVVVEKGKEVKRINIGDFVSAETHIYCNH--------------CDMCLMNHREVCRNLKILGVDT-NGAFAEYVKIPERVAWVNPKEIPHKYASIQEPLGNAVDTV-LSEDISGKTVLITGAGPIGLLAIGVARVFGATKIIVSDLSNYHLEIAKKMGADVVVNPKEA-NLREIVLNETNG-LGVDVALEMSGAKSALSDALKLTKFLGRVSLLGLF-DNNVEINLDDVIFKKLRIYGITRRIFETWQIVSDLLRSKRL---DVSPVITHEFKLEE-VEKGIKLMKSHQSG--KILLHP....... 342
123 0.000e+00UniRef50_E6R0D1 Sorbitol dehydrogenase, putative n=13 Tax=Tremellales TaxID=5234 RepID=E6R0D1_CRYGW  ali  26  17....VFEAKHNLGFMEEQSVPKI-GPDEVLVEIKKTGICGSDVHFYNTG---------KMGLATLTEPMCLGHESSGIIVQLGSNVSNLQVGGKVALEPGVTC--------------RMCVDCKGGKYQICEHMIFAAYPPTGGTLQRYYALPADLVYPLPDNVDLSFGAMMEPLSVATHAVNIGGMRTGWNVLITGAGPVGLLAMAVAKGLGAGKVIAVDINEQRLDFAKQYAATDTIPPNEGEPVAEDLLRSTGGPGSIDLVVDATGAETCVLMGLNAIKPGGIYVQIG-FGPPNVTVPMFRIVTNEITIRGAWRYGSGDYPLAIDMVARGLV---DLKPLLTHTFKFEDALE-AFEITKNGKDKNGKGVIKC....... 410
124 0.000e+00UniRef50_A0A257HDY0 L-idonate 5-dehydrogenase n=2 Tax=Rhizobiales TaxID=356 RepID=A0A257HDY0_9RHIZ  ali  29  1MRALVIHAPHDLRVEDFFAEVGDLGPEDVLVRMAAGGICGSDLHYYHHGGF---------GTVRVKQPMALGHEASGHVEAVGSAVKHVAKGDLVAVNPSHPCG--------------TCPSCQRGAFNHCENMIFNGFPHVQGLFREKISVPQNRVFKIAAPVSAAEAALCEPFSVALHAAKQAGDLKGKRVLVSGCGPIGVLMIVAARLAGASHIAATDITAHSLAVAAKFGCDDCLDVSKG---AEVLAPYTENRGQIDVVFECSGAPPAMASALQTLRPQGRIVLVGLGGDAPVPVNM--IVAKELEIVGTFRFDLE-FARAAELISSRTV---DLRPMISASFPMAEAVE-AF-TQASDRTRATKVVIN........ 344
125 0.000e+00UniRef50_A0A1I4VXX0 L-idonate 5-dehydrogenase n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A1I4VXX0_9BURK  ali  27  1MQALVIHAPGDLR-VQDVPTPELE-AGQMLVRVRCGGICGSDLHYYQHGGF---------GTVRIQEPMVLGHEVAGAIEAVGPGVSGFAVGERVAVSPSRPCGQ--------------CRFCQMGLQNHCLDMRYYGMPHVQGAFRQQIVIDTTQAYKLADHVSDQEGAMAEPLAVALHGVQRAGPLLGRKVLVTGCGPIGALAIIAARRAGAAHIVGTDMGEHPLRKALQVGADEVINVGTE---PEGLARFAADKGQFDVLLEASGNERALRSAFDVLRPRGIVVQLGLSGG-EMQLPFNTVVAKEFDLRGSFRF-HEEYATAVELINKKLV---DLKPLISATMSFRDPA-RAF-ALAADRSQAMKVLLSFDD..... 346
126 0.000e+00UniRef50_A0A1H4BDN3 L-iditol 2-dehydrogenase n=2 Tax=Eubacterium aggregans TaxID=81409 RepID=A0A1H4BDN3_9FIRM  ali  23  6MKAQMFYAPGDVRF-EETDIPTI-GPEDMLIKVKAALTCGTDLKTYRRGHPTIITSV----------PSTFGHEFAGEVVAVGEKVTQFEVGDRVVGANTTPCFE--------------CYHCKKNEYSLCENLNYL-----NGAYSEYVAVPGHMLYKIPESLPYEQAALLEPLACAVHGADRIPVKTGDDVVVIGAGPIGLMFMDLLALKGA-RVIAVDLSDYRLSLSRQFGAAGTVNAGDKGH-VQRVKEKCNGGRGADVVVEATGFPEVWENAINMVRPGGTVLTFGGMKKGTIAIDCQKFHYEEINLKAVYHHTPYHVQWALNLLTNGSI---DGAKYISGVYPLENAID-ALESIA--RQEGIKYAVLPE...... 347
127 0.000e+00UniRef50_A0A2V4WYI0 L-iditol 2-dehydrogenase n=4 Tax=Bacteria TaxID=2 RepID=A0A2V4WYI0_9BACL  ali  27  1MKAVVKEKSGHGNVLIEVQEP-ACQPGSVKIEIKYAGICGTDLHIYHD-------------TYKSNPPVILGHEFSGIITEAGENVTRFQVGERVTALPAVTCGD--------------CEHCRTGNYMFCTKRKSLG-SGVDGAFTKYVVVREDMVYKIPDHLTLEEAALTEPLACAVKAIELTTIHVGDTVLLSGPGPIGLICLSLLVMKGC-KVIVAGTNADRLEIAKELGADVIVNVSE-ENLHEIIERETEG-SGIDVAVECAGAGPSVTSCLRELKKRGKYIQVGIVG-KEITIDYDLILYKQLQVVASYAHSIETWDRVMNIWRQNKIR---LRPIITHKLPLSQ-WREAIEICEQKIGG--KVLLSYDES.... 345
128 0.000e+00UniRef50_A0A1V5IUE7 L-threonine 3-dehydrogenase n=13 Tax=Bacteria TaxID=2 RepID=A0A1V5IUE7_9FIRM  ali  27  5MRAIAKTSPSPGAEKVVVPIPQ-PGRGEVLIKVRATAICGTDVHIYE---------WDQWSQGRVMTPRIFGHEFCGDVVEIGEGVTKVRVGQFVSAETHTACGH--------------CFYCLTGQAHICREAKIVGIDR-DGCFAEYIILPEFNCWIWDIDIPDEIAAIQDPFGNAVHTA-LATDLAAKTVLITGMGPIGLCAISVAKRCGATEVYVTDVSEYRLDLAKRLGADLAINPTE-EDPVAAVRDAT-GGLGADVLLEMSGNPTAIRQGFQALRKAGFASLLGI-PSKPMEIDLNDIIFRSLTVQGINRRMFDTWYQARALLKAG----IDIMPVITHRMSLWDDLDKGMELMISGK--CGKVILYP....... 346
129 0.000e+00UniRef50_Q5SKS4 L-threonine 3-dehydrogenase n=34 Tax=Bacteria TaxID=2 RepID=TDH_THET8  ali  29  1MRALAKLAPEEGLTLVDRPVPE-PGPGEILVRVEAASICGTDLHIWK---------WDAWARGRIRPPLVTGHEFSGVVEAVGPGVRRPQVGDHVSLESHIVC--------------HACPACRTGNYHVCLNTQILGVDR-DGGFAEYVVVPAENAWVNPKDLPFEVAAILEPFGNAVHTVYAGSGVSGKSVLITGAGPIGLMAAMVVRASGAGPILVSDPNPYRLAFARPY-ADRLVNPLE-EDLLEVVRRVT--GSGVEVLLEFSGNEAAIHQGLMALIPGGEARILGI-PSDPIRFDLAELVMRGITAFGIARRLWQTWMQGTALVYSGRV---DLSPLLTHRLPLSR-YREAFGLLAS--GQAVKVILDP....... 341
130 0.000e+00UniRef50_A0A1F6D2G9 Uncharacterized protein n=1 Tax=Handelsmanbacteria sp. (strain RIFCSPLOWO2_12_FULL_64_10) TaxID=1817868 RepID=A0A1F6D2G9_HANXR :_  ali  26  1MKAVRKLAQGTGHVLCDVPEPD-PRPGHAKIAVRAAGICGTDIHILHGGYAF-------------NPPVTLGHEFAGEVVEVGKGVDRVRAGDRVTVLP------------SAMGRCGVCRFCRSGYYFYCVNRSSIG-SKTDGGFADYCVAPEDLLYVLPEGVDYRAGSLTEPLACCVQAVELTDIAPSDVVLISGPGPIGMICAALAKLRGATVILCTAQDRERLGMARSFGVDRTVDV-TAEDAAQVARDMTDGY-GADVVLECVGVGASVNQCLDAAARLGRYTQVGLLDH-PAQVDFGKVVYKQLRVQGALGQTWSTWEKTLRLLRRGAI---DMNRFITHEVPLDR-WQEAFDNTEQKRG--LKNVLCP....... 342
131 0.000e+00UniRef50_M5P3Q7 Galactitol-1-phosphate dehydrogenase YjmD n=7 Tax=Bacillales TaxID=1385 RepID=M5P3Q7_9BACI  ali  28  1MKAAVMTKPFSI-VFQDLPRPE-PGGHEVLVKVKAAGICGSDVHFYDGSNPY------------AQYPQIFGHELSGIIEKTGAQVKGRSPGERVVIEPAIPCG--------------SCYPCRKGRMNACVNIDMIG-SVRRGGFADYITVPETHVHPIPEQMDFATGALCEPFAIGAQAITRANIQSGETVVILGMGPIGLTILAQIKKRFQAVVIAVDPVRERLELAKSFGADTVIHPHE-ENAEHTVSKLTNG-EGAGIVIEAAGIPATIEQSIYLAAAGGRIVIVGLTGEH-VTVPGLLLTKKDIEIHGT-KHSVNQFPDVIRFLHR---NPQLAESFITEIMPFTK-IEEALKKAKNHPDQVTKIILS........ 337
132 0.000e+00UniRef50_A0A173SVM3 L-threonine 3-dehydrogenase n=5 Tax=Blautia TaxID=572511 RepID=A0A173SVM3_9FIRM  ali  25  114MKAVILSGPNDFAPGE-IEKPLI-GDHDILLEMKRAAICGTDIRILEG-----------TKTKGVRYPSVIGHEICGVISEIGKEVTGYEVGEKVAIANVIPCG--------------SCPSCLSGRENACMRRKAIGY-EFNGGFEEYIRIPEGNVIKLPEQVSFTAGALIEPLACCIRGLKNAGTGFNDVVLIVGAGPIGLMHMQLAKIAGAKQVIVSEPNPMRRQIALELGADKAVDPVT-EDLAGIISDVT-GGLGADVIVMAIGVPALVNSTLKLCRRGGTVNLFAGFGTGECTIEVNTIHYNEINVNGSTAYKREDYLQAADMVISGKI---NLDRIATHTYKIED-FQTAYEMCKSGKG--LKIIIEP....... 458
133 0.000e+00UniRef50_H9GBU4 Uncharacterized protein n=6 Tax=Bilateria TaxID=33213 RepID=H9GBU4_ANOCA  ali  31  14...VVVHRAGDLRL-EDRPVPE-PGPNEVLLKMHSVGICGSDVHYWQHGRI---------GDFVVKSPMVLGHEASGTVVKVGSAVTHLKNGDRVAIEPGVP--------------REKDEYCKTGRYNLSPTIFFCATPPDDGNLCRYYKHDASFCYKLPDNVTFEEGALIEPLSVGIHACRRAGVTLGSKVFICGAGPIGLVTLLIAKVMGASQVIISDLSASRLEKAKEIGADFTIQVKSPEELAQAVKNAL--GCMPDITLECTGAQACIQTGIY....................................................................................................... 264
134 0.000e+00UniRef50_A0A0N8PVY1 Putative L-threonine 3-dehydrogenase n=1 Tax=Candidatus Bathyarchaeota archaeon BA1 TaxID=1700835 RepID=A0A0N8PVY1_9ARCH  ali  26  1MKAAVLHAPKDLRI-EEVEMPTAGVGEVVVKV-KATGVCPTDLRKY-------------MGASEVREPIILGHEFSGNIYDVGEGVLGLRKGDRVTVNPFLYCFG--------------CRYCRLGRFNLCSNLGALGGARLNGSFAEYVKVPAESVYVIGPEVPYEEAALTEPLASCLNGILMCNMKPGDTVVIIGAGPIGLMHLQLARLFGASKVVISDPLKHRRAKALELGADYAIDP-ETEEPVTRVRDL-SGGMGADVVVVATGVEATTEQGLRMVSKGGVVNIFGTWPSTHVKLDPNLVHYGEVTLLGSHLFTPAIFSRAVKLVSSGRLR---LGRIVSNILPLDEIV-KAFNIALDK--QAFKVELKP....... 347
135 0.000e+00UniRef50_A0A1E5TF95 Galactitol-1-phosphate 5-dehydrogenase n=1 Tax=Staphylococcus equorum TaxID=246432 RepID=A0A1E5TF95_9STAP  ali  32  1MKSLSLVGKEKLEIVEK-EIPKI-NDNQVIIKVAFCGVCGSDLDRYFKGKVHY-------------FPITLGHEFSGTVYKTGSKVNNFHEGDRVTAAPLIPC--------------RKCEYCLRGEYSHCSKYSFIG-SRQDGAMAEFVAVDVENVLSIPENVTLEEAALIEPLTVALHGVERINMNAGSEVLIFGAGTIGMMTLLSVKALGAGKITVVDLNEEKLSKAKQLGADEIVNPVEID-----LDRYFENNRKPDAVFETAGASQTQTQSIKYIKHLGKVVFIG-TATKDVKFEPQQILRKEIIVTGSWMFPGYEWKSGLNYISQGKI---DVKPLISEIFEIEDR-NKPFDRMVDQKLSSIKYL.......... 340
136 0.000e+00UniRef50_S0G0A2 Alcohol dehydrogenase zinc-binding domain-containing protein n=2 Tax=Ruminococcaceae TaxID=541000 RepID=S0G0A2_9FIRM  ali  23  1MRAAVFMEPYKFSIVQDKPVPQ---KGEVLIRIMAAGICGSDIGPFTGKDIE-----------RRRPGIIMGHEAAGMVEMAGEGVNGWRPGDRVAINPQIYC--------------NTCIYCRTGKYNLCNNMQLIGSSKRHGAMCEYICISEKQLVRLPDNVSYEKGALLDPVGNAIRVIRRGHVGIGDKVVVLGCGTIGLLILQTAGIAGADKIIAVSRSGIKSALALEAGASHFVDSSNKEKALNEINEYTHGK-GADVVIDAAGFTDTYDFAVSCCKKGGRVVALGYNGTQ-LNFPLANLIFKEIQLIGSTGFAEES-SLALEYLSNGRVK---LDKIISKRFPLEKT-QNAFEAV--NGGNEIKVIIKPDE..... 344
137 0.000e+00UniRef50_A0A061H1S9 Uncharacterized protein n=5 Tax=Dikarya TaxID=451864 RepID=A0A061H1S9_9BASI  ali  27  20..ALLATSKKELELV--RSQAEKPGPGQALVHVRATGICGSDVHFWKHAGLGPWKIDSCVG---------LGHESGGVVIAVGEGVDNVKVGDKVAIEPGVPC------------FKPTCNFCLKGKYNLCPTVDFYSVPPRDGTLRRYHVHPAGWLHKVPESMSFEEIALLEPLSVTLQATLQAEIKLGQPVLITGAGPIGVVQLLCAKAAGATPIVITDVVADRLAFAKKLVPEHTYQIDTAKTPLECAQEITGSDVMPAVTMECTGVQSSVHTAAFATEPTGLVFVIGV-GANYQEIPFMHLSTNEITLKFLFRY-RDTWPRAIRLVAGGMI---DVKQLVTHRFPLEKARDAMFH-AADRSVPSCKTII......... 375
138 0.000e+00UniRef50_A0A1Y3Q8N8 Alcohol dehydrogenase n=3 Tax=Bacillales TaxID=1385 RepID=A0A1Y3Q8N8_9BACL  ali  26  4MKACVIEGPRR-AAVREVPVPE-PAPGEVLIRVERAGICGTDVHIYKGEYISP-------------YPIVPGHEFSGTIAGLGEGVSGFAIGDRVTAEPNIHCG--------------RCVYCLTHRGNHCENWQAVGV-TRGGAMAEYVAVPAANVFRLPGGMSFAEGAFIEPLACVVHAMNRLRPSAGDRALLFGAGAMGQQLIQALAHAGVSDLTVIDISEDKLAMAAQWGATRTFVSGRF-DEAELLGEF---PRGFDIVVDATGLPQVIEQALKYLGPAGKYLQFGVTAEAAIRLSPFDLFQRDWTLIGSMA-TNDTFHQALQWAKAKRIR---LEPLVTRVIGLDD-LPRLFETGASPED--LKVQVQ........ 337
139 0.000e+00UniRef50_C6J3Q4 Putative chlorophyll synthesis pathway protein BchC n=1 Tax=Paenibacillus sp. oral taxon 786 str. D14 TaxID=621372 RepID=C6J3Q4_9BACL  ali  28  1MQALVIPKPHEIRL-DDI-KPQSMGPYDVRIKSKAVGICGTDLEILEGK----------VSEEYVTYPVVPGHEWSGVVVETGSEVKGIKPGDRVVAEGLMSCG--------------SCSMCRQGRTNLCQEYDQLGFTRPGGG-ASLVTVPARHVHRIPDHLSFEEAVLVEPAATVMRGIMRTPIEPGMKVAVIGPGTLGLLTVLMLKVLGVDEICLIGRNGLQLGLGRELGASCVLNSKE-DDIDQCVMDWTNG-QGVDVSFETSGNEQAVKMSIEMVRAGGHAVLEGVAGGKQLVLESDDIMLKDITVHGVFSYTISSWSKVLDWLATGKL---NISPLITHRFSIRD-YEKAFQSLRNKTRPTVKIV.......... 340
140 0.000e+00UniRef50_A0A1Q9PAU2 D-arabitol-phosphate dehydrogenase n=4 Tax=Candidatus Thorarchaeota TaxID=1706441 RepID=A0A1Q9PAU2_9ARCH  ali  29  1MKTAR--GVGLLEL-REVDDPK-PKRNEVLIEVAAAGICGTDIHI-------------KYDQAFYTPPVILGHEYSGKVIGVGEDVTSFTPGDRVVSPATAYCG--------------KCHQCKTGHMNRCKDKRILGTSNANGAFAKYLVVPDYIVHHVPKGVSLEEAALAEPFACVVHSVDKTPICPGDVVVVQGPGTMGLMATQIAKSMGAGKVIVTGVTADRFDIAKKIGADLTIDVQSESDPVGIVNAETDGR-GADAVIEASGACVACTQALDFVKVAGHVTLLGVRGQ-PANIDLDPIIVKELTMSGTWGTLPSSWVTTLRLMSSHKV---DVSPLITHRISLRE-WEKGFELMESQK--AIKILF......... 339
141 0.000e+00UniRef50_A0A0G3EJ33 Sorbitol dehydrogenase n=4 Tax=root TaxID=1 RepID=A0A0G3EJ33_9BACT  ali  28  1MKSMKLTGLRQMQMMEG-PAPELVRDDDVLITMKAVGVCGSDVHYYETGRI---------GSQVVAYPFAVGHEGAGEVAAVGTAVTKVKPGDRVAIDPANPCG--------------TCDQCRAGRPHTCRHLTYLGCPKAEGCLSEQIVMPEDSCLPLPDDVSYEEAAISEPLSIGMYAVELSVPVPGTRIGILGAGPIGLSVLLPARAQGAKAIYVTDKLDPRIALAKKAGATWGGHPDR-EDIVARVLEQEPGGL--DVVFECCGEQDALDQAIDLLKPGGKLMLIGIPPTAEVSFEIDKLRHKEIAIQNVRRQN-GCAQKAIDLIAQ---RVFDVNLMTTHRFDFARTAE-AFDLVAAYRDGVVKAMIHF....... 345
142 0.000e+00UniRef50_A0A0K6GGF4 Uncharacterized protein n=17 Tax=Agaricomycetes TaxID=155619 RepID=A0A0K6GGF4_9HOMO  ali  24  11..ACVLYGAKDMRVEQR--TIKAPKEGEAQVQVVATGLCGSDLHYYVHGR---------NGDFVLQSPLVLGHEAAGVVTAVGYGVTSVKVGQRVAIEAGVYCKE-----------------CRSAKT----------FPHLDGTLQGRMNHPADLLHPLPDNCTFEQGALAEPLSVVLHANRRAQLRAGQSVLVLGAGAVGLLACALAKATGASRVTAIDIDQGRLDFAQSVGATDIYCPRTSEEGLKKAKEDLEAPEGYDVVFECTGVESCIQMGIIMARAGGKLSLVGMGTPNP-TIPLSAAALREVDIVGVFRY-AHTYPEALELLGSGKL--AGVERMVTQRFPLEQAG-KAFELLMQGKDKVVKVMV......... 356
143 0.000e+00UniRef50_E4X6Y3 Uncharacterized protein n=1 Tax=Oikopleura dioica TaxID=34765 RepID=E4X6Y3_OIKDI  ali  26  134.........................ADEVLIKVKAVGICGSDVHYWTAGR---------GARFAVEEKMVLGHEGAGEIVEVGTKVDNVSVGDRVAFEPGFATQEDELT--------------KNGRYNL-SKVFFCATPPDDGCLCEYFVHKASCCYVMPHGMSYEVGAMIEPLSVGIHAAKRARVEPGQKVLITGAGPIGLVSAIAASARGAGEIVLTDVIDSRLELARSLGFKTVNVMSKTRD-----RILLELDHKFDAVMECTGRTECMQLAIYAAKPGSTVVLVGLAPRDKMELPIMLASVQEIDIRGVFRYC-NTWPAGITIAQK---YQKEIEALISHRFTLDQ-FEEAFELALSGK--CMKVMFS........ 447
144 0.000e+00UniRef50_N1JTG9 L-threonine 3-dehydrogenase n=46 Tax=cellular organisms TaxID=131567 RepID=N1JTG9_9BACT  ali  27  6MIAIVKERPAPGLTLKRVPVPRKLGPHDVLVKVKRASICGTDVHIY---------NWDAWSQERIRPPQIDGHEFTGEVVSIGGDVSTVKVGDSVVSETHIPC--------------QKCLQCRTGKMHICKNMQILGVHR-DGVFAEYVRVPEVVLWKVDPSIPLEYASIMEPFGNAIHTALVTDLT-GKNVLITGAGPIGAMAVAVAKVSGAAQVIVSEIKEFRKELARKMGADVIIDPTK-EDLTKKVKAMTEDN-GADVLLEMSGNTTAFKQGLDSLTNGAVVSLLGVFPG-ELSFDINDLTFKGLTMYGITGRMFETWQVATQLLKNKRI---DLSPVVTHILP-AEKFEEGFDVMI--RGISGKVILEF....... 348
145 0.000e+00UniRef50_A0A0H4KS20 Alcohol dehydrogenase n=9 Tax=Bacteria TaxID=2 RepID=A0A0H4KS20_9BACI  ali  28  1MKAIQVKGAHNLVEVE-VEKAELKFPTDVLVKVKRVGICGTDMHIYHGTNPL------------ATLPRVVGHEVAGEVVDVGREVDKLKKGDHVVIEPISYCGN--------------CYACRKGRPNVCSNLSVFGVH-EDGGLREYIVLSEKQLHLVNKSLSWDDIVLAEPYTIGAQATWRGNVEKGDSVLIQGAGPIGICILKLAKMKGAT-VMMTDLNEERLQFAKESGADAVVHVGR-EDVRTRVKEWTN-REGVNIVIDAVCLPSTFELSVDVVSQAGNIVVLG-FDERPASIPQLPITKKEVTITGS-RLQTHQFSTIVQYLNKGKLSHNG---LITHKFPLSR-VQEAFDFIENYPEQVRKAVITLND..... 340
146 0.000e+00UniRef50_B5YBD9 Dehydrogenase n=3 Tax=Bacteria TaxID=2 RepID=B5YBD9_DICT6  ali  28  9.........RDIRRLELIETPEHPKDNEVLLEVIYAGICGSDLHAYLGEHPF------------VKPGIVLGHEFVGKVIEKGKDVENLEVNDFVVVEPSLTCG--------------TCYNCTHGRYNICKNLDVIGCTKTNGGFQKYIKIPAHKVYKIND-IPLKRAVLTEPLAVAVHGVRRSSFKPGDEVLVIGSGPIGLLTTIVLYLSSAKKIVLVDVLDKRLHLAK------TLCPGIITIKPEELNSNLFTQEGPDLVFECVGVDQTINMAIEYARKGTDIILMGV-PKEISTAKLIYIQDRELNLKGSLMYTKDDYLIAIDLLRKNQL---NYEALITHLYPFDK-VSEAFEDILKYKEEYFKVIIDIKGE.... 340
147 0.000e+00UniRef50_UPI00088472CB butanediol dehydrogenase n=1 Tax=Jeotgalicoccus halophilus TaxID=586411 RepID=UPI00088472CB  ali  32  1MKAVVYYDTKDVRI-EEVAEPKVYAEG-VKVKVAWTGICGTDLHEYLGGPIFIP-GDAPNGVTGKERPVIMGHEFSGVIEEVGEEVEGLAAGDKVVINPVLTNKQHDNPLYDFY---------KEG--------TFIGL-GDDGGFADFVVVPAENIVKLKDSTSLKIGALVEPTAVALQAIRESELKFSETVAVYGAGPIGLVTILAARAAGAKDIFVFDLSDERLEKAKEFGATHTVNSGK-ENPVEYIKSIY--PDGVDRTFEVAGVKQTLEQSIQSTRPRGMVCIVSIF-EKEIDFNPMMLTTSGVRISSSLGYEPDIFEATVKMIESGQI---DPSLMITEEIELDEVIEKGFNKLIEDKSQA-KILVKLSGE.... 349
148 0.000e+00UniRef50_A0A1H0JG18 L-idonate 5-dehydrogenase n=2 Tax=Rhizobiales TaxID=356 RepID=A0A1H0JG18_9RHIZ  ali  31  5..AATLFGPEDLRVVEG--SLSTLKPNMVRIKFGAGGICGSDMHYFRHART---------GDFVVTSPLILGHEVAGEVAQIGSDVAGLAVGDRVAVNPSRWCG--------------TCVYCHEGRANLCENIYFMGTPHMQGGFASYFDATPAQCVKVPKDFPFQAAALAEPLAVCLHAVRRVGHVKGHSAIIFGAGPIGLLTLLALKHAGAESVAMVDLAAAPLKFALELGANKIFDLSEGEEKLAKLAVATP----FDIGFEISGTAAGLASAIRTVRRGGTVVQVGNLPGGSIPVPANAVMAREIDLKGTFRFG-EEFYEAVELIVSGEI---DVLRLVTGEFPLSEA-PAAFAEALD-RSRSVKVVLT........ 345
149 0.000e+00UniRef50_A0A2N2BUR5 Uncharacterized protein n=3 Tax=Firmicutes TaxID=1239 RepID=A0A2N2BUR5_9FIRM  ali  30  1MKAVQKHGVGYLGYVE-VEEPKI-APGSVKIKVEYCGICGSDLHI---------VGGFETPTSPLPIPFTMGHEYSGTIAEIGDGVTQFKVGDRVT-------------GIVTKGFCGKCRSCLMGDIGRCQDAINIGY-ECDGAMAEYICMPEGATFKLPDNVSLEEGALVEPAAVAAHAVENVDIKPTDTVVVMGAGPIGLLVLQFAKACGAKTILA-DISSARLELGKKLGADYTFENDKC-NVIQEVRALTFGK-GADFVFECTGVDIVITQSIMMTKRAGTIVELALTSAEGSNIKAYIVVMQNMRIQFSYGHNLGTWKKTLQMMADGRINTKD---LVTHKFKFED-FNEAFECNDANK---IKVLLHP....... 346
150 0.000e+00UniRef50_A0A1Q7MZU2 L-threonine 3-dehydrogenase n=16 Tax=Bacteria TaxID=2 RepID=A0A1Q7MZU2_9BACT  ali  24  5MLAVVKAEAAPGADIREVKVPGF-GRTDVLVKVKVASICGTDLHIYE---------WDRWAQGRIHPPLIPGHEFCGEVVAYGNEVTSVKEGDFVSAEMHIACG--------------KCLQCRTGEAHICQNVKIIGVDT-DGAFAEYVVIPESNIWKLDPAIPQEYASILDPLGNAVHTV-LAGEIAAKTVAITGCGPIGLFSIAVAHAVGATTVFAIEVNEHRRKIAKEMKADFVIDPSK-EDARAVIMEQT-GGLGVDVVLEMAGHPSAIRTAFDIVRRGGRISLLGLTS-KPISLNFSDIIFKGITIQGVSRRMYQTWYQMTALLKSGKL---NLHPVITDRIAMKD-FSQAMERLKT--GAASKILVYPNGTG... 350
151 0.000e+00UniRef50_H3SMF2 Threonine dehydrogenase related Zn-dependent dehydrogenase n=54 Tax=Firmicutes TaxID=1239 RepID=H3SMF2_9BACL  ali  26  1MKAAVLRGTKIMEVTEWAER--LPGQDEVRLRVVCCGICGTDQHIYHGHP----------GSAEVKPPIVLGHELAGIVDAVGEAVTDLRPGDRVSVDPNMYCG--------------ACEYCRGGRAHLCDRLQAVGV-TRDGGMGEYCVVPAANCYKLPDQVSWVEGAMAEPLGCVLHGFKKLELRANQHVMIIGGGFIGQLFLQLAAAAGVARITVCEPAEHKHRLLRELGAEAIVSPLE-EGAADELRST------ADVVIECAGRPESVELALEAARKGGQVLLFGVAPEARASLSPFEVFSKELRIMGSFI-NPYTHEEALALLAQHIVS---IEPLISHRFRLDELPDV---MARYGEMNVTKAVI......... 333
152 0.000e+00UniRef50_A0A1Y2B6L1 Putative xylitol dehydrogenase n=2 Tax=Tremellales TaxID=5234 RepID=A0A1Y2B6L1_9TREE  ali  24  27.KAAVCYGATDLR-VEDRPIP-VPGDGEAQIQVAVTGLCGSDLHYYSHG---------ANGTFKILSPMVLGHESCGIVTALGPNLPTLKVGDRVAMEVGLYC--------------KTCRFCKVGRYNLCSQMRFKSFPHLDGTLSEVMTQPVDLLHKLPSTLELPLAALAEPLSVVLHAFRRAHLAPGARVLVLGAGAVGLLACTLARASGCTTVVAVDIEQGKLDFAKEMGLDAVAAAQNNWAALAAVQNVEGLEDGFDAVFECTGVEVCMQMAVMAALPGSKVMFVGM-GTPNLTLPTGPSFLREVDLIGVFRY-ANTYPDALALLGSGKL--GDVGKMVTHRYPLENAAE-AFEDLKRGRDKEGRTIIKP....... 396
153 0.000e+00UniRef50_A0A178DEK1 Uncharacterized protein n=1 Tax=Fonsecaea nubica TaxID=856822 RepID=A0A178DEK1_9EURO  ali  38  534MKAARYHGRRDLR-VEDVDVPQIV-DGQVLIQIEWCGICGSDLHEYLVGPGIIPQKDAPHPLTGAVMPVTMGHEFCGRVTKVGPN-SKFQIGQPVMVDPRVFC--------------SNCHSCNIGDTNICNSWGFLGLSPDGGGFSEYVAVKEEMCHVLPDSIPLSEAALIEPLTVARHATKKSGFDRDKTILVLGGGPVGLALIFVLRASGFGKLIVSEPTSQRQEQAAKF-VDMVLNPREI-SVPEKCRIM-----------------PGLKDGMDALRRGGTYVNVAGW-ERECVVPMEHFMLKEIIFRASMSYTAEDFKQTVDEFVAGKF--EGFEKLVTARIALDDIVKKGFEELVNHKDDHVKILVTPMKE.... 875
154 0.000e+00UniRef50_A0A0S8C192 Uncharacterized protein n=2 Tax=unclassified Betaproteobacteria (miscellaneous) TaxID=33809 RepID=A0A0S8C192_9PROT  ali  27  1MKAMILHAGGDLR-RETVPDP-APGAGEVVVRVHACSICGSDLHAYHGKHP------------RLTFPRVLGHEFSGEIVALGANVSGFRVGERVCCDIDLPCG--------------TCGPCRDGRSNICDTLKTMGFD-CDGAYAEYARVPEFNLYSLPENVSFDQASAVQVLGISYHAVDRVKPRAGDKVAVIGAGPIGLGAALVARSMGAEMTIL-DLLEYRLTLARNLGIPHAWRADDG-DLRERALAAT-GGRGFDRVIECVGQERTVADAVRMVKRGGQITVVGTFPENKATIPIAYLKDREIDLNFSRG-NFRAFAPCLELIGSGKVNPDLY---ISHRFPLARA-EEALKLLEARNVEAHKIVLHP....... 341
155 0.000e+00UniRef50_A0A173ZVI9 Carbohydrate dehydrogenase n=6 Tax=Clostridiales TaxID=186802 RepID=A0A173ZVI9_CLOSY  ali  27  1MKALVKYELGALNVVMEVEKPKI-SPDEVLIKVMGAGICGTDLHILTD------------NSYPVKPPVILGHEVSGVIEEVGENVKGWKKGDKVVSETYYYCGN--------------CYFCKTGSINLCEEKLSIG-SGVNGAMAEFVKVPAKNLHSFPESLSFEEACMTEPLVCCVQAVQHGRLSPEDYVVLTGPGTIGLLTLQVIKLFGCKTVVLTRKDEERLQKALEFGADKVMYV-EDEDIAAQVKSYCRG-IGADAVFECSGAVPAIRLAMDLMRKGAHYTQVGIPSKD-APIDMGKVVLREYTIAGTYATRPIWWDKTIELLNDGKI---DLKSLMSTAYPL-DMWEKGFDEAV--RGEGFKHIIVPNS..... 344
156 0.000e+00UniRef50_X1DKG1 Uncharacterized protein n=1 Tax=marine sediment metagenome TaxID=412755 RepID=X1DKG1_9ZZZZ  ali  29  1MKAIIYPKPHCWKY-QDTPTPQ-PGPEDVLIRIKSCGVCATDLHIY-------------NGEFISRFPLVPGHEFSGEVARVGDKVEDIKVGDRVTVDNAIYCGN--------------CEFCRNNKEHFCLNFRSIGV-TQNGAFAEYVVAHKTHVYDI-ENLSYDKASFTEPLSCAIHGFKLLGVTPGAQILVFGAGPAGLMLLQLAKYGDCSLVVIADPNYCKLDKAKELGTDFAIFADRSDHVKNREVLLNIAPLGYDYVIDATGKPEVQENCLWLVKKGGKFLVFGLAPESTVRMNPYELLIREITIIGSNCQLY-DFSAALKLLKAGLIR---VRPLITHKFPLEE-FGKALEIAQTSHEK-LKIIINP....... 339
157 0.000e+00UniRef50_A7II35 Alcohol dehydrogenase GroES domain protein n=6 Tax=Alphaproteobacteria TaxID=28211 RepID=A7II35_XANP2  ali  28  1MKAAVIHAAKDLRL-DECPEPEM-AANEVLVSFRAGGICGSDLSYYGKGRV---------GDFALRQPMVLGHEISGEVIKLGASVSTLALGDHVAVNPSRPCLE--------------CDYCRAGRSNLCRNMRFFGYPHVQGAFSETFVCRADQCVSVPRDIPFRRVAMAEPLSVAIHGVRRAGELAGKRVLIAGAGPIGMLLAIAARRVGASYIAITDIVDAPLELARAAGVDETINVAT---APEQLARYEKDKGFFDAALEATGVPQALASLFKVVRPGGRVVQLGMMPPGDVPVPANMLMAREIDFVGAFRFS-GEFATAVDWLVRGLI---DVEPVMSADLPMSR-LDEAFQLAAD-RSRAIKVHLHF....... 345
158 0.000e+00UniRef50_A0A178DJ99 Threonine dehydrogenase n=1 Tax=Pyrenochaeta sp. DS3sAY3a TaxID=765867 RepID=A0A178DJ99_9PLEO  ali  35  1MRAVRYHGRGDMRF-EHIDRPEY-GPAQVLVRPAFVGICGTDVHEWSRGPILIPM--DKHPLTGAEMPLVIGHEISGIVDAIGSEVTDVQVGQRVAIQPVIS--------------DNVCTACQNGRNNVCKQQGFYGLS-AHGGLAEYMVSNPENLKSLPNNVSLEAGALIEPFTVGWHALRMSNVNKGCSALVLGAGPIGLAVVQSLVAKGACQIIVSEPSKPKRELAMTFGATHVFDPTPGCSIPYECLNVTAG-DGVDLALDCVGKQATLDQAVDSTAKGAAIVNIALWGGNAV-ISPNAFAVGEKRFVGSAVYVERDFQEVIDAVAAGNTKPLDPTRLITSRVSLENVVNSGIRRLIEDSENQVKIIVDVSR..... 377
159 0.000e+00UniRef50_A0A1C5Q196 Sorbitol dehydrogenase n=14 Tax=Bacteria TaxID=2 RepID=A0A1C5Q196_9FIRM  ali  31  1MKAVVVETPEKITVVE-RDIPEITS-TQVLLKVKAAGICGSDVGIYHGKNAF------------ATYPRVVGHEFVGEVVKVGADVKNAAVGDHIAVDPVVSCGH--------------CYACRTGRHNVCKTVNVLGVHR-DGGYQEYVAVEQDQLHQLPKDLPWEIAATVEPYSIGAQVAHQGRLTGDDTVLICGAGPIGLIILQVAKMKGA-KVAILDVVDSRLETAKEMGADMVINSKTK-DPVEAMNEFT-GGEGFNLIYEATGNVNVLQMCIQKLSPAGRVVVLG-FSTVEFPIRQVDIMSKELEIIGT-RLNNYRFPEVIEWFKEGKV---DPKSIVTNTFPFTEA-DKAFQYNDEHPENVLKIVLTF....... 338
160 0.000e+00UniRef50_A0A239Q286 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase n=4 Tax=Bacteria TaxID=2 RepID=A0A239Q286_9RHOB  ali  29  1MKAAYYTGNGELRQVEDVP----PGPGEVQVETAYCGICGTDLHVYLG-----------HMEARIGDNRVIGHEMSGRVSAIGEGVEGFAVGEPVVVRPLAHCG--------------ACPACKAGHIHVCHNLKFLGLDT-DGAFQNRWTVPAHVLHKLPAGMALDHAALVEPLAVAVHDVRRARVAVGEDVLVIGGGPIGMLVALVARHAGA-RVTVSEVNENRLKLAEDMGF-ATANPKR-EDVAARVMAET-GNKGADVVFEVSGTQPGVDLMTAVTATRGRICMVAIHAQKP-QIDMFRFFWREIELIGARTYEITDFDAAIAMLSDG----IGVETLITEIRPLAE-LPQAFKALTENP-NSMKTLIRVSEEA... 342
161 0.000e+00UniRef50_A0A238EZ54 BQ2448_5768 protein n=2 Tax=Microbotryomycetes TaxID=162481 RepID=A0A238EZ54_9BASI  ali  34  8.KVVNYYGMRDIR-VEESPMP-VPAEGQVLIKLAW-------LRVWNNGPILCPTADKAHEITGEKLPICLGHEFSGIISKVGPGVKGWKEGERVIVEPTISC--------------YKCYACKHNFRSACSSLGFVGLSGYGGGLAEYTIAGEGFLHKLPDNVSLQYGAMVEPLAVAMHAVQMSGATEGCSALICGAGPIGCFVTKVLIAMGATKVIVSEPSGSRRKMATHAGAHHVISPRE-DDVVSKCRELTGGDDGVDVSFECAGVEASLTAAIAALRPRGTCLNVAIWSTKP-QIDMNALVLGEKTLRAVICYESN-HKPAIESLSSGKIS---LDGFVTGTASLDDIVEKGFHELINNKEQ............... 355
162 0.000e+00UniRef50_A0A1M3JXT7 Uncharacterized protein n=1 Tax=Chloroflexi bacterium 44-23 TaxID=1895927 RepID=A0A1M3JXT7_9CHLR  ali  29  8...AIITAPGRVEFQQKTLVP--LGDEEVLIKIRAAAICGSDLHLFKGLHPS------------AKLPVSVGHEAAGEIVEVGKKVIRHKVGDRVTIEPVIACG--------------KCEYCVRGDYHLCANISFQ-YRKGQGAFTPYFIVHESRAFRLPDIISFAEGALVEPLSVAMHAVKKSGIRLGHTSAVFGAGAIGILVSMLSRASGIGSIIC-DIHPYRLQKAIELGARFAINSQE-QDPVTAIFMITE-QMGVDKSFEAVGLEITLNQALQVLKHGGNATLLGIFEKLENKLPVNLFVQREISLYGSQGYSW-DFQDSLKILALGNI---DLKPLITHKLSLSE-LQHGFEILLKPENESIKVVIMMED..... 345
163 0.000e+00UniRef50_UPI000BA47DE7 alcohol dehydrogenase n=1 Tax=Blautia hominis TaxID=2025493 RepID=UPI000BA47DE7  ali  29  1MRAAYITDVKQTEI-REIDKP-VPKKGEVLIKIESVGICGSDLHLFLGVHAF------------RKPPVILGHEMSGTVCELGEGVTKFGIGDRVTVNPSVSCG--------------RCYACRRGLENICEQRKAPGTDAWIGCFVEYFPTPEETVYKIHDDVEFSRAALTEPLSVATHILRRASVQEIKTMAVIGGGTIGLMTLYLAKKKGVEKIICSDPAAYNRNQALKFGADLAVDPL-SEDPVKAAMQITDG-EGVDLCIVAAGAPMILDQASQMTRKGGEIGLVAMI-TKPITFYCYSIVFREQRIFGSQIYQTCDFEDAL-----GVVQTDELSAFVTQRMPVED-VQKAMEMLAEKKENVIKIILE........ 338
164 0.000e+00UniRef50_A0A136Q1L6 Putative chlorophyll synthesis pathway protein BchC n=5 Tax=Clostridiales TaxID=186802 RepID=A0A136Q1L6_9FIRM  ali  29  1MRQVVLTAPKQFE-VREVPVPEIT-ETQVLIRVRAVGICGSDIHAYYGEHPF------------ITCPVVLGHEATGEVVKTGKKVENIQPGDRVIYRPQKICGE--------------CSLCREGRYNVCKKLEVWGCQDT-GASSEYYAVEKELVYKIPDHTGYGEGTIIEPLAVGVHAVKRSGVK-GKKVWVIGAGTIGNVVAQSAKGLGAAAVMVTDVSDYKLEMAKKCGLDYPVNI-KNEDAAQVMREKF-GEDGADVVYECSANEKALNQALDIVRKGINIVIVGVYGNR-AAVNLANVQDREYSLVGTLMYTEEDYLEAIGLVRGGKV---DLKALISKEFPLEQTAE-AYQYIEEHKDDVQKVILN........ 339
165 0.000e+00UniRef50_A0A1G9FDD4 Alcohol dehydrogenase/L-iditol 2-dehydrogenase n=3 Tax=Actinobacteria TaxID=201174 RepID=A0A1G9FDD4_9ACTN  ali  29  1MKALVKYAHEDGAVVRDVPRPQA-GPGTVLVRVHSVGVCGSDIHMWHD---------TQSKSSKGVLPVTLGHESAGTIEAVGEGVTGWSPGDRVVCETAASCG--------------VCALCRAGQYNLCPWREGYGLKR-DGAMAEYVVAEPRVLHRIPEGMPYELAAMCEPYAVAYNAVERAGVRPGDLVVIQGAGAIGTLSLEVAIQQGAATTVVTDIDAHRLEKAKQLGADHTVDVTR-QDPAELIAELHDG-LGADLVVDATGVSAALRQSMELVRPGGAIAKVG-WGPQPLGFTIDPLVKKAVTLYGCYSHTWSTWERVLRLFGQRRLRPDLVLG---GTYPIEE-WQEAFSAM--QRGDNIKSALRMAGPDER. 352
166 0.000e+00UniRef50_A0A1Y2N5M7 Sorbitol dehydrogenase n=29 Tax=Actinobacteria TaxID=201174 RepID=A0A1Y2N5M7_PSEAH  ali  26  11.RAAVLHGALDLR-VEEVPV-TGPGPGEVLVAVEAVGVCGSDVHYFTDGR---------NGRNVLRGPMVLGHEPAGVVAALGSGVDGPAVGTRVAVEPAVGCGH--------------CPTCRSGAYHLCPSGTCLGSPPTDGAMSGYRAVPARAAHPLPDTLPTELGALVEPLAVAVHAVRRAGVGTGHRVLVTGAGPIGVLVAQVARAAGAEQVVVTDVHDARLDRAAGLGATGTVNTARDDLPDAA----------FDRLLECSAVPAALWQGMHALGPAGRATVVGQAPPAVDGLPLALMQRWEIDLNASFR-SAHAFGPAIGLAASGRV---DLAGVLTGRFALSDA-PEALRAPGADP-HHLKVVVRPGD..... 345
167 0.000e+00UniRef50_A0A1V5T1W9 L-threonine 3-dehydrogenase n=2 Tax=Bacteria TaxID=2 RepID=A0A1V5T1W9_9BACT  ali  25  1MKAAVYYGPGDLRI-EESPLPEI-GPGDILLKVGACAICGTDMRIFRHGH------------RGVKIPQIVGHEIAGTVAEIGKDVKGYAVGDKVAVDPIVSCGE--------------CFYCRRGLTNLCENYEAFGYY-YPGGFAEYMRIPEKNLILIKDDLALEEAAIAEPMACALNGQMLSQVGVGDHVLIIGAGPIGCMHISLAKTLGATKVIISEFQEGRLNLARQFGADIYVNPMQ-EDLKEVLMKATNG-IGPSVIIISAPARKAQEMALDLAANQARINFFGGLPKDDVNLDSNVIHYKELFIHGTSGTTSNHIHKCIELMAGKRV---NASQIISKVISLEELPAM---LVEAEKGNYLKIIVKP....... 349
168 0.000e+00UniRef50_A0A1S8NWP8 Galactitol-1-phosphate 5-dehydrogenase n=8 Tax=Firmicutes TaxID=1239 RepID=A0A1S8NWP8_CLOBE  ali  26  4MKALIIEDVKKL-LYKDIEIPKVEK-DKVLIKVKACGICGSDV-------------PRARDGAVHSFPQVVGHEFSGDIVEIGSEVEGYKVGDRVTAAPLIPC--------------RKCENCEKGKPAMCTNYSFIG-SREQGAMAEYVAVPSRNLIKLADNVTYEQGACIEPITVALHGVERVNIISGKKAIVYGCGTIGILLMQCLKAKGIEKIYVIDIDDFKLSLAKELGAYEVINPLRTD-----VKEYFCKNGKADYVFETAGVNFIQSEVLNLVDRLGSVVYVG-TAHKDVTIDFENILRGELNVTGSWMFPGSEWKAAVEYLESGKI---NVDKIITHRFKLEDGY-RAFEAMLSKEENSIKVM.......... 343
169 0.000e+00UniRef50_A0A1E4TGU3 Uncharacterized protein n=1 Tax=Tortispora caseinolytica NRRL Y-17796 TaxID=767744 RepID=A0A1E4TGU3_9ASCO  ali  38  1MQAVRYHGLHDVRY-ETVPTPIIQAPDHILIEPWWCGICGSDLGEYVHGPSAVPTTT-CHPITKEKCPVVLGHEFAGYVIEVGSAVTKIKPGDKVCSSAIIRC--------------EKCYFCKINEPNKCVQLGFLGLSGFGGGMSQRVVIPQVMAYKLPDHLDLRLGALMEPLAVSYHGVMNTGIGPGQTALVLGAGPIGLCVLYGLKIRGVSKIIVSEPSEQRRKLAEDLGA-LTIDPAKTK-VSRQVKSW-NNGIGADASFDCSGVPSTLDDGLTGIRPGGTFMILALI-KKPTTVNFARVQYFEKSIKGGVCYTDEEFEEVINAVGTGVI---DPSPLITSEIHGKDADALGFKELARANPEQIKILVT........ 351
170 0.000e+00UniRef50_A0A1C6HAE6 Sorbitol dehydrogenase n=3 Tax=Clostridiales TaxID=186802 RepID=A0A1C6HAE6_9FIRM  ali  29  1MKALVLEDIGKFAM-KEVPAPQ-PTAGEVQINIKAVSICGSDVHGYDG------------TSGRRKPPVVIGHEASGIVTKVGSDVTKFKPGDSVVFNSVKYCRD--------------CYYCKRGMLNVCDNGSCYGVHHLDGAMCEYLCVPDYIVYKMPDGISFETAALIEPLSIACHAVGALNIGLNDTGIVFGAGIIGLMMLKVLKTTGCRKVIMVDLDQNKLQLAENNGADYIIDG--GEDVPAKIKEITDG-LGADFALEAVGVSATITNALNSLKKGGTLVQVGNVSQK-VELPLQTIVSNEIKIQG--RYTATEYEIGLELVSSGKVSLDDCLSVV---APLEEG-QKWFDKLHNPKEGLIKVVLKP....... 346
171 0.000e+00UniRef50_A0A1S3H0Y5 sorbitol dehydrogenase-like n=1 Tax=Lingula unguis TaxID=7574 RepID=A0A1S3H0Y5_LINUN  ali  26  10..AAVLHGKNDIRL-EETPVPQ-PGKGQVQIRVHSVGLCGTDFHAWQRGYFVTD-------EHPLVKPFIFGHESSGVVCAVGEGVTDLKVGDRVAIDPAPSCGE--------------CEFCTKGRSTLCPKLNLW--EPGMGHLRQVIVHKAALCYKMPDTMTFEEGALLEPFVVAVYGCERGQVRVGTTVLIVGGGSIGMLSLVAAKAAGASKICVVDIRQSRIDFAKKMGATHTVLV-EGSDTAATGKKIGEMGDLPEVVLECSGTDPGMQTAIHAVKKGGKVVLVGVAPQ-TATIPAAMLFVKEADILCAFRYGNN-FKNSLAAITAGVV---DIKPIATHSFPLEKIVH-AMEIASTGQEGALKVMVQPGK..... 353
172 0.000e+00UniRef50_A0A2D5UE75 Uncharacterized protein n=1 Tax=Nitrospinae bacterium TaxID=2026769 RepID=A0A2D5UE75_9BACT  ali  28  1MKALMKTAKGPGQMIQDIEEPS-PGPGQVRVRVKWAGICGTDVHIASGEFFYYF------------PPLVLGHEFAGEVDEIGEGVEGVSAGDRVAVEPTKSCGQ--------------CLHCAGGNYNRCEERDIAGV-VSHGAFTNYVVTRAASLHQLPDSVSLKAAALMEPLAVCVHGVEQCTLAEGDIVLVVGPGTIGLACAQVAMASGARVIVATSRDSARLALVKRLGAFQTVNVEEG-DLEDVVAEAT-GGAGVDMAIEAVGAAASVQACFEAVRKGGQILQVGLPGE-PVAVDLTRLAWKEIRLAGTFGQKYSAWRKALRFLEEGKV---DTEAMVSDVLPLAD-WEAGFRIME--RGEGLKVLLEP....... 342
173 0.000e+00UniRef50_A0A1A9VGV6 Uncharacterized protein n=1 Tax=Glossina austeni TaxID=7395 RepID=A0A1A9VGV6_GLOAU  ali  24  58..AAVLYEINDLRL-EQRPMPEI-GPKDVLLAVDCVGICRTDVEYWQKGR---------AGPYVVEEPMILGREASGIVVESGEQVQHLRKGDRVAVEPGESCRH--------------CQLCRSGQYNLCPFIRFCATPPNDGLLTRYAKHPAHLCYKLPDHVTMEEGALLEPLAVGMASCRRAKVGLGSEVLILGCGPIGLTTLATATSIGASKVLIVDKKKDRLEIAKNFGAD-TLHLKDDCNPRDLAQSIATMGCIPNKCFDCVGTVESLKLAIYATRPGGMCTLVGVPDGKIV-LPLIDAMSREIDILGVVNY-RNDYPIALAMAASFELSLP---AIISHHFALEQ-ISLAFETAKLQADGTLK............ 394
174 0.000e+00UniRef50_A0A0G4J6F2 Uncharacterized protein n=8 Tax=Eukaryota TaxID=2759 RepID=A0A0G4J6F2_PLABS  ali  24  6.KAAVLAGVDRLEI-RDVPMPPAPGPNQVVVQIKALGICGSDVHYWKHGRI---------GSFVLEKPMVIGHESAGIIAKVGPNVQHLRVGDRVAIEPGESC--------------RTCRFCKTGQYNLCPGMKFFATPPYDGSLCNFILHPADLCFRLPGNVSLECGALCEPLSVGVYACQRGQCQPGQRV------------------------IVTDISDERLEFAKSMGASAVVNVKANEKEVAAAIIGANQGEPVSLSIECSGSERAVRPAILCTQPGGCVTLVGM-GNDNANIPIIDAAVRQVDLRGIFRY-KNTYPTCISLLERGLV---NVVPLITHRFSLEDNLIDGFETARTGRDGAIKVMFS........ 354
175 0.000e+00UniRef50_A0A1F7TRH9 Uncharacterized protein n=3 Tax=Nitrospinae/Tectomicrobia group TaxID=1802340 RepID=A0A1F7TRH9_9BACT  ali  31  1MLAARWHGREDVRL-EEISEPS-PGSGEVLVEVGYCGICGTDLHEYHHGPLLIPR--RPHPLTGRLPPVVMGHEFSGTVVARGPGVSAPREGARVTVNPCLSCG--------------RCAQCKEGRAYLCSRLGSIGF-AADGAFARRVVCPAANCHLLPDKLPLEGASIAEPLAACLHAWGRGGGRAGEAVLIVGAGTVGLLLLQVARERGAGEVLVVEPLAARREKALALGAAAVFDPARDEDVGRTLLRE---RGGVPLAFECVGRPAALETALRASGRGGRVVVIGLFTEA-VPVDFFRLFVQEKTIFASSAYTDAEVGEAVAWLAEGQVA---WKPIVGGPIPLADILPAGFGRLSDAPSSHVKLLVDPTG..... 351
176 0.000e+00UniRef50_A0A1I0FA30 L-iditol 2-dehydrogenase n=3 Tax=Bacillaceae TaxID=186817 RepID=A0A1I0FA30_9BACI  ali  28  1MKALNLYGVQDLRFEEQTPEPTIENPDDVIIRVKSVGICGSDTSRYKKLGPYV-------------EGMTFGHEFAGVVTEVGPEVKNVKIGDRVAGCPAFVCGE--------------CESCRRGEPSQCEKLHVMGAY-KPGAYAEYTKLPETHVIPLPANVDFDTAALVEPASVVAHGFYRTTIRPGAEVAIMGVGSIGLLAVQWAKIFGAKKVYSIDIDDKKLSIAKELGADVAINSLEKP-PHEQILEHTNGR-GVDLAVESAGSPITSAQVFALPRKGGEVVFMGIPYADITRFYFEKIVRNELKVYGSWNFPGKEWASTVHYMSTGQIV---VDPMISHRLSLEEG-PEALQKIINREIESVKVLFLPEK..... 350
177 0.000e+00UniRef50_A0A1F8AC55 Uncharacterized protein n=1 Tax=Aspergillus bombycis TaxID=109264 RepID=A0A1F8AC55_9EURO  ali  25  701...CLLYGALDARF-EDRPMPVLDNPHDVIVQIAYT------VHFWLHGGIRTYVSE--------TQPLTMGHEASGTIHAVGSGVTTLVPGDRVAIEPGYPC--------------RRCARCKLGRYNLCPEMKFAADPPTHGTLTRYFKLPADFCYKVPDQISLADAVLMEPLAVAIHAVRLADVKLGNRVVVFGAGTVGLFCAAVAREFGAGMVVSVDVLENRLRFAKEFVGDVPDLSSTPEENAQRLIRTQGLGEGADVVIDASGAEASVQTGVFSLRMGGTYVQAGM-GKRKIEFPISEMCEREIVAKGCFRYGAGDFDLGIHLVSSGRLQ---LKGLVTKIFPFE-AAPEAWETA--KRGEGTKTLIE........ 1050
178 0.000e+00UniRef50_A0A0S6VU62 Alcohol dehydrogenase GroES domain protein n=1 Tax=Candidatus Moduliflexus flocculans TaxID=1499966 RepID=A0A0S6VU62_9BACT  ali  28  1MKALVLENARTP-VIKDVPVPEI-GTDDLLIRVKAAGICGTDVHIYEGEYFS-------------EFPLIPGHEFSGVVEQVGKNVRAFMPGDRVTADPNIGCG--------------KCYFCQINQQNQCEQLEAVGV-TRNGAFAEYIAVPEHKAFHIGD-LSFQDAALIEPLACVVYGLQQTPIPIGADVLIFGAGPIGLMLMQMLKHAGAARVVIVEGRENRRALANTLGAHHVV----AVDGTERDMLKSLSQTGFDVVVDATGIPKVVEQMTIYARNRGILLYYGVCPKDTIRISPYEIFRRDLKIYGAFALC-NTFAPAIRFLQN---QVVNVTSLLSHTFALEE-FEEALATMRS--GNSMKVQLQPD...... 335
179 0.000e+00UniRef50_A0A2W4MVY4 Alcohol dehydrogenase n=1 Tax=Firmicutes bacterium TaxID=1879010 RepID=A0A2W4MVY4_9FIRM  ali  27  5MQALVFYQPGDMR-VEEVPVPEV-GPEEILVRVHACSICGTDLRTFKAGH------------TRIKGRRILGHEFSGVVARVGAAVEGFAEGDRVMVVPGISCG--------------MCVYCRQGLENLCLHRTIIGFD-YDGAFAEYVRIPAANVRKLPDPFDLTAAALVEPFTAVYNGQRLLNIRPGETVGIIGAGPIGVMHLLQARAQGAALVGFIEISEGRIQEARRFRPDFVINSRQ-EDPVERVRQLT--GLGLDVVIVAAGSAEAQRLALELARPAGRVSFFAGLPHDEAVLNTNLLHYKQLAVFGANGSGPNQYDTTLRWLASGAI---DLRPLITTELPLAE-VHAGFDRVA--RGEGLKVVIRP....... 348
180 0.000e+00UniRef50_A0A2N3GPQ6 NAD(P)-dependent alcohol dehydrogenase n=2 Tax=Actinobacteria TaxID=201174 RepID=A0A2N3GPQ6_9ACTN  ali  28  7MYASVLTGPKRVEL-ESRPVPS-PGAGGVLIKVTAVGVCGSDTHFFESGAV---------GDIVVRDHVVLGHETAGEIVAVGAGVDASRVGTRVAVEPQTPC--------------RACRFCKRGAYHLCPSIRFFGAWPVDGSFAEFVIVDADFAHEIPSAMTDEQAALAEPVSVAIHAARRAGVKAGARVLITGAGPIGVLSAQVAKAFGAVEVVISDPIAKRRDFARARGADEVIDSA--GDGLARFDQY------FDIYIDASGSAQAIRAALPTIVRGGIAVLVGM-GGNQLDVPVAMLQHREITLTGTFRYV-NTWPTAIDLISRGIV---DTSGIVTGRYGL-DGVEDALMKAKTDP-EAIKTMIIP....... 341
181 0.000e+00UniRef50_W4JRP0 Uncharacterized protein (Fragment) n=1 Tax=Heterobasidion irregulare TC 32-1 TaxID=747525 RepID=W4JRP0_9HOMO  ali  26  7...AVFTNKAHDLYVEESPYPT-CGDDQCIVRIRSTGICGSDIKFWRAGHV---------GSIIVEEPLGLGHESAGEIVEIGKDVTKLKVGDRVAIETTIPCG--------------TCKHCLIGRYNLCPTATSIGAPGTPGCLRRYIAHRAAWLHLMPPDMSFATGAILEPLSVALAGIRRADLRLGQPALIAGTGAVGLLAVALANAAGATPIVATDISQPRLEIAKKLGAKYVVNVKSPAEVVKEIVSLTGEADRPEVAIECSGIESSIQSAMLAVDAGGVVLQIGVCGKEHVAIPFGAVMDREIDLRYLFRY-KSTWPAAIRLASTGKL---NLEALISHTFSLEDCI-KAFETVLDPHSGAVKVIVSPHS..... 353
182 0.000e+00UniRef50_A0A1F4BM29 Uncharacterized protein n=1 Tax=Betaproteobacteria bacterium RIFCSPLOWO2_02_FULL_67_26 TaxID=1797492 RepID=A0A1F4BM29_9PROT  ali  26  1MIAMMLHGGGDLR-RETVPDP-APAPDEAVVRVRACSICGSDLHAYHGKHP------------RLTFPRVLGHEFAGEIVALGGAVTGFHAGQRVCCDIDLACG--------------RCGPCREGRGNLCEQLKTMGFDR-DGAYAEYAAVPDFNLHPLPENVSYDQASAVQVLGISYHAVDRVRPKPGEKVAIIGAGPIGLGAALIARSLGA-EVTILDILDYRLALAQRLGIPATMNANEG-DLRERALAAT-GGRGFDKVVECVGQERTVADAVRMVKRGGQITIVGTFPENKATIPIAHIKDREIDINFSRG-NFQAFAPCLELIASGRI---DPERYISHRFPLARAAD-ALRLLEARDVEAHKIVLHPGAGAQGQ 348
183 0.000e+00UniRef50_R8BDM2 Putative d-xylulose reductase a protein n=1 Tax=Togninia minima (strain UCR-PA7) TaxID=1286976 RepID=R8BDM2_TOGMI  ali  29  6.RAFVLQSIKNVSF-EDRPVPSLRDEHDVRIHVEQTGICGSDVHYWQRGRI---------GDFILQSPIVLGHESAGVVVEVGKKVKNVKVGDRVAIEPGVPC--------------RRCDFCRSGAYNLCEDTVFAATPPHDGTLQKYYTVASDYVYPIPEHMSAEDGALVEPVAVAVQIVKVADLRAGQSVLVFGCGPIGVLCQAVAKASGASKVIGVDISESRAQFARDFAADGVYVSNEGTDPVEKIVAEFGLGEGADVVLECTGAEPCIQAGIFAAKKGGTYVQAGM-GRENVTFPITTACIRALNIKGSIRYSTGCYPQAVKLIASGKIQP---SKLITHRFKFEQAVD-AFELI..................... 347
184 0.000e+00UniRef50_A0A177C227 GroES-like protein n=1 Tax=Paraphaeosphaeria sporulosa TaxID=1460663 RepID=A0A177C227_9PLEO  ali  27  10MKSIVLYKAGH-AKVQDAPVPEIVDPHDVLVRIAFVGVCGSDVHFYRHGGISRMVDPAV--------GITMGHEASGVISAIGSSVTRVRPGDRVAIEPGQPC--------------RFCRPCKSGSYHLCKNMRFAGPPATQGTLSKYYRIAEDFVYKVPESMSLEETVLVEPTSVAVHAVRLGDVRPGETVVVMGSGTIGLLVGNVARQFGAHRVVLVDVLPRKLEFAKGFLECETFLSDREHSAEQAALLEALGLEEIDTVIECSGVSVSIETGIYVLRGGGKYVQTGM-GRPKMEFPMTVMSEKELVVRGCFRYNTGDYDLAVSMIAKGLI---NVKPMISSTSEFEDAT-GAWE--KTARGEGIKNLIR........ 360
185 0.000e+00UniRef50_A0A1V5TAS1 Sorbitol dehydrogenase n=1 Tax=Firmicutes bacterium ADurb.Bin262 TaxID=1852887 RepID=A0A1V5TAS1_9FIRM  ali  26  1MKAAVLEGVGKLRFRDDYPVPQIGG-TEVLIRVEACGLCATDIKMYKG-------------EYTGRLPVVAGHEFTGVVENIGGGVKNIRPGDRVVVDPNESC--------------CACADCKTARSTFCRDMAAYGV-FTDGGFAQYAKADERGVYKIPDSLPPAAACFVEPVSCAVRGIDRAHIKAGDTVAVLGAGTMGQLLIQLAANSGAARVVSIDPLGWKLELSKAHGATDTVDAS-ATDTQAKVAEIT-GGRGADVVFEAVGSVQAFETALALAARGGTVVQFGFAPEARAQIVPFEILSKELTIAGSW-LNPYTFERAIKALASGIVTTQ---RLITDRLPLGE-LEQGIQKAMRRPEGFIKAVVFPD...... 341
186 0.000e+00UniRef50_A0A1Q7QD73 Uncharacterized protein n=4 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1Q7QD73_9ACTN  ali  29  1MRALRWFGRRQVRL-EDLPLPE-PSPNEVVLRVAYCGICGTDIEEYASGPLLIPVT--PHPLTGRMAPLTLGHEFAGTVAARGSEVKTLNVGDRVVPEICLYCG--------------TCVYCRAGKHALCQSWAAIGLHT-DGGLADYVSVPAEACSRLPDSVTDQEAALIEPLEVAVRAVRKANLDRGGTLVITGAGPIGLLVLQVARAAGAGRIVVVEPREARRKLAGTLGADSTI--------VEVVGELA-----ADAAIECAGRSESVQTAFESVRKGGRVVLVGI-PTGSLSLDLMPLISGERQVVGSIQHQREDLEVALKLVTDRKV---DLTALISDVIPLS-AVAGYLENSGSATNDATKVIVDVGGAG... 343
187 0.000e+00UniRef50_A0A0A2TW45 L-threonine 3-dehydrogenase n=20 Tax=root TaxID=1 RepID=A0A0A2TW45_9BACI  ali  27  5MKAIVKHHQGEGAQLQEVPIPAI-RENEVLIKVKATSICGTDVHIY---------NWDEWSASRVHTPYVFGHEFAGEVVEIGEHVTMVDVGDYVSAETHIVC--------------HKCPQCLTGQYHICENTQIIGVDT-QGCFAEYVALPESNLWVNPSDMPTDIASVQEPMGNAVHTVLNGEV-AGKNVAIIGCGPIGLMAVGVAKAAGASQVLAFDVNPYRLQLAEQMGATTVIHSG-NEDPVERAKSLTNEH-GVDVVCEMSGHPKAMDQGFKMITNGGRVSILSL-PVRPVTLDVNDIVFKGVQVQGITGRMFKTWQQVSRLLQSKQV---DLAPIITHHLPLEE-FEKGFSLM--NAGQCGKVVLHPNE..... 348
188 0.000e+00UniRef50_UPI0001F27501 alcohol dehydrogenase n=1 Tax=Aspergillus niger (strain CBS 513.88 / FGSC A1513) TaxID=425011 RepID=UPI0001F27501  ali  35  22MKAARFHGRGDIR-VEEIEEPT-CGKGQVKMRPSFVGICGSDIHEYSGGPVLVP--EKPHGITGTSLPVTLGHEFSGIVEEVGEGVTHVSPGQRAVVRPTIF--------------DRECTSCKQGYEYCCEKIGFIGLSGYGGGLAKYIVAPAEHFYTIPDNVSLEAAALVEP---------------GRTS--------GIGIIQVLELQGAKNIMVAELTENRKRFASNYGATHILDPRE-VDVAAKVRELTDG-VGVDVVFDTAGVEVALNGAIAACRTHGTIVNIAVWEKRPA-IRVNELMYSEINYTGSALYDESAFREVIRALSYGQLKP---ERMVTSKIRLDEVVEKGFQALVDDRDSHCKILVDVQ...... 350
189 0.000e+00UniRef50_UPI000D6595BF Zn-dependent alcohol dehydrogenase n=2 Tax=Clostridia TaxID=186801 RepID=UPI000D6595BF  ali  30  1MKALVKYGVGDVEL-REVPEPEI-GPEDVLLEVKAAGVCGSDIEMWHHK-----------VTFPVNVPVIQGHEFCGVIKEIGAQVKGFKTGDRVVSETAAHCGH--------------CYHCRAGEYNLCPERKGYG-SAINGCFTKYVKVPARILHYIPENVDFDAAALTEPACVAYNAVFKSHLRPGEPVVVIGPGPIGLFAVQMARIGGAYPIVLTEADAGRMEIGKKIGANMTINVSQ-EDPEEVIGKLT-GGLGVPLVIDAAGNNAALKTAMALVRRNGQITKIG-WGPKPVDMSLDPIIAKAATLQGSFSHTWSTWEAVLQLIANGTIMMD---PMITHRFPLDK-WEEAFRL...................... 331
190 0.000e+00UniRef50_UPI000DBE44E0 zinc-binding dehydrogenase n=1 Tax=Nakamurella sp. 12Sc4-1 TaxID=2164074 RepID=UPI000DBE44E0  ali  31  1MRAARFHTAHDIRI-EDVPEPAISAPDELLLEVALCGICGTDLHEYTAGPIVTPV--DPHPLTGATLPQILGHEFSARVREVGPAVRGARVGDRVSVMPAIVCGH--------------CWACRHGKANLCSNFAATGLSAATGGLAPWAVVKDYQVAVLPAELTDEDGALVEPAAVAGYGLERARVEGGDTVLVTGAGPVGALSALYADAVGAGLVIIVEPNPRRAARARALDVGPVLDPS--EDLDEAIAELTAG-VGVDVVAECSGTSAGLGLAVRTTRPAGRIVQTGLH-TRPATLDAMLLAQKDLDLYGSWCFRTTDWPRIIRMIARGSYP---VRKVLTSVVALDDVVTQGFDALVDPAGDQLKVLVRPGDGAPER 358
191 0.000e+00UniRef50_A0A194UZF9 Sorbitol dehydrogenase n=1 Tax=Valsa mali var. pyri TaxID=694573 RepID=A0A194UZF9_9PEZI  ali  25  7.RASVLHGAKDLR-VEERTFP-APNPDEVLVAVKSTGLCGSDLHYFSHYR---------NGDIQVKQPMTLGHESAGVVTQVGADVKHLQPGDKVALEVGLPCGQ--------------CKLCGEGRYNICRAMSFRSFPHAQGTLQEVIAHPAAYCHKLPDDVGLELGALVEPLSVAMHAGDRAALPRGSTVLVLGAGAVGLLCCAVSKVLGAGRVVVADINADRVQWALDRGAKVVVPLKRPEEFAREVAELAGTKEGVDATFECTGVESCLQAAIYATRPGGKIMIIGM-GNPIQTLPISAASLKEVDLVGVFRY-ANTYPRVIELLSSKNPLLPPVEELITHRYGSLDSIPHAFDMAGKVKDDEGKLVLK........ 377
192 0.000e+00UniRef50_A0A1Z9M1I5 L-idonate 5-dehydrogenase n=1 Tax=Alphaproteobacteria bacterium TMED194 TaxID=1986630 RepID=A0A1Z9M1I5_9PROT  ali  28  1MKSLKIHGPEDLRI-EDYPL-ENISPNQVEVSIAVGGICGTDLHYYKHGGF---------GQIKLKEPMILGHEVSGFISKIGSNVENLSIGQLVSISPSRPC--------------NKCSFCLNGNQIQCINMKFYGFPHIQGAFREKLIAEDYQCIP-ADGLSTEEAAMAEPLAVCLHAIKQAEKIFGQKVLITGSGPIGTLCVAASRRAGAEEIIVTDISTNALTFAVSVGADKVINVFEEHD---ELKNYQSNKGYFDIAIECSGSAQGISDAINCLKPKGTLIQLGLGG--DVLIPLVSVTTKELNLKGSFRFDSE-FELAVNMMKKKLI---NVNPLITHKVDF-NSAKKAFELALNSDEQSMKIQLSF....... 343
193 0.000e+00UniRef50_A0A1I0F9W1 L-iditol 2-dehydrogenase n=13 Tax=Terrabacteria group TaxID=1783272 RepID=A0A1I0F9W1_9BACI  ali  28  1MKSLVKHGFGNLEI-QDKPEPS-PGKDQVKIEVKYAGICGSDIHTYEG-------------HYKVGVPVTLGHEFAGEVVEVGEGVTEFKVGDRVTSETTFYCGE--------------CEYCKAGDYNLCNHRKGLGTQ-QDGGFAKYLVARKDSLHPLPEHVTYRSAAMTEPLACTHHAVAKTEINEGDIVVVIGPGPIGLLAAQVAKSRG-GTVIITGLDKVRLDKANEIGLDYVVNTQE-EDVKELVNKLTNGY-GADVLLECSGAVPAAKQGLDLLRKKGQYAQVGLFAQPDIQFDLEKIIQKEIRVVGSRSQKPADWEPSLALMNERKVLA---EALVTHEFDITQ-WDEAYDAIKS--GEAIKVLLTP....... 341
194 0.000e+00UniRef50_A0A1D7XEC6 Sorbitol dehydrogenase n=15 Tax=Bacteria TaxID=2 RepID=A0A1D7XEC6_MOOTH  ali  26  9MKALVLFGPNDVRLVEK-PVPK-PGPGEVLVRVAACGICGTDVKIITKGMPKMPPYGE----------FTFGHEWAGTIVALGETVDEFQVGDRVAIEAHKGCG--------------RCENCIDGKYTACLNYGRLAGMTVDGGFAEYAVQHVNSVYKIPDNITFNEATYVTTAGCALYAIDKSGYIAGDTVLVIGPGPIGLSVVQGARSLGAEKIILMGTREDRLVKGRELGATHTINIREVADPVAEVMAIT-GGKGCERVFECAGNSQSFEYGIKAAKKGGVMVLVSFY-KEPVMANLDYVVLNQISLLTVRGEGNQNCKRALSLMAQGKI---DAKPIMTHAFPLEE-FQKGLDYFVNRKDGAMKVVINP....... 358
195 0.000e+00UniRef50_A0A069PSC4 Sulfurtransferase n=339 Tax=root TaxID=1 RepID=A0A069PSC4_9BURK  ali  27  1MEALVLEEKGRISL-RPFALPQVTGPRDVRIRVHTVGICGSDIHYYQHGRI---------GPFVVNEPMVLGHEAAGTVIEVGEEVKHLKAGDRVCMEPGVPDMESRAS--------------REGMYNLDPSVRFWATPPVHGCLAPFVVHPAAFTFKLPDNVSFAEGAIVEPLAIGMQAATKAAIRPGDVAVVLGAGTIGMMCALAALAGGCSRAIVCDLVPEKLDLIAGVGVTAVD--IRERRVRDVVSELT-GGWGANVVFEASGNEKAFDGIVDLLCPGGCLVLVGM-PQKAVPIDVVAVQIKEARIESVFRY-ANMFERAIQLIASGRI---DVKPFISRSFAFADGI-KAFEEAASGNPSDVKVQIVME...... 344
196 0.000e+00UniRef50_A0A1V8TMN5 Uncharacterized protein n=2 Tax=Rachicladosporium TaxID=470018 RepID=A0A1V8TMN5_9PEZI  ali  39  1MRALRFHGKGDVRL-DDIPIPQ-CGPREVRLKVAYCGICGTDVHEYLDGPILLPSHDEPNKFTGAGLPLTMGHEMSGIVTEVGGDVKSVTVGQRVCVNPATGCEH-------------------QGRP--------------DCGFADEICVDAIAIKPLADHVSLKLGAMAEPLAVASHMVRVSGFQKGQNVVVLGAGPIGCALTLLLKEVGAKCILVSEMAESRTVQAKACGATRVVHPMR-DDVLAVTLDM--MAPGADVVFDACGIQSTLNTALDCTKPGGTIFNVAIH-EKPLQIDMNRITLSEKRILAGNAYTNDDFDTVVRLLER---RGPEIESFITAVVPLEQAVSGGFEELVHHKARHSKILIEVGGELRER 340
197 0.000e+00UniRef50_A0A2M8PEA2 Dehydrogenase n=2 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2M8PEA2_9CHLR  ali  24  5MQGVFFLGAGQLEL-REVPIPE-PAEGEVVVKVGAATTCGTDLKAYRRGHKLF------------KPPMPFGHEWAGTVVALGKGVQGFKEGDRVTAANSAPCG--------------ACYYCRRGKPQLCLHLESR---FNWGTYAEYLRVPAHIVHKIPDHLSFAEAAFIEPLACAVLCINYAEIALGDTVAIIGSGAQGLMQIQLAKAMGASRVIAVGRAHGRLAVAAQLGADHTISTLET-DAVAAVRALTEGR-GADVVIEAAGSAETWQMACQMARPAATVVLFGLPGGTQVSFDATHVHYDEITLKGVFHHTPRTVEQALQMLISGQV---NVKPMISGEISLRE-VEEGLNRMA--RSEVIKLAVLPE...... 346
198 0.000e+00UniRef50_A0A1V2SBF3 Zn-dependent alcohol dehydrogenase n=3 Tax=Bacteria TaxID=2 RepID=A0A1V2SBF3_9BACI  ali  28  1MLAVMKTKQGFGNVCTNIDEPT-CSAGSVKVKVAYSGICGTDLHVFHD-------------TFKNNPPVILGHEFSGVVSQIGEGVSSISVGDRVAV------------LGSTAVTCGTCHYCKTGNYMFCNDRRGMG-HGVHGSFTKYVVVREDMVYKIPENISLEEAALSEPLACAVQAIELTNIQLGDTVLLSGPGPIGLLCLSLLVEKGC-KVIVAGTSEFRLHLAKKLGADIVVNVNH-EDVECMIAKETKG-CGVDVVVECAGAVSSINSCLKNVKKLGKFIQVGIVGHD-ITLDYDTVLYKQIQLFGSLAHSMKTWDRVMQILEQKKV---NLAPIITHKMSLSE-WEKAFELCE--KKSCGKVLLH........ 341
199 0.000e+00UniRef50_A0A0J1CWS0 Phosphoesterase n=25 Tax=Proteobacteria TaxID=1224 RepID=A0A0J1CWS0_9BURK  ali  27  1MHALVIHAPLDLRI-EDVPTPE-PEAHQLLIRVRAGGICGSDLHYFNHGGF---------GTVRIKEPMVLGHEVSGVVSRTGTEVTDMPVGTRVSISPSRPCGH--------------CEYCQQGLQNHCLDMRYYGTPHVQGAFRQEIVIDRSQAHSVSDALSDAEAAMAEPLSVALHAVRRAGLLLGKRVLVTGCGPIGALIVAAARRAGAAHIVATDVNELPLKSAREVGADQTFNILQAPD---ALLPFAAGKGTFDVLFEASGNASALRGAFDAIRPRGVIVQVGLGG--DVPLPMNVIVAKEFDLRGAFRF-HEEFAIAVELLNKRLI---DTKPLISDIFSYRDSL-KAFETA-NDRSKAMKVIVDFG...... 344
200 0.000e+00UniRef50_A0A1B0BM25 Uncharacterized protein n=1 Tax=Glossina palpalis gambiensis TaxID=67801 RepID=A0A1B0BM25_9MUSC  ali  25  726..AVVLHAKQDLKL-ETKPIPKIE-PKEVLLAIDCVGICGTDVHFWQAGGM---------GFDVVKDPVVLGHEASGVVCEIGKDVKELKVGDRVAIEPGKFC--------------RNCQVCRQGRYNLCPFMKFHSCPPTDGLLQRYFKQDADMCHKLPDHLTMEEGALCESLNVGVAGARRAKVKLNSNVLIVGSGPIGLATSIVCQTIGASKVMMVDKNKDRLEMAEGFGMILALDESDGKDLNKTAKKIHDMGCIPDKVFDCHGSQDTFKLAIRSTGWGGTCCLMGTASGNFTDFPLMDDVMREVQITSNFRYC-NDYPPAIAIAAKSK---YDLLKMITHHMDIEDAL-CAFDTALKQEPGTMKVMVHPQGTNNPK 1079
201 0.000e+00UniRef50_A0A178ELA8 GroES-like protein n=25 Tax=leotiomyceta TaxID=716546 RepID=A0A178ELA8_9PLEO  ali  23  16.RASVLHGVKDLRIESRSLFP--PGPTDLQVSIRSTGLCGSDLHYYRHYR---------NGDIIVQEPMSLGHESAGVVVAVGSEVSNFKVGDKVALEVGLPC--------------EQCGRCKEGRYNICKDMRFRAFPHAQGTLQDRINHPAAWCHKLPENVSLDVGAILEPLSVAIQASKRAQLAASSTVLVFGAGAVGLLVAAMAKISGAATVVIADIDAGRVQFALKRGATIEEQLEIAKETAAEIGKLTGSPVGVDAVFECTGVPSCVQAAIYANRPGGKVLLIGM-GTPIQTLPISAAALREIDIIGVFRY-ANTYPTGIEVVSKKGPDYPDFSKLITHRYKGLDSTVEAFEMAARTKDDVIKVVLETGEEDK.. 392
202 0.000e+00UniRef50_A0A1F8LTI6 Uncharacterized protein n=1 Tax=Chloroflexi bacterium RBG_13_46_9 TaxID=1797619 RepID=A0A1F8LTI6_9CHLR  ali  30  1MKAIVKTKKAPGVEVRDVNVPEVT-DTDMLVKVKAASVCGSDVHVYEWTPSYEWMP----------LPVILGHEFSGEVVSVGAKVKTVAVGDRITAMPGMAC--------------SRCDYCQVGRPDLCRKRISLGLGG-DGAFAEYIRLSAATTFKLPETLSYEAASLTEPLSVVLRAVDLATLRVGQTAGVLGPGPIGLLAMQLVKLSGVSLLMVAGPDTKRLALATELGADVTVDVTK-EDPVKKALALT--RRGFDVVLEASGSPKSVPQALQMVKPGGKVILIGIHP-APGEIPTTDVVRQSKSIIGAYGYDADIWNRAIMLLNTKRVK---VDSMISHRLPLTDA-NHGFEMLV--KKEATKVIFIP....... 342
203 0.000e+00UniRef50_C5LLR2 Sorbitol dehydrogenase, putative n=3 Tax=Perkinsus marinus (strain ATCC 50983 / TXsc) TaxID=423536 RepID=C5LLR2_PERM5  ali  25  65....IIRGRGDMSM-EPIPMPGAPQPGECLIRVKNVGICGSDVHFFANGSV---------GSYAVTSPMVIGHEGAGVVEQVGEGVTDLKVGDRVALEPAVPCGH--------------CELCRSGEYNLCPEIKCFGTPPNNGCLTRYVRHPASFCFKLPENVSLEEGVMCEPLAVATYACKRAEVKDGDKVLVFGDGPIGTMAAMVSSALKAGRVLVCGHHDDKLEIVEACPQAEVLNVKGSGDVAEKIRDALGGP--ADCSVDTTGAQDAVSSCIRATQSGGRVAMVGI-GAVEMKLPVVDALLRQVDIRGTFRFC-NTYPTCIDMISSGKV---DVKQLITHRYHFNNAILQAFEDCRAGVGR............... 402
204 0.000e+00UniRef50_K8EB14 Putative oxidoreductase, Zn-dependent and NAD(P)-binding n=15 Tax=Firmicutes TaxID=1239 RepID=K8EB14_9FIRM  ali  27  4MRAAVIEGPHKITL-QEVPYPT-PGPGQVVVKVEACGICGTDYHILEG-------------DFLSPYPLIPGHEFSGTVYELGEGVENWQVGERVAVDPSVYCGE--------------CYYCLSNQGNMCQKWNAVGV-TLNGAFAEYVAVPAKNLYRLPENMNFQQGAFVEPLSCVVYAMRRLNIRFGDKVLLFGAGPMGLLLLQAVVKGGASEAVVVDLAEDKLAKARQLGAHKTFLGTAG--LQEAY------PLGFDIVIDATGVPAVIENMFRFAGNRAKIMQFGCAPKDKVSVSPFDIYNKDWEILGTMALLF-TFHPAVNLLKNGVVVAD---PLTTREISLDEFP----AYLSQPKDKDLKVLVCPWKK.... 337
205 0.000e+00UniRef50_A0A1F9C305 Uncharacterized protein n=4 Tax=Bacteria TaxID=2 RepID=A0A1F9C305_9DELT  ali  26  1MKAVVKYGKGKGLVIRDVPEPKV-KDDEVLIEVKAVSVCGSDLHIYHDNHPYW-------------PPVTLGHEFSGVLSDIGKEVKGWKAGDRIVSETRISCG--------------VCFICQSGFPQACEKKRPYGI-GVNGAYAKWVAGPARLLHRLPENIPFEVGAAIEPTAICVTSIERSRVQAGETVLITGPGPIGLISLAIAKMAGVRMVGITGRSSARFQKARELGADFIINVDK-EDPVQKILGFTDG-LGVDILIETSGGEKAISQAFEMVRRLGRVCAIGVSGKPEISIPYDRGIFKAIRFDFCFSSSWTSWERTISLISKGLLP---LEKLITHKLPLEQ-WEEAFHLLESR--QAAKVILIP....... 344
206 0.000e+00UniRef50_A0A0M8Q4F2 Iditol 2-dehydrogenase n=7 Tax=cellular organisms TaxID=131567 RepID=A0A0M8Q4F2_9BACI  ali  25  8MKAVVCHGPGEY-LLESVDVPS-PEAGEVLIKVEACGICAGDVKAWDGAPMFWGGEDGQPSY--VKTPVIPGHEFVGTVVEVGTGVTDFSVGDRLISEQIVPC--------------NTCRYCKRGQYWMCEKHDIYGFQNVNGGMAEYMNFPVNAIHKVPHDLPIEKAILIEPYACSMHAVNRANIQIGDFVVISGAGTLGLGMVAAAKLRSPGTLVVLDIRDERLELAKQFGADIVLNPSK-VDVVEEIKNMTEGY-GCDVYIEATGAPASVIQGLHAIRKLGRFVEFSVFSS-PVTVDWSIIGRKELDILGA-HLGPYCYPNVINGIASGALPTEGV---VTHKLPLEE-FQNGFEMVKSGAG-SLKVILIP....... 358
207 0.000e+00UniRef50_J2K8J0 Theronine dehydrogenase-like Zn-dependent dehydrogenase n=8 Tax=Proteobacteria TaxID=1224 RepID=J2K8J0_9BURK  ali  26  1MLNCQIHGARDLR-VEDVPT-ETLSPTQVRVGVKAVGICGSDLHYYQHGRV---------GDFLIRAPLTPGHEASGQVLEVGAQVTSVRAGDRVALNPSRTCGH--------------CRFCRVGASNHCENVHFFGWPHMQGAMREQVVVEASQCVPVPDGLSFELAAFGEPLAVALHAVQEAGSLLGKTVMVIGTGPIGALILMAAKLAGASRLIAVDIQDQTLAACTRVGATQTINAAKD---PAALDALAEGKGQVDVSFEVSGNYAGLANCIRLTRPRGTVVQVGTLNGSSEGCPFNQVMVKSLTYVGTFRFI-GEYAWAVDYLSRGVL---DVSPLLTDALPVSR-VHEAFALAADRQ-RAMKVMVTF....... 345
208 0.000e+00UniRef50_A0A1F3M040 Uncharacterized protein n=1 Tax=Bacteroidetes bacterium GWF2_42_66 TaxID=1797351 RepID=A0A1F3M040_9BACT  ali  27  1MKAALFTGKHTIEMVEK-ATPEI-RDGEALIQMKACGICGSEIPFYNG-----------IPDYLCKHPWTIGHEMAGVVAQIKGGANGLAIGDRVAVEPLINCG--------------KCYACRVGKYNCCANLKVIGAST-PGGFAEFVVVPANRCHKIPDDMPFAVAALTEPYSIGANVLRRGQITGDDLVVINGAGPIGLTIIDFAKIHGA-KVLISDVYDDRLARAKEFGADVVVNASK-ENVLEKVMEFTNNEGG-SLVIDATGVPAVIESTQHLVAPGGRIVVVG-YTENNVKIDGILIIKKEITLLGS-RNSANLYPYVIECIMSGKLK---LEKLITHRFPFER-VADAFDYANTNFKSVGKVMVEF....... 339
209 0.000e+00UniRef50_A0A1Y3QJ43 L-threonine 3-dehydrogenase n=1 Tax=Firmicutes bacterium ZCTH02-B6 TaxID=1861639 RepID=A0A1Y3QJ43_9FIRM  ali  27  5MQALVKTEPGPGLAMMEVPIPEV-GRRDCLVRVEATSICGTDLHIYR---------WDAWAASRLRPPLIVGHEFCGRVAAVGSDVTEVSVGDYVAGEGHLFCG--------------RCYYCQTGQAHICAQGRIIGVDT-DGCFAQYVRMPAANLWRLDDTVPPAIGAIHDPLGNAVHSVMAAGVS-GASVAVVGCGPVGLCSIAVAKRAGASAVYGVDVNPYRLSLAQGLGADAVIRSDT-DDPVESVKDLT-GGLGAEVVLEMSGHPAGIRAAFEMLRKGGRIVLLGIPPG-PVQADLSWIIFKEARVLGINRRIFETWHRMAELLRSG----LDVSSVVTHRFSLSE-FEQAFAVLAEGR--CGKIVL......... 343
210 0.000e+00UniRef50_A0A0N8TYV7 Putative zinc-type alcohol dehydrogenase-like protein YjmD n=106 Tax=Bacteria TaxID=2 RepID=A0A0N8TYV7_9GAMM  ali  27  1MQAAQYIGNKSFRVVESQAI--SPGDDEVRLNVGYVGICGTDMHIYHG-----------VMDTRVNPPHTIGHEISGTIAEIGKNVTGYEIGERVVVRPLDWCGQ--------------CPACDAGHSHVCQNLKFMGIDT-PGAFQNSWTVKSRTLHKLPANVSLQQGALIEPLSVACHDVARSRLTAGEKAVVIGGGPIGQLVALVAKSVGA-EVIISEPNESRRDFSNKF-AIPTVNPIE-QDLKDFVDTWTQGK-GADVVFEVSGVQPAVDAMVDIASVRGRICMVAIHAQKP-QVDLFQFFWKELELLGARVYEHADFDMAIDLVASGSI---DLAPFITSVSKLS-HISNAFENMDNNPTG-MKALVSC....... 337
211 0.000e+00UniRef50_A0A151ATT6 Sorbitol dehydrogenase n=2 Tax=Moorella TaxID=44260 RepID=A0A151ATT6_9THEO  ali  29  1MRAAVLQAPYKI-VIENVPEPK-PADGEVLIKVKAAGICGSDLHAYEGIHP------------RRRPPAILGHEVIGVIVEVGKRVRKFKVGDRVTVLPRKNCG--------------ACPPCVMDWSNLCDHKILLGTNEWAGGFAEYIVAPEETIYTIPDVLDDIVGSLVEPLAVGVHVIERGEVRRGEKVAILGAGPIGLMCVACAHRAGADHIVVADLVDFRLSAAKRLGANVVVNSAKDCFLSK--MEEACGLTQVDVAIIAAGAPVLLNEAFSIVRKKGRIILVGQFDIPDV-IDIEKSRLKEQTLVGSSTYCKEDFLDAIKILE---INRDQFELLVTHQIPLEE-IEKGIDLIRKRDQDVLKVIVKF....... 340
212 0.000e+00UniRef50_UPI000DCC5FA2 galactitol-1-phosphate 5-dehydrogenase n=1 Tax=Paenibacillus contaminans TaxID=450362 RepID=UPI000DCC5FA2  ali  33  8MKALVYYGPKQITL-EQYDMPEL-KQGEALIRIEAVGICGSELEGYLG------------HSSVRTPPLVMGHEFCGGIERIAPDVTGVQTGDKGIVNPLISCG--------------ACDRCAAGRPNICRNRQIIGIHR-PGAFAEYAAVPAANIYRVPNELDSDLASLAEPLAVCIHAVKL-GLRPFEDAVIYGAGPIGLLTLQAARQMGAGRILVVDRQQERLAFARQLGAETAL-PEQAEEAFDSLLSA----RGVDTIIDCVGVQATREQAIQLVNPGGSIVIVGL-GQDQSTLSMNHVVRREISLIGSYTYTNADFEQAVYLLTNGCISKESW----STTCSLDEA-PDAFAALTDGTAKFSKIIINPNG..... 343
213 0.000e+00UniRef50_Q5KAN3 Xylitol dehydrogenase, putative n=27 Tax=Agaricomycotina TaxID=5302 RepID=Q5KAN3_CRYNJ  ali  25  9.KAVVCHGAVDLR-VEERDIPE-PKADEVQIKVAMTGMCGSDLHYYLHG---------ANGTFKIREPLVLGHESCGVITAVGSNVNNLKVGDRVAMEVGVYC--------------KTCKMCRRGRYNLCANMRFASYPHLDGTLREVMTWPAELVYKLPPNLELPLAALAEPLSVVLHAYRRAHLSPGSRILVIGAGAVGLLTCALARASGCTTVVAVDIEQGKLDFAAQSGAEALEVAGKQWDALDAVQSVEGLEDGFDAVFECTGVESCMQMAPMAAAIGTKVLFVGM-GTKVLALPCGPSLLSEVDLIGVFRYC-NTYPDALALLASGKL--GDVSKMASHYYSLDQAAE-AFEDLKRGKDKDGRTVIKP....... 378
214 0.000e+00UniRef50_A0A0S7YP63 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium SG8_13 TaxID=1703398 RepID=A0A0S7YP63_9DELT  ali  26  1MKAAVL--KNDMQIVEEVPTPD-PGPGHVLIRVSWASVCGTDLHIFMGEF-----------KNRVAYPRILGHEFSGVIESVGPGVKHLQPGDRVTADPIVWCNE--------------CPACLNGQNNVCRNLKLLGI-EYDGGFAQYTVALADKVFKVPDSITMRDAALAELYSLGVHSVRKAMIEPGDRVVILGAGRLGLAVLEVLKQSAVSWVCAVDVLDSRLEIATKMGADLTINAA-SEDPVETVLSRTDG-LGVDRVIECVGTQGPVQQAVQLARSGGRIVVMGL-GSQFTPVFWKDAVFKELQIVGSRV-TLGDFPRAIQLMDMGRFHPDL---LVSEVFELENLGE-AFHLLEDKPDEILKVMVK........ 345
215 0.000e+00UniRef50_A0A2N3R8V1 Xylitol (Sorbitol) dehydrogenase n=2 Tax=Bifidobacterium TaxID=1678 RepID=A0A2N3R8V1_9BIFI  ali  25  1MKAVVLEKQGIIK-VRDVPDPPAPGSGELLIAPHTVGICGSDLHYYLHGRV---------GKYVVQKPMIIGHEASGTVLEVGPGVKGFRVGDKVAMEPGIPDMNSKAS--------------KLGLYNIDPSVRFFATPPVDGCLCEKIVHPAAFTYKLPENMSYAEGALLEPLSVGMWSATKARIKPGDTGAVSGAGTIGLMTAASAMAGGCARVLVSDSSRVKLNLAAQIG---VIPVDINQDLLDRVMAETDG-WGADRVFEASGNLNAYQELWKLGAPGNTTVIVGIPAEGIVPMDITEVQARETRIENVFRY-ANVYQKSIDLVSAGKI---NLTPFISRTYRMDQA-QEAFDRAAQGHQEDVKIQIE........ 343
216 0.000e+00UniRef50_E3RX76 Uncharacterized protein n=19 Tax=leotiomyceta TaxID=716546 RepID=E3RX76_PYRTT  ali  25  6...VVLYGPHNAKI-EDAPMPELVDAHDVIIRINYVGVCGSDVHFWHHGGIGKMVNPST--------GIVMGHEASGTIHSIGSSVKTVKPGDRVAIEPGVPC--------------RVCKACKSGTYNLCRHIRFAAAPGTPGTLSKYFRSAEDFVYKIPETMGLDEAVLVEPIAVAVHAVKLGDIRPGETVVVMGSGTIGLFCAAVARQFGAHRIIIVDILEKKLEFAANYLKCETYDISAEQNAKKLLKRFTAGGL-VDTVIEASGATASIETGIHMIRPGGKYVQTGL-GKPKIEFPIVAMGQKELMMRGCFRYGAGDYQLAVKLLEKGLI---DVRSLITTVTPFEQATD-AWE--KTSRGEGIKNLIH........ 360
217 0.000e+00UniRef50_G0R846 Predicted protein n=3 Tax=Trichoderma TaxID=5543 RepID=G0R846_HYPJQ  ali  23  29......TADHNLKLVE-APVYK-PERGQVLLQIKATGICGSDVHFWKSGRIGSLVFEGDC---------ILGHEAAGVVLKCGEGVTNLKPGDRVAIEPGVPCGE--------------CFLCVDGRYNLCKNVMFSGVYPHPGTIQRYKTHPAKWLHKLPDNLSFAEGALLEPLSVVLHGIRTAGLNLGYGAVICGAGPIGLIALAAARASGSHPIVITDIEPKRLQFAREFVPSQVDPSLSAEENGRRIRQLFDGRE--DVVLECTGVESSVCTAAFAVRRGGTICVIGVGKSIMNNLPFMHISLAEIELKFINRY-RDTWPAGIACLSGGIL---NLKPLVTHVFPLEKALE-ALHLAADARNGSIKIQI......... 385
218 0.000e+00UniRef50_A0A081C0E6 L-threonine 3-dehydrogenase n=1 Tax=Candidatus Vecturithrix granuli TaxID=1499967 RepID=A0A081C0E6_9BACT  ali  27  1MKAAVLYKPGDIKIQEDIPKPDKK---DVLIKVKACGVCGTDNALYHGEYPG-------------NYPVVVGHEFSGDVVEIGAEVTKFTPGDRVTADPNKVC--------------HTCDYCRAGYEHLCEHLSSMGVH-IHGADAEYCVMPESNVYRISDALAYEEAAFCEPLACAIHGTDLAHIKVGDTVLVIGAGGMGNLITQCAVHSGAARVIVSEPIALRRERAIENGATHVIDPLH-QDLERELKNIK--RIGADIVFEVAGNLNAQKQCISLVRKGGTIVFFGCSPQNLVEVNPFIINEHELKICGSFNNQFAT-ARAVEMLGSRKIRVDN---LISHRIVLNDYLE-VFKLF--GGRETLKLMVIMNE..... 338
219 0.000e+00UniRef50_I5CCP3 Dehydrogenase n=9 Tax=Burkholderiaceae TaxID=119060 RepID=I5CCP3_9BURK  ali  32  1MKAAVYYGNRQITI-DDVPEPS-PSKGEVKIKVSRNGICGTDIHEYYDGPVLIPKT-EPHPLTGRTLPVVIGHEFSGTVVEVGPDVNGIEEGDNVAIEPVIRCG--------------MCRPCRSGFYNVCRCVGFQGLS-SDGGMAEYAVVPSHMVHKLPGNVPVEMGALVEPMAVAYHAATLGEVTNQSRTLIFGAGPIGIGLWFALRGMGVTEIDVVEPSAIRRKAIEGLGA-RTIDP-TSIDVPAFIADRTNG-EGVDAAYDAAGVPAAISSALKSLGEHRTLVSVAIYDKPMLT-PLLETVMRERRIQGTLCYTGKDYKSVIDLMERGHYRTTGWVE----TVPLENVLSEGFEELRAGRK--MKVLVDP....... 347
220 0.000e+00UniRef50_A0A0K8L103 Probable D-xylulose reductase A n=59 Tax=leotiomyceta TaxID=716546 RepID=A0A0K8L103_9EURO  ali  25  16.....LYGPFDARF-EDRPIPKIEDPSDVVIRIAYTGVCGSDVHFWLHGGVKRLVSPEQ--------PIVMGHEASGIVHAVGPSVSTLQPGDHVAIEPGYPC--------------HRCSCCKSGRYNLCPRMKFAAAPPCHGTLTKYFRLPADYCYKIPPGLGLDEAVLMEPLAVAVHSVRQVGVRPGHRVVVFGAGTVGLLCAAVAREFGARTIITVDVNQVKLQFARSFLATFVPDSSRSEENAAALLEESDEVTGLDIVIEATGAEPCIQMGIEVLRVGGAFIQTGL-GKRNVSFPICTVAEREIVVKGCFRYGPGDFRMGLQFAVEGRIP---VRQFITRVFPFERATE-AWET--TRRGEGIKTLIE........ 371
221 0.000e+00UniRef50_A0A1I3M8L2 L-iditol 2-dehydrogenase n=6 Tax=Firmicutes TaxID=1239 RepID=A0A1I3M8L2_9FIRM  ali  29  1MRAGFIEKPE-VAYFKEVEEPQIQNPTDVKIQVKVTGICGSEVHAYHGKHPFRI------------PPVVSGHEFSGVIVEVGSQVTKYRVGDRVTAEPHYGCGH--------------CIECSEGHYNVCAAKKVLGSNGWSGSFGEFIVVPEQTVVKLDGGVTFEQGALIEPLAVGMHAVRQNDVSLGQNILIIGAGTIGLGVSLCAKIANPAKIIMADVVDNNLEIARKLGCTDTINSAK-EDLEARVMEIT-GGVGADITFLAFGNAPVVEAAAKCTRRCGVISEIAIMPNG-VGAPFGLIQNKELMVRGSNMYTRKDYEVVVDALNKGLIQTDL---MISRIYPIEQMTE-AMEMADKRTEPVVKVMMKF....... 341
222 0.000e+00UniRef50_Q3ACJ3 Sorbitol dehydrogenase n=1 Tax=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) TaxID=246194 RepID=Q3ACJ3_  ali  31  1MKAAVLMEPKKI-IFKEVPVPELEK-GKVLIKVEAVGICGSDMHLYLDGHI---------GATVLDKPLVLGHEIVGTVIEVGEGVNRELLGQRVIVDPGENCGQ--------------CEHCRTGAYNLCSFSKFKGIPPVDGGMAEYITALATHVIPLPENLDSPTATLLEPFSVGLQAVDVADFRAGAKIAVLGGGPVGVLTAIAAKIRGCGDLWLTELYERRIEIARKLGIEKVINVAQ-EDPLKTIMEVTK-KSGVDVVFETTGNPKAVEQALQIVKRGGTVVFLGI-GAGKVPINIDQVTRTGLKLLGSFRYQYH-FAGAVALVKK---HNLDFSPLVTNIYDFVD-IPKALEEVSTYKDRIMKVIVFPQK..... 345
223 0.000e+00UniRef50_A0A1F7TKH6 Uncharacterized protein n=1 Tax=Candidatus Tectomicrobia bacterium RIFCSPLOWO2_12_FULL_69_37 TaxID=1802343 RepID=A0A1F7TKH6_9BACT  ali  23  11MRAAVTRGAGDVRI-EEVPVPPYE-PGLVLVKVAACGVCGTDIHI-LGGHMA--------PTWPPHYPFIQGHEWCGTVAAVGSACTALKPGDRVIMEPTIGCGL--------------CQNCRQGSYHLCLEYKLLG-HTADGAFSEYGVAPPTHLHKMPDRMTWEEAVITNQVVIALHALDRGRVEPADRVAILGPGLLGLSVLQLARAFGASRTYVTGR-GYRLAIAQELGADVVIDVTK-EDPVKVIMEDT-GGRGADLVVECAGPPEAMKQALALARRGGRVVLEGINGGKEVPFPTDRIVLDEIALIGGRG-SPNCYPRAIQLIMDGHIHT---AKMLTHRFPLAD-FREAIRMFKAREDGVMRVMIEP....... 359
224 0.000e+00UniRef50_A0A1V5D0S9 Sorbitol dehydrogenase n=2 Tax=Bacteria TaxID=2 RepID=A0A1V5D0S9_9DELT  ali  28  1MLAVVKSRPEVGIEIMEMPEPEIRK-GHVMIEVKACGICGSDLHFYDWAPLARW----------ITLPRILGHEVAGTICEVGEEVEGFAPGDRIVADTWGGCG--------------SCYFCRLGRFNHCMHQTRLG-QHVDGGMAKYVIVPSNSLFKVPEGVDLLEASVIEPLGVVLRAFERCDMKPGDDIVIMGPGPIGLLGVMLAKHSGAATVIASGLKDERLGYATKFGA-VTVTVGE-ENLKDKVLELTNGK-GADIVMDVSGGQASLADAASIVKRGGQIGVIGLSPEGM--FNPYVIVDKELTIHGSFRRQPSTWFRAIKLVASKVI---DTRPIITHVLPLQRA-EEGFRTLLRKEG--LKVVLVP....... 340
225 0.000e+00UniRef50_A0A1X0UE11 NAD(P)-dependent alcohol dehydrogenase n=2 Tax=Rhodococcus TaxID=1661425 RepID=A0A1X0UE11_9NOCA  ali  29  1MQVSVLSGPQEIRL-ETRPVPS-PAADEVLVQVTAVGVCGSDAHYYREGRI---------GDHVVNGPLVLGHEAAGVIVAVGCTVADTRIGQRVSIEPQRPDPTSAQS--------------RAGRYNLCPSMEFFATPPIDGALAEYVLIQSAFAHSVPDEISDEAAALFEPLSVGIASAQKAGITAGSSVLIAGAGPVGLVTAQVARAFGATAIIISDIAPDRRENAKKFGATQVIDPMTED-----IRALD-----VDAFIDASGAPRAVVDGIHAVRPGGTVVLVGM-GSSDYALPISLIQNRELVLTGVFRY-ANTWPIARELVLSGRV---DLDAMVTGRFDLA-HVEDALN--ADTLPGSIKAVVIPSSHKE.. 337
226 0.000e+00UniRef50_A0A2A2KFC2 Uncharacterized protein n=5 Tax=cellular organisms TaxID=131567 RepID=A0A2A2KFC2_9BILA  ali  32  7...CILYGKNDIRL-EQRPIPKA-GPNQLLIRVKTVGICGSDVHYCLHGAI---------GNFIVKEPMVLGHESAGIVEAVGENVRGFSVGDRVAMEPGIPC--------------RGCQHCKTGNYNLCPDMRFFATPPVDGSLARYVTHDADFCFKLPENVSLEEGALCEPLSVAIHACRRAHLQIGQNVLVTGAGPIGLLCLLTAKAMGVSSVVVTDLDDGRLALAKKAGADHIVNVKSQDDLRREVTSAF-GGLMPDAAMECTGAQPCVETAITVI..................................................................................................... 260
227 0.000e+00UniRef50_A0A0S7ZPA7 Uncharacterized protein n=1 Tax=Spirochaetes bacterium DG_61 TaxID=1704237 RepID=A0A0S7ZPA7_9SPIR  ali  29  1MKAAVWKDAGKIEI-EEIPEPS-PGKGEVLVRVRAAGICGTDLAIYQGK----------FPKERAVPPRVLGHEFSGEIADVGAGVKEFRGGERVVVDPLISCG--------------SCFACSSGFPHVCATLKIIGID-VDGAFAEYVVSPADRVHLLPARIPFETGAAVEPLAVAVHAVRRSGLAVGDSALVVGGGPIGILVALVTRALGAQKVLVTELQEYRLDMVKEMELSS-INPLK-EDLKRSISARF-GLTGPDIVFEASGTAAGFQQAIDFVRIRGSIVEVSL-PKVKTDLDMRRVNFGELTLLGSRVYSPIDIESAISFLADGKLRLESLLK----TYPPEES-QVLFGALVSGEGKLMKVILNF....... 339
228 0.000e+00UniRef50_A0A177FJJ8 Uncharacterized protein n=1 Tax=Fonsecaea monophora TaxID=254056 RepID=A0A177FJJ8_9EURO  ali  39  1MKAARYHGRRDLR-VEDVDVPQIV-DGQVLIQIEWCGICGSDLHEYLVGPGIIPQKDAPHPLTGAVMPVTMGHEFCGRVTKVGPK-SKFQIGQPVMVDPRVFC--------------SNCHSCNIGDTNICNSWGFLGLSPDGGGFSEYVAVKEEMCHALPDSIPLSEAALIEPLTVARHATKKSGFDRDKTILVLGGGPVGLALIFVLRASGFGKLIVSEPTSQRQEQAAKL-VDVVLNPREI-SVPEKCRIM-----------------PGLKDGMDALRRGGTYVNVAGW-ERECVVPMEHFMLKEIIFRASMSYTEEDFKQTVDEFVAGKF--EGFEKLVTARIALDDIVKKGFEELVNHKDDHVKILVTPMKE.... 342
229 0.000e+00UniRef50_A0A2I7KG50 Threonine dehydrogenase n=93 Tax=Proteobacteria TaxID=1224 RepID=A0A2I7KG50_9RHOB  ali  32  1MRALRFHAAKDLR-VEDIALPTDPAEDEVVIENRFVGICGTDLHEYAYGPIFVPQDEDGKTA----APQVLGHEYGGTVTKVGKGVTHVKVGDRVSVQPFITPRSGDYYVD-------------RGEFNLSDAMQLAGLSWIGGGMAQESLLKGYNVYKVPENMTDEDAALVEPTAVAVYGVDRGGVNAGDSVLVTGAGPIGLLTLLAARAAGAVQMFVSDPNATRLKIAKEIIPDVTINPTE-ENVGDVIRAATEGGVGCDVALECVGNTFALQACVDAVRKRGVVVQIGLHPG-EAPVNWFDVVYKDIDLRGSWAYTAQMWPRVMRLIASGQIPA---RKVVTKTVTLDTVIKDGFDALLDPAGTQLKILIDLNG..... 355
230 0.000e+00UniRef50_A0A1H4D4Q9 L-iditol 2-dehydrogenase n=3 Tax=Chitinophaga TaxID=79328 RepID=A0A1H4D4Q9_9BACT  ali  25  5MKAAVKTADGEFEMCE-VDIPQLSQPDWVLARVKVAGICGTDLRHWKKKEPSLEGK-------------IMGHELAGEVVKVGEAVKNVKPGDRVVIETLLGDG--------------TCDWCRIQQYNLCPNLYEVRMKTISQAFAGYVAGPSNKFYKLPDHVSYEEATLLDTFSVCMHAIQLSGLKLNDKVVVIGAGPIGLGQLQLAKICGA-DVLVTDVVDHSLQVAKELGADEVVNAKTNEDVLKAVKEFTNGR-GADVVFECAGMPATLPQATSFARIGGKVLIVGGFDEDTIDLKWQEIQKAEIKLIPSASYSWGIYPEMLDLLAKGKL---NAKKLITHRYKLDD-INQAFD....................... 337
231 0.000e+00UniRef50_A0A1B9VC00 L-iditol 2-dehydrogenase n=10 Tax=Alphaproteobacteria TaxID=28211 RepID=A0A1B9VC00_9PROT  ali  26  1MYSVVIHSPHDLR-VDQIDQPGAPEPGTITVQIDKGGICGSDLHYYHNGGF---------GTVKIREPMVLGHEVAGTIIAVGQNVTGLAVNDKVAVNPSMPCNQ--------------CQYCRANMRNQCTDMRFFGFPHQQGLFRQQINLPAEQLVKLSPDINMEHAACSEPLAVCLHAVRQAGALSGKKVLVSGCGPIGCLTILAAAHSGAHWITATDLSKAALDIAAKAGANSCIDVARNAD---AFKTLGMNKGTQDVVFECSGSPQALANAFDAVKPGGTIITVGLGGNGE--LPLSLAVTKEVRMIGSFRFDAE-FAQAAELIDRKVI---DVSPIISSVLPFRDA-KTAFD-LASDRSQSMKVQLDFG...... 345
232 0.000e+00UniRef50_A0A0M2U480 Uncharacterized protein n=2 Tax=Terrabacteria group TaxID=1783272 RepID=A0A0M2U480_9FIRM  ali  27  5MRAAVTVAWNEVRVME-VPVPAL-RPGEVLCRVRACGICGTDLKIMAG-------VFADSKKWPRELPFIQGHEWSGEVVALGPGVTDIKIGDRVVGESHMFCG--------------TCRMCQEGNYHMCDRAGLYG-HDAPGAFAEYVARPLSLLYRVPESLSWEEAAIGNQAAVALHLADRGDIKAGYKVVVLGPGHLGLLSLQIAKAMGATTVIVTGRDDQRLALARELGADYTVDIRE-DAPERRILELTGG--GADVVLECAGTPEAVCTALEVARKGGKVVLGGLTGGKQVAIDPDKLVLKELDVRGSHARV-NSQTRALEMIAKGLI---NARKLVSFTFPLEE-INKAYNTFKDRNNRAIRVIVQP....... 359
233 0.000e+00UniRef50_A0A2E8B2S4 Alcohol dehydrogenase n=1 Tax=Planctomycetaceae bacterium TaxID=2026779 RepID=A0A2E8B2S4_9PLAN  ali  27  1MKALIKTAPGVGNLVLEVAEP-IPQPDQLKIEVKAAAICGTDLHIHDD-------------EYVNSPPMILGHEMSGVVVEVGDRVTRFKEGDRVTSESFKYCGE--------------CRFCQTGLIGLCIHRTSMGVH-VDGAFAQYVCQREESLHQLPENVDFEAGCMSEPTAVAVRAVERAGVSTGDIVLVSGPGPVGLLCLQAAKMLGATVILVADGDENRLALGKQLGADLVLNAQ--ADSLERVLDMT-GDLGVDVAIECAGAKASLEQCIRFSRKAAQLVLVGLYG-NEVEICLDQAIIKELTILPSFTYRHPTWRRAIQLLGEGDIKT---APLVSGRFPLTE-WKQAFEAVRARQGN--KYLLLP....... 340
234 0.000e+00UniRef50_A0A0D2FCG1 Unplaced genomic scaffold supercont1.2, whole genome shotgun sequence n=21 Tax=leotiomyceta TaxID=716546 RepID=A0A0D2FCG1_9EURO :  ali  38  1MKAARYHGQRDLRLENDVPVPEIEK-GQVLVEIEWCGICGSDLHEYLVGPRTIPVTQKPHPLTAASLPVTMGHEFCGRVSQIGAGASRLKVGQPVMVDPRLYCG--------------SCDCCKSSRTNVCSRWFLGLHGGGGGGFSEFVAVNEDMCYVLPDSVALSQAALIEPLTVARHAMKSSGFKAFENVLVLGGGPIGLAVILNLRACNTAQIFVSEPTEKRANQTREF-ADKVFNP-RLVDVAEECLASTAGK-GVDLVVDCAGLMPALKDGMKALTRGGTYLNVAGWETDLI-MPLGDFALKECVFRTSMSYTDEDFRETVDAFVSGK--YQGFEKLISGRILLDDLVTKGFEELIRHKDDHVKILVTPKHE.... 361
235 0.000e+00UniRef50_K5XTE3 Uncharacterized protein n=9 Tax=Agaricomycetes TaxID=155619 RepID=K5XTE3_AGABU  ali  36  1MKAGRYYGPGDIR-VENIPEPVLTS-DQVKIL----TVCGSDLHAYLTESPGYGSV-EPHPITQETFPVTLGHEFSGTIVETGPGVTKWATGTNVIM-------------------KGSCDTCSQGYRNLCPHIGFIGITGWGGGLSEYIAVNVRYLHTLPQGISLEIGACVEPLAVAYHAVKRSGFTEDKTALVVGAGPIGLFVVKVLRLYPTSTILVSEPATIRREFALKHGATQVFDP-TNIIIPEAIRSIVA--PGVDVAFDAAGIQASMDASLFSLRARGTYVNLAIW-EKTATLNVNLILVREINFTGIVGYDR-VHEEVLSLIASGKIKGLD--ELITKRISLDDVVEEGFKKLLSEKDKHVKILVHPGSR.... 366
236 0.000e+00UniRef50_A0A2V2E5I1 Sorbitol dehydrogenase n=1 Tax=Clostridiales bacterium TaxID=1898207 RepID=A0A2V2E5I1_9FIRM  ali  29  1MKAIVKDGEGNVELI-NKPEPSVKK-NEVKIKVEAVGICGTDVKI-------------KHGTTWSNPPVVLGHELSGVVSEVGEDVKSVKVGDRVVTETGVVCGH--------------CYYCRTGNFLMCKDRLSIGY-GVDGGMAQYCVVREDIIHILPDEIDFDAGSLCEPAAVSVHAVDAVSLIPTDTVVVIGAGAIGLLVAQLAKNFGAT-VIVTGLSEERLVIAKDLGVDYVVNTQK-DSVEELVNNLTDGR-GADVVYECSGSAPGVHTGMSLLKKMGALVQIGLT-KPTMEIEYSMLTAKQIKLVGTFGHKWQSWDTALKLMNQGKI---NADALISHRFAIDD-WEEAFGVAE--RGEGLKVVIFPNK..... 343
237 0.000e+00UniRef50_A0A2P8A4L7 Uncharacterized protein n=1 Tax=Elsinoe australis TaxID=40998 RepID=A0A2P8A4L7_9PEZI  ali  33  5MLAARFHAPHDIRI-DHIPLPS-PTPSQVLLQISWAGICGSDLHEYLIGPQTIPAPDRPHPITKSTLPCPMGHEFCGVVAPLSPAQPQLVEGAKVIVDPRLYC------------AREDCENCAKGATNACPKWGFHGLSGCCGGFSKCVAVEARMCYVLPAETDLSFAALIEPLAVAWHAVKVAGVGEGKKVLIVGGGPIGIALVYVLRVFGCQMVVVSEPTALRRSQDEKV-ADIVLDPTK-VKVAEECKRLTNG-SGVDVVFDAAGVERGLKDGVDALKYGGTYVNIAGW-ETPFTIPWFPFMLKDMRVQGSMAYNDEDFAETVQAYIEGKFK--GVESMVTSRISLKDTKEKGFEELINNKDYHIKIMISPHDNA... 372
238 0.000e+00UniRef50_U5HF86 Uncharacterized protein n=3 Tax=Microbotryum TaxID=34416 RepID=U5HF86_USTV1  ali  37  8.KVVNYYGKRDIR-VEENPMP-VPGEGQVLIKLAWCGICGTDLHEYTDGPILCPTAGTAHGITGEKLPFCLGHEFSGVISKVGPGVKGWRKGDRAIVEPTISC--------------FKCYACKHNFRNACSSLGFVGLSG-------YAVAGEGFLHKLPDNVSLQHGAMVEPLAVAMHAVQMSGATKGCTALVCGAGPIGCFVTKVLIAMGASKVIVSEPSGSRRKMATHAGAHHAISPRE-DDVVSKCRELTGGDDGVDVSFECAGVEASLTAAIAALRPRGTCLDVAIWSTKP-QIDMNALVLGEKTLRAVICYESK-HKPAIETLSSGKISLDG........................................... 321
239 0.000e+00UniRef50_A0A0F9DZ19 Uncharacterized protein (Fragment) n=1 Tax=marine sediment metagenome TaxID=412755 RepID=A0A0F9DZ19_9ZZZZ  ali  30  27MKAGILHKAGNIR-CESIPVPEI-NSGEVLVAIKAVGICGSDILRFSRGVSPYNFS-------------VLGHECAGEVIEVGRNVTSVKVKDRVAIMPVMSCG--------------KCDFCRSGEYSLCDNFIRMGT-RIDGCFAEYIKVSPENLLKLPDNVDYESASILEPSAIALHSIKRAGILPGDVVAVLGCGPIGLLIAQWVKILGARRVFAIDIAEEKLEIARKIGMTDCINA-KNEDSVELVMRETKSR-GVDLVFDSAGSKITFEQSMRMARKLGKVVIVGLV-EEDVTLPVLAILRHELTIYGVYDTDTNSWQTSLYFIEAHRL---DVKSLITHRFKIED-IATVFKKIAREREKFNKVIFVF....... 372
240 0.000e+00UniRef50_Q6TUH3 LRRGT00071 n=1 Tax=Rattus norvegicus TaxID=10116 RepID=Q6TUH3_RAT  ali  26  24...................................VGICGSDVHYWEHGRI---------GDFVVKKPMVLGYEATGTVTKVGPMVKHLKPGDRVAIEPGVPREIN--------------EFCKIGRYNLTPSIFFCATPPDGGNLCRFYKHSADFCYKLPDGVTFEEGALIEPLSVGIYACHRRSVSLGNKVLVCGAGPVGIVTLLVAKAMGASQVVVTDLSASWLTKAKEVGADFTIQVAKPQEIASKVESLL--GSKPEVTIDCSGAEPSIQSGIYATHSGRTSVIVGM-GPEMISLPLVHAAVREVDIKGVFRYC-NTWLMAVSMLAS---KTLNVKHLVTHRFPLEKAVE-AFETA--KKGLGLKV........... 328
241 0.000e+00UniRef50_A0A0K9YXV6 L-iditol 2-dehydrogenase n=9 Tax=Firmicutes TaxID=1239 RepID=A0A0K9YXV6_9BACL  ali  25  1MKAVKLYEPGNLQ-VEEIDVPEI-GAREVLVEVKAVGVCGSDI-------------PRALYKGAYYKGLTLGHEFAGQIAKCGPEVTGWQVGDRVSVAPLIPCNE--------------CKYCKQGDYSLCEDYNYYG-SRTDGAMAHYIKVTQENLIRLGDSVSYESGAMIDPAANAIHGLWRGNCKAGDTVAVFGLGAIGLFAIQFAKVLGAKQVIAVDIHDEKLELAKELGADIVINSLKG-DPASEIAAQTG---GADFILDTSGSPIAQNQAVSAAAKQGRIVFLGI-SNSELTLSMNNVLRYELALFGSWNSFSNPFPGTAELMAEGKLKA---EPLISHRYQLDQA-PEVFQKIKNKELVFNKIMFLPN...... 345
242 0.000e+00UniRef50_A0A161GKS9 Sorbitol dehydrogenase n=474 Tax=Bacteria TaxID=2 RepID=A0A161GKS9_RHOFA  ali  29  1MQASVLTGVHEIRM-EDRPVPT-PAHDEVLVQVTAVGVCGSDAHYYREGRI---------GEYVVDGPLVLGHEAAGVIVAVGSDVSDARVGQRVSIEPQRPDPTSAQS--------------RAGRYNLCPAMEFFATPPIDGALAEYVLIQSVFAHDVPDSISDEAAALFEPLSVGIASAQKAGITAGSSVLIAGAGPVGIVTAQVARAFGATEVIVSDIDAPRRDNAAKLGATRVLDPA-----VEDVRAL-----EVDAFIDASGAARAVVDGIHAVRPAGTVVLVGM-GGSDYPLPISLIQNRELVLTGVFRY-ANTWPIARELVLAGRV---DLDAMVTARFGLDR-VEDALN--ADKQPGSIKAVVIPG...... 333
243 0.000e+00UniRef50_A0A1X7UGK7 Uncharacterized protein n=2 Tax=Amphimedon queenslandica TaxID=400682 RepID=A0A1X7UGK7_AMPQE  ali  27  219............................................................................................DRVAIEPGVPC--------------RTCSYCKGGRYNLCPDMQFCATPPVNGSLANYYVHAADFCYKLPDHVSFDEGALLEPLSVGVHACQRAGIGLGSKVLVCGAGPIGLVCLLTAKACGASDIVITDLDAGRLDFAKKLGATSTIQVKTRDTLAKQVEEAL--GCKPDQTIECSGAQSSISAAIYATRSGGTLVLVGL-GAPEVQIPIVDASVREVDIRGIFRYC-NCYPTALEMVASGKV---DVKPLITHSYTLEQTLD-AFQRAKTGEGGAIKVMIRCGTE.... 484
244 0.000e+00UniRef50_W8IAE3 L-threonine 3-dehydrogenase n=14 Tax=Proteobacteria TaxID=1224 RepID=W8IAE3_ENSAD  ali  26  1MKAAVLHAPGDLR-VEDVPVPEI-GPDEVLVEVKAAGICGSDI-------------GRVMTTGTYRFPTIPGHEFSGRVERVGSDVSHLKPGDRVAVAPLMPC--------------RTCQWCEAGKFHLCDDYDFMG-SRSDGAFAQYLCAPATNVLKVPDSVSYEVAATIEPAAIILHGIHKLDLKLGDAVAVVGCGALGYFALQFARLSGARPLIAVDVDDDKLELARSIGADLCLNPTR-DDVLARVREAT-GGRGVAVSLECAGSAPGRDLSIMVAAKQGAVMLYG-TAYGDVTFAFAKIVREELQVIGSWNFPGKEWFDIIGLLGDGRLT---VEPLITHRATLEEA-PSIFKALKDRSGRYHKILFKPND..... 349
245 0.000e+00UniRef50_Q6KAV2 ARAD1D37840p n=21 Tax=Fungi TaxID=4751 RepID=Q6KAV2_BLAAD  ali  27  23....VLKKPLELGF-EERPVPVITDPRDVKIQVKKTGICGSDVHFWQHGRI---------GDYVVEKPMVLGHESSGVVVEVGSEVTSLKVGDRVAMEPGVPDRRSKEY--------------KMGRYHLCPHVRFAACPPTDGTLCKYYTLPEDFCVKLPENVDFEEGALVEPLSVAVHTARLLGIYPGSKVVVFGAGPIGQLCIGVCKAFGASIIGAVDLFEQKLETAKEFGASHTYVPQKGDETAHKILELLPNKQAPDVVIDASGAEQSINAGIELLERGGTFGQVAMGRTDYIQFAVSRMAMKEIRFQGVFRYTYGDYELATQLIGDGKIP---VKKLVTHRRPFEKA-EEAYELVKS--GVAVKCIID........ 365
246 0.000e+00UniRef50_H2Y2K6 Uncharacterized protein n=9 Tax=Bilateria TaxID=33213 RepID=H2Y2K6_CIOIN  ali  26  7..AAIVKGDKTIELAK-WKLPELKN-NDVLLSISAVGICGSDLKYWAYGKCGRFNLEGK--------PMVIGHEAAGVVVQVGSSVKSLQVGDRVAIEPGVSC--------------KTCSHCKSGRYNLCPEMRFCATPPVHGNLCQYFVHDADFCFKLPPNVSDEEGAMIEPLSVAVHTCRRACVTSGHHVLIFGCGPIGILCGLVAKHYGATQVTIVDIDQDRLEVAKKLGAADVVHTTTDNDPVAHTLREVANDDGSHAALECSGADISLKTAVHASRPGGCVLLVG-RGSMDVPMPMVAAGTYEIDIRGIFRY-ANRYPEAIELVSSGAV---DVASLVTHRFTLQKAGD-AFTTAVSPKEKAMKVMIK........ 352
247 0.000e+00UniRef50_A0A2S4V6D4 Uncharacterized protein (Fragment) n=2 Tax=Puccinia striiformis TaxID=27350 RepID=A0A2S4V6D4_9BASI  ali  24  452....ILKEPAKILMV-NKSMPKL-HPGQVLLHVRATGICGSDVHFWKHAGVGKMVVKHECGA---------GHESAGEVIGVGEGVLDVHVGDRVAIEAGVPC------------SKPTCEMCRTGRYNACPDVVFFSTPPYHGLLTRFHAHPACWVHKLPANVSYEEGSLLEPLAVALASVEHAGVKLGDPVLICGAGPIGLVTLLACVAAGACPIVITDISESRLDFAKR-----IVPSVSTFRIVEGVSEQTMMGEKPQVALECTGRQSSVRTAIFSVKFGGKVFMIG-CGQNEQMFPHTYMFENQIDVQFQFRY-ANQYPKAIKLVSRGLI---NVKPLVTHRFPLEEAVE-AFHTSANPESGSIKVQI......... 793
248 0.000e+00UniRef50_A0A2M9N4V0 Sorbitol dehydrogenase n=43 Tax=Terrabacteria group TaxID=1783272 RepID=A0A2M9N4V0_9BACL  ali  29  1MKAVYVEDAYKV-VVKDVDIPEI-GAGEVLIQVKAAGICGSDIHTYKGLHLF------------RKPPVIIGHEVSGEIVKVGKDVTSFRIGDRVTVEPQVGCG--------------KCNYCLTGRTNYCAERGAPGLKGWYGSMAEYFAAPEACVFKLPDQLDHELGVLVEPFAVGVHAVRKARIEVGDKVAILGAGPIGLLAMTAAKAAGATTLMVTDVMEYALESAKEMGATHTLNIRGKERWTEEAKSEIDGE--FDKVLIAAGVPGIVDDALALLRKGGRCVTIAMF-HGTQTFDIVNLQQTEKEIVGCMTYTREDTISAIDLLASGAV---DVKAVISHRLSYEDAAE-GFRLVDKKEDSSLKVIVTF....... 340
249 0.000e+00UniRef50_A0A0T6A5F8 Zinc-binding alcohol dehydrogenase n=1 Tax=Candidatus Rokubacteria bacterium CSP1-6 TaxID=1640509 RepID=A0A0T6A5F8_9BACT  ali  29  1MRAAVFHGPRDIRLSE-VPDPT-PKTGEVLVRVQRAGICGSDVKRFLYGSYPWP------------PGFIMGHEFCGEIAKLGPEVGGWRVGEQVVVEPTLYCG--------------ACFYCRQGHHNRCVDFMRRGISGTDGAFAEYVRLPAYQLHRRPPELSTSLAALVEPTAVSVHGWHLAGLERPDSVVVVGTGNIGLLAILVARAKGARQIIAVGKYPPRQDLARAYGAQLVLEPDDAR-LQDLILERTEG-LGAALVLEAAGTPSSLRTAVAAARKGGKIVVLGVF-QEEVALDYRTILLHEKQIIGSVIYQRQDFADALRLLARGEV---DTRRHITGEIPLEAIIPRGFVPLSEKRAEHIKIQV......... 341
250 0.000e+00UniRef50_A0A212KEM1 Chlorophyll synthesis pathway, bchC n=1 Tax=uncultured Clostridiales bacterium TaxID=172733 RepID=A0A212KEM1_9FIRM  ali  26  5MLQQIMTAPAEIRF-DTVPIPR-PQPGQALIKIKRIGVCGSDIHVYHGKHPYT------------KYPVTQGHEVSGQVAELGEGVTGLRVGQKVTIEPQVYCGH--------------CHPCTHGKYNLCESLKVMGFQT-PGTASEYFAVDAGKVTLLPDAMSYDEGAMIEPLAVTVHAAKRAGDVKGLKVCVLGCGPIGILLVQTLKAFGAAEVLATDISDYRLALAKECGADHVVN-TRGTDFGTALAEAF-GPDKADLIYDCAGNDITMDQAIQNARKGSTIILVAVYAG-LAHCDLAKLNDSELDLNTTMMYRHDDYVDAIRFVGEGKIR---LAPLMSKHFAFTD-YADAYRYIDLNQEATMKVLVDVDPNG... 347
251 0.000e+00UniRef50_A0A1I1A2U9 L-idonate 5-dehydrogenase n=3 Tax=Oxalobacteraceae TaxID=75682 RepID=A0A1I1A2U9_9BURK  ali  27  5...IVIHAPHDLR-VQELETGELQ-PGQLKVKITAGGICGSDLHYYRHGGF---------GTVRIKEPMVLGHEVSGVVAETGSAVDDITPGTRISVSPSLPCG--------------VCKYCQEGKQNHCLDMRFYGTPHVQGAFRQEIVIERSQAHVVTDNVSDGEAAMAEPLAVALHAVRRAGSLLGKRVLVTGCGPIGALTVIAARRAGALQIVVTDVAKMPLEAALKVGADQAIDVGQQPDALAA---FTKDKGSFDVLFEVSGNEQALRGALDALRPGAVIVQVGLGG--DINFPANLLVGKELEWRGAFRF-HEEFALAVELMNQGLV---DVKPLISATYPFEQSVE-AFEIAGD-RSKMMKVQLSF....... 344
252 0.000e+00UniRef50_A0A1B8FW08 Uncharacterized protein n=1 Tax=Pseudogymnoascus sp. 03VT05 TaxID=1622148 RepID=A0A1B8FW08_9PEZI  ali  26  8.KVLMLHGCKDLRL-ETRSI-QSPLPNEVQVAVHSTGICGSDLHYYSDFR---------NGAFAVLAPLCLGHESAGTVTIIGSSVTTLSVGDRVALEVGMACG--------------TCELCRGGRYNICEEMLFKSSPHADGTLAELINHPADLCHRIPENVTFDQAALIEPLSVSIHGVNRSQAPAGGKTLVFGAGAIGLLTAAVLRAHDMSEVVVADIDSARLTIAKDLGATKTFLIKDAQNLAAKIAEIA-GVRGFDRVYECTGVPSCVQTGIYASKPGGKLVLIGM-GSAVHTLPLGAAALREVDIIGVFRY-ANTYPTAITLISSGKLPR--IHELVTHKRSLDKA-EEAFILAKNGRDEEGNVVLK........ 367
253 0.000e+00UniRef50_A0A2U1K1N5 Sorbitol dehydrogenase n=1 Tax=Bacillaceae bacterium T8 TaxID=2171751 RepID=A0A2U1K1N5_9BACI  ali  31  47MKAIYMDSPKDMSLKHTDEL--EPGPNEVIVKVNAAGICGTDLKIYQGKYPN------------IKWPIILGHEFSGQVAAVGEGVEGLPVSTNVTARPGISCG--------------RCRMCIEGKTNVCSEKNRLGF-EQNGAFAEYVRVHKDQIHILPKEIDLTTAAMIEPLAVVVHALRSITIKPSDVVLVIGPGPIGLIALLLSKANGAT-VAISGLSQKKLTLARELGADLIIDAEKEND-EKTLLELTNG-DGPDIVLECTGTAGGVNKGLELSRTGGTYVQIGTWSH-PLTVDFMKIAYKEITVKGSYGHTKLDWRDSIRLLQSGRI---DLTPLIQGIY-LMDEWEKAFKDAES--GEKAKILIKP....... 387
254 0.000e+00UniRef50_A0A1H2ZPZ5 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase n=3 Tax=Firmicutes TaxID=1239 RepID=A0A1H2ZPZ5_9BACL  ali  29  1MKAAVLNEWEQI-LYKEVPEPKLQ-EEEVLIRVKYAGVCGSDVTIYKGKHP------------TARTPVIPGHEFVGVIEEVRSKRNDLQPGDRVVVEPLISCGE--------------CAACSSGNWHVCRTLKLLGIHT-DGGFAQYVKAPAAKVIKLKDSISDRIAALTEPFAVGFHVNQRAGIKAGDKALIIGGGPIGLVIGIAAKRCGAEKVVFTELNDARIEIIKSFGFDA-INPKR-QDVTDLSAELTNG-AGYDVVFEVSGSQGGLSSAIELCAIRGTVVLVGFPHKQP-EIDVLKVIFKEINVVGSRVYTFQDFTRTVRMLESGQF---DLDRIISDTMPMEQA-EEAIRRMIAG-DNLGKILLDCNVSGRER 349
255 0.000e+00UniRef50_U2TFS6 Putative chlorophyll synthesis pathway protein BchC n=1 Tax=Leifsonia aquatica ATCC 14665 TaxID=1358026 RepID=U2TFS6_LEIAQ  ali  27  239MRTSVLTGQRALAI-EDRRVPS-PAKGEVLVKVAAVGVCGSDVHYFRHGRI---------GDFVVDGPLVLGHELSGSIVAVGDEVDPARVGQRVAIEPQKPC--------------HVCDQCLAGRYNLCPHMEFYATPPIDGAFTGYVTIESIFAHAVPDNVSDEAAALLEPLSVAITTMRKAHIVPGSRVLIAGAGPIGIICAQTARAFGAAEVIVSDPVSERRERALAYGATRTIDPA-AEDVANI-------GLDVDAFIDASGAPRAVFSGIQAVRPAGYAVLVGL-GNPEMNLPIEHIQNKEVWVTGIFRYT-DTWPTGIHLVSSGQV---DLDSLVTGRFDLDQ-VEAALESDLDPA--SLKSIVYPNK..... 574
256 0.000e+00UniRef50_A0A1Y0XB09 Alcohol dehydrogenase 3, mitochondrial n=89 Tax=Bacteria TaxID=2 RepID=A0A1Y0XB09_BACAM  ali  33  1MKAAVWYGERDIRI-EERGTKELQ-PNDVKIKVAWAGICGSDLHAYLHPDSVPMNKKT-----------VLGHEFSGEIAEVGSHVTKFKKGDRVCIYPMM----LKDPSNAETERFIT--------------LDAVGAQ-IDGGFAEYVILPQKTIFKIPDHLPLELAAMVEPAAVSFQSIKDSNVREGDTVVVYGAGPIGLFAVLGAKAAGASNIIVIDLFNSRLDKATEMGATHVFNAKE-VNPVEEIRKLF--PDGADVAIEAAGVESTFHQAIQSTKVRGTMMVIS-FHTQDIQFNPASLIFSGAKLMGSVGYSNETYNEVIELFANGRLPAQ---SIITSKIDIDNIAEQGFDALINDKSQA-KILVK........ 335
257 0.000e+00UniRef50_E4YPL8 Uncharacterized protein n=2 Tax=Oikopleura dioica TaxID=34765 RepID=E4YPL8_OIKDI  ali  26 1509..........................DEVLLEMGSVGICGSDVHYWTHGRI---------GDFIVNEPMILGHEASGKVIKAGKNVKNLAIGDRVSIEPG--------------YNLEADDYAKNGRYNL-SDVFFCATPPDDGCLMKYYKHKASWCYKIPENMSYEEAAFIEPLSVGIHACRRANVTLGDTVLITGCGPIGLVSLLVARAMGASKVLLTDMNGDRLKKALECGASDTIQVTREQTP-EQIAALVEEKLGPNITVECTGAESCIQTGIYATKSG-GCLLLVGLGKEMANIPIVNAAVREVDIRGVFRYC-NTWPIAINMISSGQI---NVKPLVTHRFELKDSL-KAFET--TRRGEGVKVMIKC....... 1826
258 0.000e+00UniRef50_A0A0S1XFI1 L-threonine 3-dehydrogenase n=5 Tax=cellular organisms TaxID=131567 RepID=A0A0S1XFI1_9EURY  ali  28  1MKAAVFKGEGKL-VIEDVPIPKKYKPNEVLLRVLAAGICGTDLHI-----------LSVPPGHTATPGAILGHEFVGEVVDIGSEVDNVNVGDLAAVDPNIKCG--------------KCWFCRNGYPNMCPEMTTLGIYG-NGGFAEYAVVPAKQVYVLPRNMDIDKAVLFEPLTTAVHNWEKVNLKPGENILIFGAGPIGAFFIKLAQISGANEIIVSEPSSLRREIARKLGATKVVDPI-NEDVVEIVHSVT--KYGVDVAIDASGVPVVIEQAVRALRPGGRLSLFGIHAFAD-KVSFTLMNQKELHIFGSYA-AAKSFDQTIEIL--KKRETDDLKNIITHRLKLED-IHKGLELM--RKKEALKVVIYP....... 359
259 0.000e+00UniRef50_UPI000379BC94 NAD(P)-dependent alcohol dehydrogenase n=1 Tax=Sediminispirochaeta bajacaliforniensis TaxID=148 RepID=UPI000379BC94  ali  27  6..AAYMTEKGKITIV-DIPVAE-PAEKEVLLRIEYVGICGSDAHFLETGMRKGKSF---------NLPFILGHECSATIVEIGKGVTNLAIGDRVTFEPQITCG--------------KCHYCREGKYNLCPHVIFPSVPPYDGMLRKYTAIPASVIRKLPPSVSFVEGAMIEPLAVGLSAANRGEVTIGSTVIILGTGCIGLTTLLACRASGATKIIVVDICDSRLKMARALGADVAIKNSNAIYTDAKLKELTNG-EGAEIVFETAGNTHTALLAETVLQRGGRIVHVGNI-HDTVPYPFMDLMYKEGEIRTIYRY-RNNFNRAIDAVASGIIDIKKIAPRI---FPFEKT-QEAFDAAIYDAQHTVKAMVAVNTNTD.. 351
260 0.000e+00UniRef50_A0A0J1FHZ1 D-arabitol-phosphate dehydrogenase n=7 Tax=Bacteria TaxID=2 RepID=A0A0J1FHZ1_9FIRM  ali  31  1MKAVVKYANQDGTEIRDMAVPEI-GPDDVLVEVAYIGICGSDPHIHH-----------QDVSYPIAVPLVLGHEFSGIIAKVGSNVRDWVAGERVTAETHRYCG--------------KCAMCRTNRYHLCRERKGFGF-GVDGAFAKYVSVPSRILHKVPDNVSLRDASLTEPLCVAYNAVKYSRINPGDFVVIIGPGPIGLLCTTVAKLQGAGEIIVSDGDEERLAKALELGATKAVQSSK-QNIAELVMSI-GDAYGADLVVDTAGPSATLKLALEIVRPAGQITKIG-WGPEPVNFSLDQLIAKSARLQGCFSHTWDVWEKCLTLMAEGQV---DLSKLITHELPIED-WKRGFEVIE--KSQGIKVVLVP....... 344
261 0.000e+00UniRef50_A0A256ZGD9 L-threonine 3-dehydrogenase n=1 Tax=Desulfurococcales archaeon ex4484_204 TaxID=2012517 RepID=A0A256ZGD9_9CREN  ali  28  17................EIDEPR-PGPGEVIVEVRATAICGTDLHFY--------YWDDYARRHNPGFPKVLGHEFSGVVVEVGEGVKRLDIGDRVAAETHIPCG--------------SCYYCRTGRPHICENVKLYGIDTTYGSFTKYTVLPERVAIRIPEEISFEEAALLEPFGVAMHAVSEAGIKPGDTVAVLGCGPIGLFIQQLAKISGASKVIATEVSKYRLNLARKVGADEVVDALR-EDPVRRVYELTC--RGVDVVFEASGSTKAVKQGLEMVSKSGRVVQVGI-ARRPTKININTIVEKEVRLVGIARLMFSTWYRSIRMVQSRAI---DVLQVVTHRLPLRQA-PKAFETLS--RGEAGKILLIP....... 344
262 0.000e+00UniRef50_A0A1X9MIF5 D-arabitol-phosphate dehydrogenase n=76 Tax=cellular organisms TaxID=131567 RepID=A0A1X9MIF5_9BACI  ali  29  11MKAVVAYSPGDYRL-ETVPVPTIE-AGEMLVKVEACGICAGDLKAYDGAPSFWGDEEQPA---YIKAPMIPGHEFIGHVVALGEGVEGFEVGDRVISEQIVPC--------------WKCRFCKRGQYWMCEKHDLYGFNNVNGAMAEYMKFTKEAIYKVPDELPIEKAILIEPYACSMHAVQRAKIELGDVVVLAGAGTLGLGMIGAIKKSGAEKLIVLDLFDDRLELAKQFGADLVINPAK-EDADKIVKDLTEGY-GCDVYIEATGAQKSVEQGLKMIRKLGTFVEFSVF-KEPVTVDWSIISRKELDVLGS-HLGPYCYEPVIKGIGNGDLPTEGV---VTHQLALED-FKEGFDLVKNGRD-SLKVILKPN...... 361
263 0.000e+00UniRef50_A0A1G3P2I9 Galactitol-1-phosphate 5-dehydrogenase n=1 Tax=Spirochaetes bacterium GWF1_41_5 TaxID=1802188 RepID=A0A1G3P2I9_9SPIR  ali  27  1MKALIHNKVNDF-VYSDTEKPAV-NDNEVLIRIKAVGICGSDVHGMTGK------------TGRRKPPVIMGHEAAGIIEEKGKNAAGFMIGDRVTFDSTIYCGH--------------CSFCRQGKINLCANRRVFGVSRQNGAMAEYLAVPEHILYKIPAEMSFAQAAMIEALSIAFHAVGRSGLKINDTVTVFGCGIIGLLIIQSARLAGCGKIIAVDLDDYKLEFAEKFGADLCLNPLKK-NIPKNIEDFCS---GADIVFEAVGVQVSVNQAVLSCKKGGKIILVGNLS-PEIIMPLQKIVTGELTLLGS-CASSGEYQACINMIAGRRI---NVDKLISKIVPLSEG-KKWFAFLLEGKEPLFKIVLEP....... 341
264 0.000e+00UniRef50_D4X6S9 GroES-like protein n=26 Tax=Burkholderiales TaxID=80840 RepID=D4X6S9_9BURK  ali  27  1MLNCAIHGAQDLRLIEQAPEP--LGATQVRVGVKAVGICGSDLHYYRHGKV---------GDFVIREPLTPGHEVSGQVLEVGEAVTNVKPGDRVALDPARTCG--------------VCRYCRQGDSNHCEAVHFFGYPHMQGAMREQVVVEAKQCLPVPDGLSFELAAFGEPLAVALHAVRSAGSLLGKSVMVVGAGPIGALILMAARLAGASQVTVVDIVDETLATCARVGATRTINAATD---PAAIDALAAGKGMIDVCFEASGNYAGLANCIRATRPRGVIVTVGTLSGSSEQCPFNQIMVKSLSVIGSFRFV-DEYAWAVDYLSRGVL---DVSPLLTAAVPVQQ-VHDAF-ALAADRHKAMKVMVTF....... 345
265 0.000e+00UniRef50_A0A2A2ENP2 NAD(P)-dependent alcohol dehydrogenase n=1 Tax=Halomonas sp. WRN001 TaxID=2032625 RepID=A0A2A2ENP2_9GAMM  ali  23  4.KALVLEQRRELSL-RSIDLPSRPGPDDVKIRIHTVGICGSDVHYYKHGRI---------GPFVVEEPMVLGHEASGTIIGIGSNVRHLKVGDRVCMEPGIPNPVSRAS--------------KLGVYNVDPEVRFWATPPVHGCLTPEIIHPAAFTYILPDNVSFAEGAMIEPFAIGMQAVVKADMRPGDLCVVTGAGPIGLMVALAALANGASEVLISDIVDEKLAIAEQYGLTPVN--TLNESLREALDQRCGGDWGADVVFEASGAPHVYDNIISYSRPAGTLVLVGM-PIEPVNLDVVSAQAKELRIDTVFRY-ANVYDRAIALVASGKV---DLTPLITDTLAFSQSIE-AFERAAEALPGDIKLHIT........ 345
266 0.000e+00UniRef50_A0A2Y9B8G0 L-iditol 2-dehydrogenase n=1 Tax=Faecalicatena orotica TaxID=1544 RepID=A0A2Y9B8G0_9FIRM  ali  29  5MKALVYHGPGVLE-VEERAIP-MPKADEVQIKIKKVSICGSDLGAYR------------FASDRFAPPLVLGHEFSGDITMVGDEVKDLKAGQKVTVNPMVLCND--------------CFFCKRGEGNLCGNRKSMGTTQTDGAMREYVTVPAWMVVPVADNVSYEAAAMLEPCGVTLACAKTGRTVDEQSVVLIGSGPIGLLIVKFLKALGVPKVIVSDILDTRLAKAKECGADEVINA-KDEDVAARVKELTD-SYGADRVIIAAGVGSSINQSFELVRNGGTIVLVALMHEK-VEIDPMEIVGRGLKFLGSYMFTSE-MKEAAQMLAEGRLNVED---LITSTYLLERG-QEAFDILNNPQNTEIKVQIE........ 346
267 0.000e+00UniRef50_A0A2N1S014 Alcohol dehydrogenase n=2 Tax=unclassified Spirochaetes TaxID=1130380 RepID=A0A2N1S014_9SPIR  ali  28  1MKACMIVEKGKIEIV-DIPYCGDPDEHEVVVKIKAGGICGSDMHIYHGTNAF------------AVYPNIMGHELAGEIHAIGKGVEGFRKGEKVAINNVLSCGE--------------CYACRQGRPNVCKNLKVLGVHT-PGGFQEYLRISKHNVYPVPDNLSWAEAALVEPYSIASESMNRGRIADGDTVLICGAGPIGLMLLQAAKLHDV-KVAVLDVVASRLEIARKLGADLVLN-GKSDDVKQAIMEFTDN-EGVSLSFEATGNLRVLEACIHYASQAGRVVVLG-FSTEKMQIAPIEIMKRELDVLGT-RLNNNRFPEAIDWLATGKI---DPKHMISAVYPVEKVVE-AFAFVDENPERTLKVVLEF....... 339
268 0.000e+00UniRef50_A0A1M6RXX3 L-threonine 3-dehydrogenase n=3 Tax=Rhodothermus TaxID=29548 RepID=A0A1M6RXX3_9BACT  ali  28  3MKALAKTRPGPGLELIETDVPR-PGPRDVLIRVRAASICGTDVHIYR---------WDAWSQHRIRPPLILGHEFAGEIVAVGEEVEGLEVGQFVSAEGHI--------------VDHTCAACRAGQLHLCRNARVIGIDR-PGAFAEYVCVPAENVWVNALDVPPEIASLQDPFGNAVHAAY-AFDLAGRAVLVSGCGPIGLMAIPVARVAGARLIVATDLNERRLALARRMGADVTLNPQQ-DDVVGQVRTLT-GGDGVDVVLEMSGAPAAIYAALEALRPGGQVAALGLTAAS-ITLDWNHVVIKGATVQGIYGRIWDTWHRMRALLQTGAV---DLSPLITHRLPLED-YEQAFRLLMHPGDEVVKIILYPNG..... 349
269 0.000e+00UniRef50_A0A182F7A7 Uncharacterized protein n=2 Tax=Anopheles TaxID=44484 RepID=A0A182F7A7_ANOAL  ali  25  10..AGVVHGIEDFR-VEEIPMPT-PLDNEVLLRMDCVGICGSDVHYISHGGF---------GDYKLKEPLVLGHESSGVVIAVGRHVTHLQVGDRVAVEPAIGC--------------RTCRHCKAGRYNLCPKGIYCAT-TGQGNLCNYYTHAADCCFKLPPNVTMEEGALLEPLAVAVHCCRRAGVRX--------------XXXXXAKAMGAARICSVDLMESKLELAKELGADATLAVSGHDSEEELVRRIHLLLLGPDISIECTGAEACVRLGIEATVAGGVLMLVGI-GAINQRLPITTALVREIDIRTAFRY-ANCYPAALALVANGTI---DARKLITHHYDLSQSVE-AFKTSRYGLDGAIKVMIHCQPRN... 356
270 0.000e+00UniRef50_H6LF11 Galactitol-1-phosphate 5-dehydrogenase GatD n=42 Tax=Firmicutes TaxID=1239 RepID=H6LF11_ACEWD  ali  26  1MKAVCMYKPGDLR-VEEVDLPVVQ-ADEVMVKVRAVGLCGSDI-------------PRALVYGAHVSPIIIGHEFSGEITELGAQIKNFKVGDRVVVPPLIPCFE--------------CEWCQKGIYSLCEHYDYYG-SRRNGALAEYVAVKEGNLLKVPDNVSYEDAATIDPCANAYHGLTRANFQAGDSVCVVGTGPIGLFAAQYAKLAGASQVIAVDVWDEKLVIAKKVGADVTINSLK-EDAVEAVKKATNGK-GANIVIDFSGVPMAQKQCLLMASKMGRVVYLGI-SHKGLELSLDTLMRSQLSLIGSWNYPGEDWTESLKMFAEKGMTAKD---IISHRLPLDE-VPNVFAEIAKGGYFYNKIMFYPWGEN... 350
271 0.000e+00UniRef50_D7CVS4 Alcohol dehydrogenase GroES domain protein n=59 Tax=Bacteria TaxID=2 RepID=D7CVS4_TRURR  ali  25  1MQAARLHGAKDLR-VEQIPEVGSPGPGEVLLEVEAVGICGSDLHTYEDGRI---------GDTRVASPLVLGHEFGGVIREVGEGARDLRAGQRVAVDPATPC--------------WRCELCEAGHPNLCCNLAFYGLYPDDGALRERMIVGGRNCFPVPEGISDAGLALLETLGVAIHAVDLGKLELARSVAVIGSGPIGLMITKLAALSGARPVYAFDKFPWRTERALEWGATHSFCLADG-DPVAWLMQETEGR-GADVVFEAAWADASVQQAAEMARLGGRLVLVGIPGDDTLCLKHSVARRKGLSIMMSRR-MKHTYPRAIRLAAKGAV---DLDALVSHRFPLAEA-PRAFDLNLAYPEGLHKVIVE........ 348
272 0.000e+00UniRef50_A0A2U2SMG5 Alcohol dehydrogenase n=1 Tax=Anaerolineae bacterium TaxID=2052143 RepID=A0A2U2SMG5_9CHLR  ali  25  14MKAMLYLGPGKLEL-REVALPQ-PQKGEVLVKVRAATTCGTDVKTYLRGHP------------KITPPCLFGHELAGEIVAVGEGVENFQVGMRVVCHNTAPCG--------------SCYYCKHGYHNLCQKLIY-----NFGSYAEYNCVPAPIVFEIPESLSFAEAAILEPLASVVHGQKKVGITLGETVVIIGAGPIGLMHLMLSKINGAKSVIVVDVQSNRLQIAKEFGADEIINAKQ-QDPLEIIKMQTDGR-GADVCIECVGQKQTWLQAVQMTRPGGRVLWFGLPAGTQLELNADYLHYSEITLFGSYHATPYDVQTAFDLIASRAL---DVSSLVSVELPLDQ-LDKALQMMMN--GEVVKAAITP....... 352
273 0.000e+00UniRef50_A0A182MHV2 Uncharacterized protein n=1 Tax=Anopheles culicifacies TaxID=139723 RepID=A0A182MHV2_9DIPT  ali  30  10..AGVVHGVEDFR-VEEIPIPR-PLDHEVLIEMDCVGICGSDVHYISHGGF---------GDYKLKDKLVLGHESSGVVIEVGKRVSNLKVGDRVAIEPAIGC--------------RICRHCKAGRYNLCPEGVYCAT-TGHGNLCNYYTHAADCCFKLPPNVTMEEGALLEPLAVAVHCCRRGGVGIGNTVLVLGAGPIGLVTMLVAKAMGAAKVCVIDLLECKLEMAKSLGADVTLAVSAQEDIVKRIHLLL--GTAPDISIECTGAEACVQXXXXXXXXX-XXXXXXXXXXXQQRVPITTALVREIDIRTAFRY-ANCYPAALAMVANGTI---DALKLITHHYDLADS-EQAFKTARYGLDGAIK............ 346
274 0.000e+00UniRef50_A0A2S4DCE7 Butanediol dehydrogenase n=3 Tax=Bacteria TaxID=2 RepID=A0A2S4DCE7_9BACT  ali  29  9MLAAVFHGPRDIRL-EEMDEPS-PNVDEVLIRVLQAGICGSDLNRFHYGSHPWPPS------------FIMGHEFCGEIAAVGSEVTAWQVGQRVVVEPTLYCG--------------VCFYCQQGYHNRCVDFAMRGISGTNGGFAEYVCVPAYQPHLQPSTLSSALGALVEPTAVSVHGWHQAGVSQPDCVVVVGIGNIGLLAVLVAKAKGAKQIIAIGKYAPRQTLAERYGASLVLSPDEPK-LQERILERTDG-LGAELVLEAAGAPSSLRMAVDSARKGGKIVVLGVF-HEEVSLDYRQILMAEKHIMGSIIYQREDFAEAMAILATGMV---DVPCHITSEVPLQDIVSAGFQPLSESKAAYIKIQVRPQG..... 353
275 0.000e+00UniRef50_A0A2A8VLM0 L-threonine 3-dehydrogenase Tdh n=10 Tax=Firmicutes TaxID=1239 RepID=A0A2A8VLM0_BACME  ali  26  1MKAVVKTGENYGFSYMEVEKPR-PKPHEILIEVEAAAICGTDISYNKWG----QSAKDFASKFNVKFPFTVGHECSGTIIEVGSEVKNRKVGERVAFETHIPCGE--------------CFQCQTGNAHNCMNMGIYGTS-CDGCFADYAVAPENVAFKLPDNISFEEGALFEPAGVAMRAVEESQIQPGDTALVFGCGAIGLLAIKMLLACGASRVIGVDIDPYRVDMAKSFGA-VGVNSLK-EDLSAIVKDMTSSRGGVDFIFEMTGSPKVYETLFDHLRLEGRVVTVG-HPGGPIPINITQINLKGATIKGLFRRIWETWWKLSSLVESKKI---DILEVVTHRYSFSQ-VDEAFEQVNKGAG---KIMF......... 345
276 0.000e+00UniRef50_A0A1G3R343 Alcohol dehydrogenase n=2 Tax=Bacteria TaxID=2 RepID=A0A1G3R343_9SPIR  ali  26  1MKQAVMTSPGVIEF-REVPAPE-PAAGELLLRMKRIGVCGSDIHVYHGKHALTP------------FPVVQGHEVSGVVEKLGTGVRGFKPGERVTFQPQVFCGQ--------------CYPCTHGAYHICDNLKVMGFQTT-GAASEFFAVPAAKVLKLSPAITLDQGAMVEPVAVAVHALGRSAGVAGKKVLVLGAGPIGNLVAQAALGSGAARVLITDLSDFRLEIARKCGIPAGVNPAKA-DLAAEVRRHL-GEDKADLILECVGSQATIAQAVAVARKGTDIIVVGVFGEKP-TVDLGTVQDRELRLIGTLMYQEPDWRRAIELIGRSKVQ---LDPLITDHFPFAD-YKKAYEHIEAHRDRAVKVMIVVEE..... 341
277 0.000e+00UniRef50_A0A1Y4FGQ4 Alcohol dehydrogenase n=1 Tax=Blautia sp. An249 TaxID=1965603 RepID=A0A1Y4FGQ4_9FIRM  ali  28  5MKVCVLTGKQKLEWTE-REIPQ-PGKGELQIKLEYVGVCGSDLHFYQEGRLANWELDG---------PLALGHEPGGVVTDIGEGVEGFEIGDKVSIEPAVPCG--------------TCPDCRSGHYNLCQNIKMLAIPGRDGVFADYCVHDASMCYKLPENVGTMEGGLIEPLSVGLHATELSNAKVGETAIVLGSGCIGLCTIMSLKARGVSEIYVADVLDKRLEKAMEVGATRVFNSTR-ESIEEFAK--TLPGGGADQVYECAGNRITTLQSCRLIKRAGKVTLVGVSPEPVLELDIATLNAMEGTIYSVYRY-RNLWPKAIKAVETGMIP---LKKIVSHVFDFKDCIQ-ALEDSMNHKDEIIKAVIKM....... 347
278 0.000e+00UniRef50_A0A151B9S2 Alcohol dehydrogenase GroES domain-containing protein n=1 Tax=Candidatus Bathyarchaeota archaeon B24 TaxID=1779368 RepID=A0A151B9  ali  31  1MKAALIRRPYSLDIV-DVDVPSV-KPGEALVKVHACGVCGTDIHIYEGAMPW------------ARLPLIPGHELSGVVVEVGEAVSNIEPEDKVTVDPNITCG--------------VCRYCRRGRRNLCPNLEAIGV-TTSGGFAEYVVAPVSQLYKVPKGLSLEEAAFAEPVSCCVHGFTRLSIQPGDDVLIIGAGPIGLIHLQLAKRCGAGKVVVAEVNEKRLKLASELGADLTVNPSE-ERLSERVRQFLSGK-GVEAAIDAAGGSAPLDLALSCLEPGGRLLVFGVASEKDLKIKPYDLYKRELTIIGSFI-NPYEMDNALNLLASGAV---DVKPLISHVIGL-DSLEKA---LKRELPNALKILVKP....... 337
279 0.000e+00UniRef50_A0A1Y6GBJ1 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase n=4 Tax=Bacillaceae TaxID=186817 RepID=A0A1Y6GBJ1_9BACI  ali  27  1MLAGVFEKIGNLAL-QEREVPTLKSDLDVKIKVLAASICGTDVHILSD-----------PPGHPATPGIIQGHEYVGEVVDTGKEVRNVNIGDRVIVDPTTTCG--------------SCHYCQIGRPNLCKNSSTLGI-FLDGGWASYSVVPSKNVFKISKDIAPEIAVLAEPLSCVVNGSEKVNVQPGDSVVIIGAGPMGQLFTQVLKAAGAAKMICVDFSDYRLNYSKLSGATHVINP-KNEDLVKAVKEITE--VGVDVVIDCVGV--LFDQCINLVRSGGQILLVGMNEHAKPQIKQYDLTRNEITVKGTFIQNY-DFPKVVKILES---NILNLNSLITHKITLDK-LEEGIETM--RKGEAIKIIVYP....... 336
280 0.000e+00UniRef50_A0A259UF12 L-threonine 3-dehydrogenase n=3 Tax=Firmicutes TaxID=1239 RepID=A0A259UF12_9FIRM  ali  27  5MKGIVKDKPEAGAWREDLPIPEI-KDNELLIRVKAAAICGTDMHIY---------PWTAWAQARLKLPMVFGHEFAGEVVAIGSTVRGFEVGDRVAGETHIPC--------------NKCYQCQTGNQHNCNDMKIIGVHTE-GCFAEYIAIPVDCAWRLDDSLSFEIGAMLEPMGVAVHGV-LAGDIGGKSIAVYGCGPIGLMGVGVAAACGASKIFAIDVFDQKLEVAKQMGADITLNS-RNDNVIEQILQATEG-QGVDITVDFTGNGNAIKEGFAILRKGGRFTLVGL-PNEPVALNLDDIIYKEATVQGVTRLMYKTWWQCNELLKSGKI---DLSPVIGRKYALKD-YDQAFSALKAGATG--KMLLIPDK..... 349
281 0.000e+00UniRef50_O35045 Uncharacterized zinc-type alcohol dehydrogenase-like protein YjmD n=231 Tax=Bacteria TaxID=2 RepID=YJMD_BACSU  ali  29  1MKAVQVRKAYDL-VTAEVKKPVLSKDDEVLVKVKRVGICGSDMHIYHGTNPL------------ATLPRVIGHEVTGQVEAVGANVQSLKPGDHVVIEPISYCG--------------SCYACRKGRPNVCAKLSVFGVH-EDGGMREYIVLPERQLHAVSKDLPWEEAVMAEPYTIGAQAVWRGQVEKGDTVLIQGAGPIGICVLKMAKLAGAA-VMMTDLNNERLAFAKENGADAVVNV-QAEHVAERVLEWT-GNEGANVVIDAVCLPETFALSIEAVSPAGHVVVLG-FDERAAQISQLPITKKEVTITGS-RLQTNQFPKVVELLNGGRLMHNG---LVTHTFSVDD-VHHAFQFIKEHPDQVRKAVITFD...... 339
282 0.000e+00UniRef50_I0I4Z2 Putative arabitol-phosphate dehydrogenase n=2 Tax=Chloroflexi TaxID=200795 RepID=I0I4Z2_CALAS  ali  30  1MKVA--PGFGHVE-VRDIPEPE-PGPGQVKIRVRAAGLCGTDLHIYKD-------------EFRSWPPVVLGHEVAGEIAELGEGVAGLAPGMRVTTETYFSC-------------CGECRYCRSGQINLCPERRSIG-SAVNGGFTSYLIVPAHNIHLLPENVDFQAGALTEPLACVVHATLTAPVAPGDVAVIAGPGAIGLLTLQIVKAAGATAVVLTNADERRLMLAQELGADRVVNVQQK-DPLESVRELTEGGLGADVVYECAGAGAAAQQLLTLVRRRGRYVQIGLFG-KPVAWDLDQLVYKELTATGSNASTPSSWLRALELLRTGKVRT---APLITHVFPITE-WEAGFATFEDRSG--VKTLFVP....... 338
283 0.000e+00UniRef50_A0A0C7BLY6 Uncharacterized protein n=34 Tax=Eukaryota TaxID=2759 RepID=A0A0C7BLY6_9FUNG  ali  28  21...VQLKEKDHLQIVE-IPIPT-PEKGEVQVQVKCTGICGSDVHLWKHGEI---------GIFPVTQPQLLGHESAGIVTAVGENVTSLKVGDRVAIEAGIPC--------------SLCDQCMNGRYHLCPDVVFKSTPPYDGLLAKYITHPARWLHKIPDNLSYEEGALLEPLSVAIAAIDRVRAKFGKSLLITGCXXXXXXXXXXXXXXXXXXXXXXDVQENRLEYAKKMGATFTYKVTPGKSETETVKEIRDGGEGAECTVECTGIESSFRTAIMATRDAGTCCLVGV-GKNDQSIPVNNFAMREVDIRGLFRY-HHTYPRAINLIASGTV---DIKHLVTHKFEFKDAL-KAFETASNYSTGAIKVQIT........ 362
284 0.000e+00UniRef50_A0A239YNF3 Putative zinc-binding alcohol dehydrogenase n=10 Tax=Actinobacteria TaxID=201174 RepID=A0A239YNF3_9CORY  ali  36  1MKAVRYYGKEDLRI-DEIAEPEV-RPGTIKIAPAYTGICGSDVHLYFDGPPPAPSEDAPHPVSGETLPVVMGHEFSGVVEEVGPGVTGISVGDHVVVEPFMVDG--------------TCPSCNRGDYHLCDQMGFIGISGRGGGLSEHIVVEERWVHP-TGSIPLDQAALIEPLAVAHHGIAHAGDHEGEWALVGGAGPIGLLTGAVLKAYG-MKVIISEPSGARRDKALEAGADHVVNPLE-EDLHEKVTELTDGEL-VSVSFDAAGVPQVLQDLIHATRPAGRIEVLALHMH-PYSMDIMDLTMKERVIGSSIGYC-NDHPTVIKLVQDGKV---DLAPFITSKIKAENVVEDGFNALRNPQE--VKILVSMD...... 356
285 0.000e+00UniRef50_A0A1B9BFQ6 Galactitol-1-phosphate 5-dehydrogenase n=28 Tax=Firmicutes TaxID=1239 RepID=A0A1B9BFQ6_CLOBE  ali  31  1MKALVITGISKVEL-QDLEIPKY-KDDEVLIKVKYCGICGSDL-------------PRALDGGVHSFPIVVGHEFSGQIVEVGEKVKNVKVGDRVTAGALLPCG--------------KCEACQQGRPAMCSDYGFIG-SRQNGAMAEYVAVKSQNVVKLPDEVDYKEGAMIEPLTVALHGIQRINIKAGATALVFGAGTIGLLALQCLKAVGAGKVYMVDVVDKKLELAKKLGADDVINSMKVD-----LNEYLTEHGKPEVVVENSGSPIAQAQCLEIVKKCGSVVYIG-TATRDLTLKPEKILRGELNITGSWMYPGYEWTTAVEYIKEKKI---DLKSMITNVYKLEDGLAP-FEIMRDREACATKVLFE........ 342
286 0.000e+00UniRef50_UPI00085BCB57 alcohol dehydrogenase n=1 Tax=Cellulosilyticum sp. I15G10I2 TaxID=1892843 RepID=UPI00085BCB57  ali  30  1MRALVYHSPQNIS-VEDVKVPEV-GEKDVLIKIKYCGVCGTDIHIYNG----------DGGAFEVTPPLIMGHEFSGTVEQVGSQVKKVNIGDVVTVDPNNMCGE--------------CYYCKNAMEQFCENVIGIGT-TFDGGFAQYIVVTEKQVFKFKEGMDALTAAMTEPVSCCLHGIDLCNIKLGDEVLVIGGGPIGLMMLQMAKMAGASKIILSEPVEEKRELALKLGADITINPLE-EDIEAVIKANCKN---INAVIECVGKVHTIDSAIKCAGKGATVMMFGLTGPDEAHVKPDIVFKKELKLTSSFI-NPYTFERSIAILESGKLNVRDT---ITDIVELEECV-KVFEDDKYRRSG--KVVIKLND..... 340
287 0.000e+00UniRef50_A0A1Y4RGT8 Alcohol dehydrogenase n=2 Tax=Clostridiales TaxID=186802 RepID=A0A1Y4RGT8_9FIRM  ali  28  27.......................PGPHEVLVKNMACGICGTDVHIYHG----------EKGSAEVLPPVILGHEFAGIVEAAGSAVEGLEPGDHVAIDPNMYCG--------------KCFPCRMGKKQNCEHLYALGVN-ANGGFAQYSLCPDSQCFRVDKNLDFDVAAMVEPLACAVHGIDQVQIQTGQTVLIIGGGTIGLLMVQLARLSGASAVLLSEPVEMRRAIGLQAGADGVIDPIH-ENVSERIRQMT-GRDGADVIIECVGKPVAVTQAFSAAGTGCHILLFSVPGNSTVEMPLFDIYKKELCITGSII-NPDTHQRAVNLLNSGRMM---IKELITHSYDLE-HLDEAVHMQMS--SESIKVMIHPWS..... 347
288 0.000e+00UniRef50_A0A1C5ZMW6 Sorbitol dehydrogenase n=13 Tax=Firmicutes TaxID=1239 RepID=A0A1C5ZMW6_9FIRM  ali  29  1MRAGFIEKPE-VAYFKETEEPQINNPTDVKIKVKVTGICGSEVHAYHGKHAW------------RVPPLVSGHEFAGEVCEVGSAVTKFKVGDRVTAEPQYGCGH--------------CELCKAGKYNLCQDKKILGAYYWSGSFGEYIVAPEGCVIPLGENVSFDQGALIEPLAVGMHAVREHKVNEDSVIAIIGCGTIGLGVLLSAKRFNPKKIIAIDVVDFNLEKAKEMGADLVLNSMKDP-VLDRVLEETDGY-GVDMTFLAFGNAPCVQQAAEITKRGGIISEIAIMANVQAPFDL--IQIKELKLCGSNMYTADDFKEVIDGINEGDIK---LDGFITKRFPVEE-FHDAMEWADKRPEPVVKVVVDF....... 340
289 0.000e+00UniRef50_A0A0G1V541 L-iditol 2-dehydrogenase n=6 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1V541_9BACT  ali  32  7MKALVYADKEKMEI-RDVPKPAI-GPDDILMKVKSVGICGTDLHIYRGGLDIPRGT-------------IPGHEFSGIVTEVGKKVTNVQKGDRAVAEHVVSCG--------------KCDYCKMGKPNLCGHSKIIGLH-LSGALAKYVRVPANLVYPFPNSMTFDEAALIEPLSIALYAAREAGFLLDKRIAVLGQGPIGLLLDQVLAAAGA-LVTGIDVRPNTLAFAKKMGAHHTINS-RLQNLRARMKEI-KSADGFDMVFEAVGIEKTAELAFDITRRDGNVYLLGVFS-APVRINMMNIIKKELNIHGSWT-CAFSFPDSIDLVARKKV---DLKSLITHTYPFANAV-TAFKEANSYTHNRLKTIIK........ 342
290 0.000e+00UniRef50_Q96V44 L-arabinitol 4-dehydrogenase n=154 Tax=Fungi TaxID=4751 RepID=LAD_HYPJE  ali  24  25....VFTNPHDLWISE--AEPSALKPGEVTIAVRSTGICGSDVHFWHAGCIGPMIVEGDH---------ILGHESAGEVIAVHPTVSSLQIGDRVAIEPNIIC--------------NACEPCLTGRYNGCEKVEFLSTPPVPGLLRRYVNHPAVWCHKIG-NMSWENGALLEPLSVALAGMQRAKVQLGDPVLVCGAGPIGLVSMLCAAAAGACPLVITDISESRLAFAKEICPRVTIEIGKSAEETAKSIVSSFGGVEPAVTLECTGVESSIAAAIWASKFGGKVFVIGV-GKNEISIPFMRASVREVDIQLQYRYS-NTWPRAIRLIESGVI---DLSKFVTHRFPLEDAV-KAFETSADPKSGAIKVMIQ........ 374
291 0.000e+00UniRef50_A0A0D6JV78 Sorbitol dehydrogenase n=10 Tax=Halobacteria TaxID=183963 RepID=A0A0D6JV78_9EURY  ali  27  1MRTCELTDVSEFTLV-DRDLPTI-GPDEVLVRIDRVGICGSDLHYYQHG---------ENGGNIVEFPHVLGHEAAGTVVEVGDGVSRVGPDDRVAIEPGLPCGE--------------CEYCVDGTYHLCEDMEYMSSPPVEGALTEYVAWPAEYLYALPDSVSLREGALAEPLSVAMHACQRGGVSEGDSVLVTGGGPIGQLVSEVAMARGAETVVLTDVVPEKLELAESRGVDHAVDVTES-DPVETIREHVDER-GVDVVLESSGFGGAIETTTEAVKRGGTVVFVGIPLEPEFPTDIVETIGQEYDLKGSFRFS-NTYPAAIEGIETGRF---DVDSIVTFESSFEDT-QAAFDRAAEPEE--VKGVIRVSDE.... 345
292 0.000e+00UniRef50_U5HHS4 Uncharacterized protein n=8 Tax=Basidiomycota TaxID=5204 RepID=U5HHS4_USTV1  ali  25  9..AAVLHGPKDLRLTKR--EVVAPVAGEAQVAVKATGLCGSDMHYYIHGAV---------GDFKLRHPMALGHESAGVVTAVGEGVTSVAVGDRVAIEAGVYCGQ--------------CRLCKSGRYNLCGRMRFNSYPHADGSLQTFLNHPARNLHKLPDACSYEAAALVEPLSVVLHASRRANISAGQSVLVLGAGAVGILALAVAKAHGATHLVVVDINEARVNFSVQEGAGHILPPENSTQSLEQAKTMADDSDGFDVVLECTGVETCMQAAVHAARPGGKVVYIGM-GTPNATLPVSAAAFREVDLLGVFRYV-NTYPDALALFGAGRLP--GVEKLVTTRHKLS-AVNQAFEELINGVDKDGKMIIKM....... 371
293 0.000e+00UniRef50_A0A1W9PEW1 Uncharacterized protein n=1 Tax=candidate division KSB1 bacterium 4484_219 TaxID=1968530 RepID=A0A1W9PEW1_9BACT  ali  26  1MKAAIFKTKHNIVLETNKAV-APPTAKEVLVKVDTCGVCGTDIHIFDG-------------EAKASPPVVLGHEFCGTVEKVGLDVSTIAPGAWVAIDPNIHC--------------DSCFYCRKGLINLCQNLRAIGVN-LDGGFAEYCLVPATQVYQISDSFPHQWGALAEPISCALRGIERAQIRSGESVVILGAGNIGLIMLQLAQIAGAGRLVVVEPLPERRQIAQQIGCDGTIDPKTS-DAEEQIQQMTGG--GADVVIECVGKTEAATMAVRIARCGGRIVIFGLAEKDSLRVNLQDLFYRELSILGSI-LNPFTFQTAIQLLNSGKIRFDYYK---TQSFTLEQ-IQRAF--AAHREGKYHKIFIKPN...... 338
294 0.000e+00UniRef50_A0A1G6WKB0 L-iditol 2-dehydrogenase n=5 Tax=Actinobacteria TaxID=201174 RepID=A0A1G6WKB0_9PSEU  ali  29  7MRVSVLRAPGELAL-ERRPIPAF-GPREVLVRVLSVGTCGSDTHYYRHGRI---------GRFVVRAPLVLGHEPAGEVVAVGAEVERVRPGQRVSLEPGVPC--------------FTCPLCASGRYNLCPRMRFFATPPVDGAFAEYVVHHEAMAHPVPDTVSDDAAALLEPLSVAIWACRKAGVGPGSRVLVSGAGPVGLLAVQAARAFGAAEVAVTDLRWARLSLARDLGASRAVDMGADTGPKEV------SGFAPDILIECSGSPEATAGGVLALGGGGRAVLVGM-GGDTVALPLSHVQDNEITVTGVFRY-ANTWPTAIALASARTV---DLDRLVTHHFGLAD-VEGALGAGAEDPT-AVKVVVRPQ...... 344
295 0.000e+00UniRef50_A0A259UN40 Putative zinc-type alcohol dehydrogenase-like protein YjmD n=1 Tax=Sporomusa silvacetica DSM 10669 TaxID=1123289 RepID=A0A259UN40  ali  29  1MKAIEIIKPGEIAIVE-RPIPE-CKENEVLIKVKAAGICGSDAHIYHGKNAF------------ATYPRVVGHEFAGEIVKVGSQVKNLQVGDGVAVDPVSSCGH--------------CYACRIGRHNVCKSLSVIGVHR-DGGYREYVAVDAGSAHKLPKNISWEIAAMIEPYTIAAQVMDRGRLTADDTVLICGAGPIGLILLQAVKMTGA-RVAIMDIIDTRLNMAKEMAADLVINSKTS-DMITEMMAFTNN-EGASLILEATGNINVLETCIKIAAPAGRVVVLG-FSTELVKIPQVAIMSKELEIIGT-RLNNNKFPQVIEWFAKGLVQP---EKILTHTFKFEE-VEKAFDFMDKNPADVCKI........... 334
296 0.000e+00UniRef50_A0A2N3PYY5 L-idonate 5-dehydrogenase n=2 Tax=Proteobacteria TaxID=1224 RepID=A0A2N3PYY5_9PROT  ali  27  1MEACVIHGALDLRL-DKVKEPEL-SDNYVKVRIRAGGICGSDLHYFSNGRI---------GDFIIREPLIPGHEVAGEVCAVGAKVSTLKPGDRVAIHPGRSCG--------------RCPRCREGRPNLCQSVFYMGFPHMQGGFCEFVSVDESQCHKISTDIAFPLIAFAEPLSVALHAVHRAGDIMGRKVLITGAGPIGQLLLLAARRAGAGDVVVTDLLDSSLGKARQIGAAATINVGRTPDALTETSRAID---GFDVAFEVSGAAPALNSAIDAVHPGATIVQVGSLPAGPQGVTANRIMAKELDVRGAFRFG-NVFADAVACLEKGLI---DVSPLLTAVVPMANAGE-AF-LMAKDREHHLKVVIEF....... 345
297 0.000e+00UniRef50_UPI00082E9A2E hypothetical protein n=1 Tax=Anaerotruncus rubiinfantis TaxID=1720200 RepID=UPI00082E9A2E  ali  27  1MKAIVLEAPRRSVAVADKPMPEI-GPDEVLIQVQACGICATDLKMFKGEYSGC-------------LPVTPGHEFTGRAVKVGDKVTRIKAGDRVVADPNESCG--------------TCGACRTAHSTFCETMAGYGVYT-DGGLAEYAKAKEKGLYLVPENLPPEIAAFVEPISCALHGIEQAGIRQGDNVVIIGAGTMGQLLLQMARNTGAAKLIHVDRIAWKLEVSKAYGATDVVDGSKA-DPIEAVKALT-GGKGADVVIEAVGHPSVLEMAMDMVAQGGRIVQFGFPAEGKAQIEPFQILKKELTLVGSWI-NPYTYERALHMLSSGKLR---VDHLVTHLLKLED-YEKAIHLIETQPQGFMKIMVHPE...... 343
298 0.000e+00UniRef50_A0A2E5QK64 NAD(P)-dependent alcohol dehydrogenase n=1 Tax=Chloroflexi bacterium TaxID=2026724 RepID=A0A2E5QK64_9CHLR  ali  30  9.KAAILKDKRSI-ILGDIPDPGTPASDEVRVKILSVGICGSDVHYYTDGRI---------GSFIVDAPLILGHEACGIVEQIGENVTKVSVGDFVALEPGIPC--------------KKCKECFTGNYNLCKKIKFWATPPINGALTEYVLHPEIFTFKLPSNINHSIGPLIEPLSVAVHAITKTGIQPGDIVFINGSGTVGCLTSVVAKTLGGSYVISSDNNELRLNLARKMGVDKTINIL-SDSIINKVNQITK-SLGVNLIYECSGYSKSLNDLIPISSPGGKITLIGM-GNQKYDFDAVDAMSKELQIYTIFRY-ANSYFKAIEIAKN---TNFNLQELITDRFSIDN-VSDAFEYASNPEPRTCKILIDF....... 350
299 0.000e+00UniRef50_A0A0J1F717 Sorbitol dehydrogenase n=1 Tax=Peptococcaceae bacterium CEB3 TaxID=999898 RepID=A0A0J1F717_9FIRM  ali  29  18..............LETIPVPEL-NDDEVLVSVHTCGICGSDMHAYHGKHPY------------VAFPIIMGHEFSGIVVATGSKYDNLKE-QRIVVEPSIVCGD--------------CYNCRHGRYNICQRLAVLGCQTS-GAFAEYIKVPGTQVIVLPDSVSFAEAAMVEPLAVGVHAARRARLQSGDRVVVLGAGTIGLLTAASAAQLGA-EVLIVDMFPAKLEVAKKLKIQHTINLAE-QDLAATVTEVF-GDEGPDVWFECVGIEKTIHGAITLARNGTKIIVVGVFGQ-TIQVDMGLVQTKELELLGSLMYTRGDFDTALDFIRTKNI---DVSKLISAVYPVSK-LSEAFKAIEANRGTSLKTLITVKG..... 344
300 0.000e+00UniRef50_A0A1Z5TRN3 Uncharacterized protein n=2 Tax=Hortaea werneckii EXF-2000 TaxID=1157616 RepID=A0A1Z5TRN3_HORWE  ali  26  399....VYTNPHDLWVAEEVEKGESLKPGEVTVAIKSTGICGSDVHFWHEGCIGPMIVEDTH---------VLGHESAGIVVAKHPTVETHNVGDRVAVEPNIICGE--------------CEPCLTGKYNGCENVEFRSTPPVPGLLRRYVNHPAVWCHKIGD-MGYEDGALLEPLSVALAGMQRANITLGDSVLVCGAGPIGLVTLACVKAAGAEPIVITDIDEGRLKFAQEFGVHKVEFSDSPEDFARKVVAKADGVEPA-VTMECTGVESSISGAIHASKFGGKVFVIGV-GKPEIKIPFMRLSTREVDLQFQYRY-ANTWPRAIRLLQGGVI---DLKKLVTHRFPLENAID-AFKVASDAKQGGIKVMIQ........ 748
301 0.000e+00UniRef50_Q0RW76 Probable Zn-containing alcohol dehydrogenase n=20 Tax=Actinobacteria TaxID=201174 RepID=Q0RW76_RHOJR  ali  36  1MLALRLYREHDARL-EEVPEPEL-RPGAVKVKVAWAGICGSDLSLFETAPV---PLDYSNPIMQETGPHTLGHEFSGYVTEVAEGVTTVQVGDLVAVRPNFADG--------------TCPSCQAGHPNMCDNFAFIGINGWGGGFSESVVVPADHAYVLPPGFNAQIAALIEPLTVAWHAVKLAEIPKDGTALVVGAGPIGLSTVLALRAQGISKIIVSEPSEARKKLAAEVGADLVIDPRET-DVVAAVRDAT-GGRGADVSFEASGIGATLQPAIDALCTAGRAVILASF-HGDVPTDVMPFLTKEKVLTGSFAYTAQDFSDVRDAVVDGRITPD---ALISSRIQLSDVLDSGIKHLLEGRTTEVKILVSP....... 352
302 0.000e+00UniRef50_A0A2H3ISI9 Alcohol dehydrogenase superfamily, zinc-type n=1 Tax=Penicillium occitanis TaxID=290292 RepID=A0A2H3ISI9_9EURO  ali  27  442........IRDHRLAEDEGIPTLTDPYDVIVRISYVGVCGSDVHFWNHGGIQTFVSS--------TAPIILGHEASGIIATVGSKVDSLKPGDRVAIEPGFPC--------------RRCNFCKRGQYNLCLGMRFAADPGQHGTLTKYFVAPADFVYVIPAEMSLEEAVLVEPLSVAVHTVRNLGLKAGESVVVMGSGTIGLLCAKVACAFGAERVVLCDVLPQKLEFARGYGCETFLLDKGQTDTEVEAKRLLDDIKGVDNVIEASGAGSAIQIGIFALRNGGSYIQTGMSGRAKVEFPINVFSAKELNLKGCFRYGAGDYELAMGLLASKKV---GVKELISSVTPFERA-PEAWE--KTGKGEGIKNLIE........ 790
303 0.000e+00UniRef50_A0A1E3IIK9 Chlorophyll synthesis pathway protein BchC n=2 Tax=Cryptococcus depauperatus TaxID=5208 RepID=A0A1E3IIK9_9TREE  ali  26  25..AFILHGALQTSF-EEVPVPQV-GPDEVLVEIKKTGICGSDVHFYNTGRMGLATCSES---------MCLGHESAGVIVQLGSNSNKLTIGDKVALEPGVTC--------------RMCVDCRRGQYQICEHMVFAAYPPFGGTLSRYFKLPADLVYPLPDSVDLAYGAMMEPLSVATHAVNVGGMRTGWNVLITGAGPVGLLAMAVAKGMGAAKVVAIDINEERLKFAKEYAATDTFPIKPGEKLADWVRTAAEGPGSIDLVVDATGAEACIHMALNAIRPGGVYVQVG-FGPPDVSIPMFRVITNEIQIRGAWRYGSGDYPLAIDLVARGQV---NLEPLLTHTFKFKDALE-AFEITKAGKDKNGKGVIK........ 389
304 0.000e+00UniRef50_A0A0U2M194 Alcohol dehydrogenase n=87 Tax=Bacilli TaxID=91061 RepID=A0A0U2M194_9BACL  ali  28  1MRAGIYLGEKKV-VPGQLPIPE-PTHGEALIRVLAGGICGTDMMIYAGKHP------------RAKAPLALGHEFCGVIEKV-AGDSSFQPGERVVIEPTLSCGE--------------CEACLAGQTHVCKTLRLIGID-MDGGFAEYAKVPVHRLHRYPGHLSDSLAALTEPLAVAVHTVRRSHVKIGDDVVIIGCGPIGLLVGMVARRSGAGRIIAVDVSPYRIAKAQELGWT-VLDARQT-DITQEIKSLT-GGKGADVVFEAAGTSVTAKQMTEVAKIQGQIVVVSLFKQPP-TVDLAAMHFKELCLTTTRCYSRTDFQTAIALMAGDQV---NLSGLISHELPLERIAE-GFALMENP-EEALKIIIRP....... 336
305 0.000e+00UniRef50_N6TGY8 Uncharacterized protein (Fragment) n=1 Tax=Dendroctonus ponderosae TaxID=77166 RepID=N6TGY8_DENPD  ali  29  9...AVLYGINDIRL-EQRPIP-VPKDDQVLLQMAVVGICGSDVHYLVHGSI---------GPFVVKKPMIIGHEASGTVVKVGKNVKHLQPGDQVAIEPGVPC--------------RFCAFCKSGDYHLCADIFFCATPPDDGNLSRYYVHAADFCHK-------------------------GFVTVGDVVLILGAGPIGLVTLLSAKAMGASKIIVTDIWDVKLQTAKELGAHHVIKIEKGMEEDAIVAKIVELGEQPNKTFDCSGAEQSVRIALKVTKSKGIVVLIGM-GQLEQTLPLSSAIIREVDIRGVFRYS-NDYPIAIDMVASGKIS---VKPLITHHFKIEETV-KAFEVARTQAGNPIKILIHPNWKPNKK 334
306 0.000e+00UniRef50_A0A0D6FQG0 L-idonate 5-dehydrogenase n=44 Tax=Bacteria TaxID=2 RepID=A0A0D6FQG0_ALCXX  ali  28  1MLNCAIHGAEDLRLVEQAPEP--LGPTQVRVGVKAVGICGSDLHYYRHGRV---------GDFVIREPLTPGHEASGQVLEVGSAVTAVKPGDRVALDPARTCG--------------VCRYCRQGDSNHCEAVFFFGYPHMQGAMREQVVVQEKQCVPVPDSLSFELAAFGEPLAVALHAVRSAGTLLGKTVMVVGAGPIGALVLMAARLAGASQVIVVDIVDQTLATCARVGATRTINAAAE---PGALDELAAGKGTVDVCFEASGNYAGLANCIRATRPRGTIVTVGTLNGSSEQCPFNQIMVKSLNVIGSFRFV-DEYAWAVDYLGRGLV---DVAPLLTAAVP-ARQAHEAFALAADRR-QAMKVMVTF....... 345
307 0.000e+00UniRef50_A0A1Y4TZD3 Threonine dehydrogenase n=5 Tax=Bacteria TaxID=2 RepID=A0A1Y4TZD3_9FIRM  ali  27  1MKAVVLNGPNDFAAVEDYPKPQI-GPGDMLLEMKRTAICGTDIRILEGK-----------KTKDVRYGHIIGHEISGVICEVGAEVEGYSVGDRVAVENVIPDG--------------TCAMCISGHDNVCLHRQAIGY-EFDGGFAEYVFIPEGNVVKLTDNISYGEGALIEPLSCCLRGQRNAGVKFNDVVVIVGAGPIGLMHTLLAKAAGARKVIVSELNEFRRGKALECGADIVVDSAK-EDLKGIVMSETNG-VGADVVIVAIGIPALVNPSIELVRKNGSICLFAGFTKGKAEIDPNLIHYGEIRMCGSSAYRRQDYQEAAQMVMSGAV---DMKPIITNVFKIED-FQKAYEAVKSGAD--LKVEIEP....... 346
308 0.000e+00UniRef50_V2XK07 Putative chlorophyll synthesis pathway protein BchC n=13 Tax=Bacteria TaxID=2 RepID=V2XK07_9FIRM  ali  29  1MKALRFLEAYHLE-VQEVPMP-VPAEDACLLKVKACGICGSDPAGYTG------------TSGRRIPPMTMGHEFCGEIVEIGSKVKNFRLGDRVIAQPINFCGY--------------CENCRRGLTMLCEDKSFFGVLTTDGGMAEYVSVPEKLLYRIPENTTFYRGALTEPYAVTYGAYKKAGDLKDKIVLIIGAGTIGDCLLQLILTDRPKMVIVADVSEQRLKLAEEFGADYTINTAET-DALEKIRELTDGH-MIDISFEAVGVEETANLSVKALYIAGTAVWLGMH-QKEMTLNMQDVVCSARNILGSFNYTHAEFGEVVELLGTGKL---DADKMISKVISLEEA-PDAFEELLSTPGKYLKIIIDPTKNKD.. 345
309 0.000e+00UniRef50_I0I2B3 Putative L-threonine dehydrogenase n=6 Tax=Terrabacteria group TaxID=1783272 RepID=I0I2B3_CALAS  ali  29  1MKAVLFPAPESIS-VERVPDPS-CGPDEVVVQVARCGICGTDIHIYRN-------------EYMSTFPVIPGHEFGGVIVEVGRDVTDFRVGERVAVDPNLYCG--------------RCDMCRNEMANHCLNWQGVGI-TRPGGFAEYTAVPARACYRLPDSLSDAQAAFIEPLACVVHAMKRIRVLPADPVLILGAGPMGLLLIQALRRMGGSFVVAVEKQPARLELARAMGASLAVPAGPEQD--AALREVA--PRGFGVVIDATGVPAVIEGAFRYLRPRGTYLQFGVAPQARVSLSPYDIFRNDWTIVGSFALCY-TFIPAIDWLASGAI---DVAPLVSHVAPME-HFATVFQQFAA--GQTLKVHI......... 333
310 0.000e+00UniRef50_A0A135VNF0 Uncharacterized protein n=2 Tax=Candidatus Thorarchaeota TaxID=1706441 RepID=A0A135VNF0_9ARCH  ali  27  4MKAGILYAPKDLR-VEEIEIPKLL-PGWVLIKVRAAGICGSDLHLYKEKTFIPISSILGEGKY------VPGHELAGEIHEIGEGVTSLQLGDRVVIEPTVNCG--------------KCDWCNIGLYNLCEKSGLIGFYYI-GGIAEYCVAPEENCFKISEKTTYEEAATLDCIAVAVRAIKRAGISMEDSVVILGAGTIGLFAAQAANIAGAKEVYVTGTHDYQLEAAERFDVTATINAKK-ENPVERIMELTSGK-GVDKVVEAVGNAPVIDQGVSMLRRHGTIVATGIFL-NPMPINMFSLITKEVNLTGSWGYAYKEFKVSLDLLEMGRI---DSKPLITHKFPLEKS-SEAFQTALDKRESHIKVQIIF....... 354
311 0.000e+00UniRef50_A0A0G2I9U2 Putative alcohol zinc-containing n=2 Tax=Diaporthe TaxID=36922 RepID=A0A0G2I9U2_9PEZI  ali  34  1MRALRYYGIRDIRL-DDIPEPD-CRPGCVKLRPAYVGICGSDIHLYFDEAVAI-KPDFVHPLAKEKMPIVFGHEFGGVVTEVGDGVTRARVGDLVAVRPSLYDG--------------TCEACVAGHTNVCQCWGWLGIHAS-GGLAESAVVEDKTVFRLPQGTSAEVSALVEPLAVGWHATRLADLAPTSTALIIGGGPIGCAVYLALRAQGLTRIVVSEVSEARRDMLAALGAEHVLSPADA-DVAATVRRLSGPGRGAHAAFDCAGLPVTLSTALDALRPRGTIVNVAIRAEPVPQVDLNLYVYKEATLVSSIAYQDKDWEEVIEALAHGKIKP---EAMVTSKIELQDLVEKGIKVLAKPGQQHCKILISVQQ..... 356
312 0.000e+00UniRef50_A0A1G9LUS9 L-iditol 2-dehydrogenase n=1 Tax=Halarsenatibacter silvermanii TaxID=321763 RepID=A0A1G9LUS9_9FIRM  ali  28  4MKEIELVDIEKFA-EKEVEIPEV-GPDQVLIEPEIFGICGSDVHSYTGHHPF------------VDPPIVLGHEYSGIVRKVGENVDDLEIGQRVTSEIVINCG--------------VCHNCRDGRYQICENGKYLGNVGWNGAMAEYLVMYADKVHKLPEELTSQQGAMVEPAAVGIHAVRRSDFQVGDTALVLGAGVIGNLTAQALKAAGASRVIITDVIDDRIEKAKETGCNEALNSADI-DLPKWI-EDNLGRENLKIIFDCVGIEQTLDTAINIARKGSQIIMVGVPPPTEIPVNMAFVQDRELEIIGSLQYIDKDYIRAINFINDGRLT---VEPLITHVLPLGE-YEKGFELAGSQQSGRMKVMLE........ 346
313 0.000e+00UniRef50_A0A135VVB1 Uncharacterized protein n=3 Tax=Archaea TaxID=2157 RepID=A0A135VVB1_9ARCH  ali  30  1MKAAVYEGANDIQ-VKEVPEPQI-GPADVLVKPKYVGICGTDLSAWEYGM--------------YEGGLIMGHEFTGEVVDVGENVSKWKKGDRVVPNSLIPC--------------AKCSFCSRKKHSLCEDMQMVGIS-INGGLAELVALPETVLHRLPDSLDYKTGVFVEPLSIVVRGFSRTSFAPGENVLVLGTGPIGLLSIRLARIKGASAIYASEIKRARLEMAERLGIDAGINAKE-EAVSLRVESFTNG-MGVDLVVECTGAPGPTAEAFQLVKRGGTILVLGI-SEEPVEADFMTGVLNELNVQFSY-LGFAEFPEAIALLESRRI---DPTPFITKVIPLDQVVEEGFEALTHPDSNEVKVLVE........ 336
314 0.000e+00UniRef50_E3KZ19 L-iditol 2-dehydrogenase n=28 Tax=Eukaryota TaxID=2759 RepID=E3KZ19_PUCGT  ali  25  53..ACCYNDKKQIHMVKK-PMPKV-HPGQVLLHIRATGICGSDVHFWKHSRVGEKMVVRDECGA--------GHESAGEVVELGEGVTDLQIGDRVAIEAGVPC------------SKPTCEKCRTGCYNACPQMIFFSTPPFHGLLTRYHAHPACWVHKIPAHITFEEGSLLEPLAVALAGIERANVRLGDPALVCGAGPIGLVTLLACRAAGACPLVITDLSEARLNFAKRLVPSVTIKPGTSEEVAAEVQKI--MQCKPTVALECTGFESSITVAIYSVGFGGKVFVIGV-GKDKVTLPFSHMSENEIDLQFQFRY-ANQYPKAVRLISDGVI---DVKPLVTHRFQLDKAVD-AFTTSCDITSGSIKVQIT........ 398
315 0.000e+00UniRef50_A0A1Q9NNA4 Putative L-threonine 3-dehydrogenase n=12 Tax=root TaxID=1 RepID=A0A1Q9NNA4_9ARCH  ali  27  7MKAAMYYGIGDVRY-EEVDIPEI-GPGELLIKVGTALTCGTDVKTYKRGHPVLIK----------QIPSLFGHEYAGTIEAVGEGVEDFKVGMRVVATNSAPCGD--------------CFYCKRDMPNLCTWLK---DNLVNGAFAEYIKVPEWNTHQIPDSLSFRDAALTEPLACVVHGIEESNIRLGDTVVVIGAGPIGQMLIMLAKKNGASTVIASDLAELRRDIALKAGADIVIDPSK-EDPVERVKQETAGR-GADVVIEAVGIRQTWEQAVDMTRDAGTTVLFGGAASGTQELDTGRFHYGQLTIKGVFHLKPKHVERALKLIIAGDVNTDL---LITHEMPVEK-IGEALEMM--GAGKTMKISIT........ 348
316 0.000e+00UniRef50_A0A1B8ELQ4 Uncharacterized protein n=17 Tax=Dikarya TaxID=451864 RepID=A0A1B8ELQ4_9PEZI  ali  27  8.KVLMLHGCKDLRL-ETRSI-QSPLPNEVQIAVHSTGICGSDLHYYSDFR---------NGAFAVLAPLCLGHESAGTVTIIGSSVTTLSVGDRVALEVGMACG--------------TCELCRGGRYNICEEMLFKSSPHADGTLAELINHPADLCHRIPENVTFDQAALIEPLSVSIHGVNRSKAPAGGKTLVFGAGAIGLLTAAVLRAHDMSEVVVADIDSARLTIAKDLGATKTFLIKDAQNLAAKIAEIA-GVRGFDRVYECTGVPSCVQTGIYASKPGGKLVLIGM-GSAVQTLPLGAAALREVDIIGVFRY-ANTYPTAITLISSGKLPR--IHELVTHKRSLDKA-EEAFILAKNGRDEEGNVVLK........ 367
317 0.000e+00UniRef50_A0A2H5Y9A8 Starvation-sensing protein RspB n=2 Tax=Bacteria TaxID=2 RepID=A0A2H5Y9A8_9BACT  ali  26  7MLAVVKEHYGPGFSLRSVPIP-VPPPGWVRVRVRAVGICGSDLPIFEGIRP-------------VPLPLIPGHETVGEVEALGEGVEGWAVGDRVAVDMVVACG--------------RCRFCRIGRPTLCERLMELGIHT-HGGFAEYMIAPARNLHRLPEPLTWEEGTAADPLASAYHGMRMAGPLDGATVAVFGTGAIGLYAIQLARHLGAWRILAVGRREAPLQQARELGADEGI-SIQRENPVEGIRART-GGLGADIVIEATGAPEIFPQVIEAAAPGGRILILGVF-HEPTHLDAGRLVRKELQLWGSLCYTWDEYEYCLQLLAERRI-----RPLISHVFPLQE-MGTALALL--HRREALKIVIRPN...... 342
318 0.000e+00UniRef50_A0A1C5PWN0 Sorbitol dehydrogenase n=10 Tax=Bacteria TaxID=2 RepID=A0A1C5PWN0_9CLOT  ali  29  1MKAARFYERGKIVIDESVKEPE---EYEVLIKIRYCGVCGTDVHIFNG----------EKGSAKVNPPVILGHELSGDVEKVGSKVSGIKPGDRVSVDPNTYCG--------------KCYFCANGKKHLCTDMKGLGT-AVDGAFAEYITVPEESVYPIAENVSYEEAAMTEPISCCLHGFDLTDVKMGDTVMVVGTGNIGLIMVQLARNAGADKIIAVEPNETRRKKALELGASFGIDPLH--DNTEEILKEHK-IVNIDKVIDCAGRISTAEYAVRYAGKGAIVMLFGLTGPDDMNLKPFEVFQKELTIKGSFV-NPDTFERAGRLLGTGAIKAD---KIISDIIPLGD-IQRVFEERLYAKDG--KVLIKCD...... 340
319 0.000e+00UniRef50_A0A284QYL6 Uncharacterized protein n=1 Tax=Armillaria ostoyae TaxID=47428 RepID=A0A284QYL6_9AGAR  ali  26  8.KACMLLKANTVEI-RDAPIAEV-GKDDVLIRVEATGICGSDLHNYSHGGV---------GKDLIKEPLILGHESAGVVVEVGSAVTDVAVGDRVAIEPTMFC--------------RKCHNCKTGKTNVCRNFRQASLSPTQGTLCQYYVCDADFAVKIPASISWEQAGCIQPLAVAIQLAKRAKFGAGQTVAVFGCGPLGCLVMATARAYGVSKILAFDISQKRVDFAKKLWADYAVLSAQGQDYSEALKEAGVDSWGVDISVEASGAEACMLAGMTFVHSGGTYVQAGL-GRAINSFPTFQIVAKELDVIGSVRYTAGCFKTAIDLMESGKI---DLEPMITAVFPLSRS-KEALEAV--RKGDDLKVII......... 358
320 0.000e+00UniRef50_A8RW25 Uncharacterized protein n=3 Tax=Lachnoclostridium TaxID=1506553 RepID=A8RW25_CLOBW  ali  26  1MKAAFLVDKQRLELM-DCDMPSV-SDTDVLVEVAHVGICGSDMHIFEDPHYAVKD---------IKLPVVLGHECAGRVAAVGKSVKGIIPGDRVALEPGVPCG--------------SCEFCMGGRYNLCPDVRFLGAPWLNGAFSRYVSHPARWTFRLPDAMDTVEGALLEPLVVGMHAVDRANLRTGQSVLILGAGCIGLMTLEACLARGITNVTMSDLYENRLDMAGTIGARHVVNSSE-EDIISRSAQITANR-GYDVIFETAGSQKTAALTADLVKRGGKIVMVGVFGETP--FNFFKTNSKEADILGVFRY-RNLYPAAIELCSEGQ---AEPKKIVTNYFEFEK-IQAAMEYAITQKQEAVKTVIRM....... 345
321 0.000e+00UniRef50_A0A1C6HBZ7 Sorbitol dehydrogenase n=41 Tax=Bacteria TaxID=2 RepID=A0A1C6HBZ7_9CLOT  ali  28  1MKALVLTAYNELQL-KEVPKP-VPAEDEVLVHIKACAICGSDVHGYDGG------------SGRRQPPIIMGHEAAGVIEQVGRAVKGFAVGDRVTFDSTVFCGN--------------CWYCRHGMINLCENRMVLGVSTNAGAMAEYAAIKARTLFRIPDAVSFEQAAMVEPLSIAVHAVSVAPIRMGDRAVVIGAGTIGLLLTQAVRNAGVTELVVVDLDDRKLELAKALGATHVIHSGR-EDAAAEIRALC-GGRGADIAFEAVGISQTLNTAIDSVRLGGSVVMVGNVARK-AELPLQKCVTQQITLYGS-CASSGEYDICLDLIAHRMV---DVDSLISAAVPLADGAE-WFDRLHAAEPGLIKVVLQP....... 344
322 0.000e+00UniRef50_A0A0Q3TGN8 Alcohol dehydrogenase n=11 Tax=Bacillales TaxID=1385 RepID=A0A0Q3TGN8_9BACI  ali  28  1MKAVQVRKAHEL-IINEIEKPQIVHTTDVLVKVKRVGICGSDMHIYHGTNPL------------ATLPRVIGHEVAGEVVEVGEDVKGIKVGDHVVVEPIRYCGE--------------CYACRKGRPNVCEKLSVFGVH-EDGGMREWFVLPEKQLHVVDSSLPWEEVVLAEPYTIGAQAIWRGGVEEGETVLIQGAGPIGICVLKLAKLMGAT-VMITDLNEERLAFAKENGADVIVNAG-SEDVRKRVEEWTNG-EGANVVMDAVCLPMTFELGIDVVSPAGRVVVLG-FDERKAAISQLPITKGEVTIVGS-RLQTYQFPKVVKLLNEGKLRHNG---LVTHTYKLED-VQEAFDFIEKHPEQVRKALIEFE...... 339
323 0.000e+00UniRef50_A0A0G3SGF2 Alcohol dehydrogenase n=34 Tax=Bacteria TaxID=2 RepID=A0A0G3SGF2_KLEOX  ali  26  5.KAILKT-PGTMKIIADIPVPK---EHEVLIKIEYVGICGSDIHGFESGPFIPPKDPNQEIG--------LGHECAGTVVAVGKRVSKFNPGDRVNIEPGVPCGH--------------CRYCLEGKYNICPDVDFMATQPYRGALTHYLCHPESFTYKLPDNMDTLEGALVEPAAVGMHAAMLANVKPGKKIVILGAGCIGLMTLQACLCLGASDIAVVDVLEKRLAMAEQLGAKVVINGAK-EDTVGRCQQ-FSGDMGADVVFETAGSAITVKQAPYLVMRGGKIMIVGTVPGDSA-INFLKI-NREVSIQTVFRY-ANRYPVTIEAISSGRF---DVKSMVTHIYDFED-VQRAFNESVNDKREIIKGVIKVN...... 346
324 0.000e+00UniRef50_A0A2A5NZS1 Zinc-binding dehydrogenase n=1 Tax=Candidatus Geothermarchaeota archaeon ex4572_27 TaxID=2012530 RepID=A0A2A5NZS1_9ARCH  ali  29  1MRAAVFYGPNQPLKVEEYPTPK-PGPGEALVKVAACGVCHTDLHYLKGVPTFK------------KPPMILGHEISGTVAEVGEGVTEVKPGDRVLVPAIIPCG--------------KCYYCRTGRENICLNLLMVG-NHIDGGYAEYVKVPAKDLIKLPDEIPLQEGAVISPYA-AV--VRRAELKPGETVAVWGAGGLGLNTVQIAAALG-GKVIALGRREENLKLAKQLGAWETINLKEDKEPVRTIRRLTGG--GVDVAFDCTGVPQVIEQAFESVRQGGRLIIIG-YSDKPITINAGRIMFRELEIRGVMGCRPIDYYGAIELVRTGRIKL-----LVSHKLPLEQ-INEAFKLLEEGK--VTRAIVTP....... 338
325 0.000e+00UniRef50_A0A2D5VAX6 Uncharacterized protein n=1 Tax=Deltaproteobacteria bacterium TaxID=2026735 RepID=A0A2D5VAX6_9DELT  ali  28  9MKAIVKTKAEPGIDVIEMEVPAV-GENDILLKVNAVGVCGSDVHIYEW----------TTGYEWLPMPLVIGHEFAGEVVEIGGNVKGVAKGDRITALPGFACGE--------------CEFCQMGRVKDCKNHQVLGL-RHNGAFSEYMRIKGTAILKIPDNVSDEIAALIEPLAVCLRGFDLSGIKPGQSAAVFGPGPIGLLMIQLLKAAGAGQIIVTGTSADRFEIAKQLGADVIIDVSK-EDPVKRIKEIAGSL---DFVFEATGISRTISQGLQMLHWGGKVIVIGIHAENT-TFDTIDLVRQQKSIIGVYGYDSNIWRRCLALMSSGKV---DLSPVITHQFSFSQGIE-GFELASNKT--AAKVIFGPEK..... 351
326 0.000e+00UniRef50_A0A1C6F3L8 L-threonine 3-dehydrogenase n=2 Tax=Clostridiales TaxID=186802 RepID=A0A1C6F3L8_9CLOT  ali  28  1MKAVVNYGAKKVRLMEV--EPPLPQAGQVRIRVSYCGICGTDIHIFSG-----------DGGYPTNPPVTMGHELSGVVESVGAGVDPAWIGQRVVSETYYTCGI--------------CPYCQTGHKNLCPEKQSIG-SAVNGAMAELVVVPAKNLHRIPQGVSMEEAAMTEPLACCAQGVEFGGLRPGDKVLITGPGAIGLMCLQLAASAGARVVIATQVDAERLELAKELGACAAVFSDRP-DAEDRIAALCP-PYGPDVVFDCSGAGPAIQMGLRAVRKGGRYVQVGLTG-KPTTLDMNLITLKELTVYGTYAQKTEWWIRSLELLGQKKIS---LKPLISNIYRLED-WEQAFD....................... 329
327 0.000e+00UniRef50_A0A1A9W1K6 Uncharacterized protein n=1 Tax=Glossina brevipalpis TaxID=37001 RepID=A0A1A9W1K6_9MUSC  ali  24  59...AVLYDINDLRL-EQRPIPEI-GPKDILLAVDCVGICRTDVEYWQKGR---------AGPYVIEEPMILGREASGIVVETGEKVQQLRKGDRVAVEPGESCRH--------------CQLCRSGQYNLCPYIKFCATPPNDGLLTRYAKHPAHLCYKLPDHVTMEEGALLEPLAVGMASCRRAKVGLGSDVLILGCGPVGLTTLATATSIGASKVLIADKKPDRLEIAKTFGAD-VMHIKQDCNPRELAQEIHAMGCVPNKCFDCVGTIESLKLAIYATRPGGMCTLVGVPDGKIV-LPLMDAMSREVDILGVVNY-RNDYPIALAMAAS---VELNLPAIISHHFPLE-HISVAFETAKVQAEHTLKVIVHLQPEN... 403
328 0.000e+00UniRef50_A0A1X6W5H1 Sorbitol dehydrogenase n=2 Tax=Bacteria TaxID=2 RepID=A0A1X6W5H1_CHLAO  ali  29  1MIQAIMTEPGKIEFN-NVPVPEV-KPNQIKIKMKSIGVCGSDIHVNHGKHPYT------------SYPVVQGHEVSAEVVEVGSEVTNVKVGDKVTIQPQVVCGE--------------CYPCTHGLYNDCEELKVMGFQTT--GMAEYFVVDADKALALPADMSWEHGALIEPLAVAVHAVRRAGDIAGKKIVVLGGGPIGNLVAQTAKAMGAADVLISELSPYRLEVAQKCGI-KTIDA-KNENILESIIANF-GKDRADYIFECIGINVTINQAIEYARKGSTIVVVGVFG-DLATVNMGYVQDHELSLLGSAMYREEDFIKAIELVNEGLIEFD---TLITHRVKFRD-YSEAYDIIDQQKDKAMKVMIEME...... 339
329 0.000e+00UniRef50_A0A212QMH0 L-threonine 3-dehydrogenase n=5 Tax=Bacteria TaxID=2 RepID=A0A212QMH0_9CHLR  ali  26  5MRAVVKAAPGPGLTMAQRPIPT-PGPGEILVNVKAASICGTDLHIYR---------WDPWAQGRIRPPLIIGHEFCGEVVETGPEVDGIRVGDFISAESHVVCG--------------RCDMCRTGKGHLCRNTRILGVDR-DGAFADFIVIPAENAWVNPPDLPLEVAVLLENFGNAVHTAFAVDLRA-RKVLVTGCGPVGLMTIAVARAIGARMIIATDISPYRLELARRMGADHVLNPQEI-DVVEAIRDLAGGE--VDVLLEMSGAPSAIREGFAVLKPGGQAALLGLPPG-PIEFDLNMVIFKGVTVHGIVRRLWETWYEIRGLLNSGAV---DLRPVVTHRFRLEE-FDQAFATMASGRSG--KVMLIP....... 345
330 0.000e+00UniRef50_W9ZP70 Uncharacterized protein n=5 Tax=Herpotrichiellaceae TaxID=43219 RepID=W9ZP70_9EURO  ali  37  1MRALRYHGVKDLRVDYDIPEPT-CGEHQIKIK----------LHEYSS-PTFIPLKDSPHPVTKESMPVTIGHEFSGEVVEIGSKAKGLKVGDKVAAQPTVCC--------------HSCGPCKEGYINCCDHAGFVGLSGGGGGMSDYVCIDEQFVYKLPDNVPLDIGALVEPLAVAWHGVNQSPLKEGQSALVMGAGPIGLGVIQCLKARGAKDIIVVELAKERQNFAQQFGATHIIDP-RYEDVVKRCKEICDG-QGPHVALDAAGVAATLKSAALAVRARGTIVNLAIW-EKEVPFQPNTLVFGEKKYLGVLGYVNEDFEGVIKALGEKRLQP---EKMITRKIHIDRVAEDGFRALIEEKDKQVKILVDCR...... 347
331 0.000e+00UniRef50_A0A1V6BHL6 Sorbitol dehydrogenase n=5 Tax=Bacteria TaxID=2 RepID=A0A1V6BHL6_9BACT  ali  26  1MKAVVLTGIKKMEL-RNVPDPVIKNPVDVKIKMSVAGICGSDIHYYTWGNI---------GSQVVKYPFTVGHEGSGVIVETGPAVKHLKPGDKVAIDPAMPCFE--------------CDQCLSGRSHTCRKLKFLGCPEAEGLLSEYIVIPETSCIKLPDNLTLDQGALSEPLSIGLYSVRKSGDIKGKNIGILGFGPIGMSVFLTARAEGAKAVYVTDKLPDRLAVAAREGATWTGNPLK-DDVVSEINKR--EPLGLDVVFECCGQQEAVDQAVEIMKPGGKIIVVGIPDLENWLIKVDRTRRYENTILFIRRQV-DSVEPVVEMMKSGRINTIN---MVTHRFPLEKTGE-AFDFVADYRDGVMKAVID........ 343
332 0.000e+00UniRef50_A0A0V8JSJ2 L-threonine 3-dehydrogenase n=11 Tax=Bacteria TaxID=2 RepID=A0A0V8JSJ2_9BACI  ali  30  5MKALVKDKRGFGAVLAEVDIPSI-ADDEVLIKVKATSICGTDVHIYK---------WDKWASSRVNPPYVFGHEFSGEVVQIGQNVAGVQIGDSVSAETHIVCG--------------RCMQCLLGNAHICQKTKIIGVDRM-GCFAEYVAVPAQNIWKNPNHLSHDVACLQEPLGNAVHTV-LNDSIAGKSVLVIGCGPIGLMTVAVAKASGASLVIAMDVNEYRLSLAKDLGTHIVLNPLE-QDPLEVINKLTSGN-GIDVVCEMSGQPTAMNQGFKMVANGGRVSILSL-PTTPVSIDVNDIVFKGVTVQGITGRMFSTWYTVSNLLAGNQL---NMNELITHRLPLED-YEKGFELMMEGK--CGKVVF......... 344
333 0.000e+00UniRef50_A0A0M0BFJ1 Uncharacterized protein n=2 Tax=unclassified Candidatus Bathyarchaeota TaxID=1700837 RepID=A0A0M0BFJ1_9ARCH  ali  27  1MKAVVKRVPKSGIEITDVEDPKV-GSRDVLVKIKAAAYCGSDIHLYKWDEQAIKGNWA--------LPTIVGHEFCGDVIEIGDKVTRLNPGDIIAGETHIPC--------------EQCYFCKTGRMHICENLKVFGVHTYEGSFAEYAVIPEIIAYKLPEGTSHEEGALYEPCGVAMHAVQRTHPKPGDTAVVLGCGPIGIFIQQIMNALG-SKVVATDIKPYRIEIAKKIGAARVINAAE-EDVEERVKSVL-GKRGPDIVFEAAGSINTIKQSLEIVAKCGKVVLFGACPENP-TLDTTSIVYKEIDVLGVFRYMFDTWYRVQRLVSDRKI---DLTSVITHNFPLEKA-EEGFQLIM--KGEASKVILTP....... 345
334 0.000e+00UniRef50_X1FGQ4 Uncharacterized protein n=2 Tax=marine sediment metagenome TaxID=412755 RepID=X1FGQ4_9ZZZZ  ali  28  5MMAAVLHAPGDLR-CEEVEVPEI-GPNDVLLKVKAAGNCGSDL-------------QRIMVEGTHVFPCIPGHEFSGEIAKIGEKATSFKVGDRVTAYPLIPCM--------------RCEWCLQGQYNLCEDYDYLG-SRSHGAFAEYVKIPVVNLVRLPKEVDFDEGAMTDPACVALHGIKRAGIRPGQSVVILGTGPIGMLACQWAVAMGAGKVVAVDIIEDKLKIARELGVDVCINA-EKEDVVEKVMEETKGK-GADVVMETAGSTATQRQSLLIARKRAKVILIGVLLSDEV---FTRIFRRELEVYGAFSPLDNEWKISVQFMAARAIKA---KPLISHRVKLEDIAET-FKKMYEGKMIYNKIIFSP....... 350
335 0.000e+00UniRef50_A0A2M7S7N6 Uncharacterized protein n=1 Tax=Candidatus Desantisbacteria bacterium CG_4_10_14_0_8_um_filter_48_22 TaxID=1974543 RepID=A0A2M7S7  ali  28  10.QAVVFEAPGKINI-KDIPEPQA-GKEDILVKVKAAGLCGTDLHVYKG-------------DFIASYPIVPGHEFSGEIISAGADVEGFKPGDRVCVDPCVYCG--------------KCDFCKSDRENFCRDFRAYGLH-FNGGFEELVSVSYRNAYQIG-SLSFEEGSMIEPLSCVIHGIKRIGLRAGDEVLIFGCGPIGLMLMQVCKKSGASRVIMADVSRKKLETAERLGAGATL--LNNNSFEAGLKKLF--PFGADVVIDATGIPQVVQNMSAHVKDAGKLLFFGVCPPDRISINPYEVYKRELTIYGTFSLL-HDFPSAIKLLQSGSI---DVRSLASHQFSLSEFMQ-GFNLMLEH-GDFLKILIKP....... 343
336 0.000e+00UniRef50_A0A2U3EFU7 L-arabinitol 4-dehydrogenase n=2 Tax=Purpureocillium lilacinum TaxID=33203 RepID=A0A2U3EFU7_9HYPO  ali  26  29....VYTNPHDLWIAESVKSGADLKPGEVTVAIRSTGICGSDVHFWHAGCIGPMIVEGDH---------ILGHESAGDIIAVHPSVKHLKVGDRVAVEPNVIC--------------NACEPCLTGRYNGCENVAFLSTPPVPGLLRRYVNHPAVWCHKIG-NMSYENGSLLEPLSVALAGMQRANIQLGDPVLVCGAGPIGLVTLLCCAAAGACPLVVTDISESRLAFAKELCPRVITHKVEKMSAEESAKAIVQSFGGVEITMECTGVESSIASAIWATKFGGKVFIIGV-GKNEINIPFMRASVREVDIQLQYRYC-NTWPRAIRLVESGVI---DLTRLVTHRFKLEDAL-KAFETSADPKSGAIKIM.......... 375
337 0.000e+00UniRef50_A0A1A9W1K4 Uncharacterized protein n=6 Tax=Glossina TaxID=44049 RepID=A0A1A9W1K4_9MUSC  ali  26  45..AVVLHGKQDLKL-ETKPIAKI-GPKEVLLAMDCVGICGTDVHFWQEGRIGPD---------VVKAPVILGHEASGVVCEIGKKVKSLQVGDRVAIEPGKHCRD--------------CEVCRKGRYNLCPFMKFHSCPPIDGLLQRYFKQDADMCFKLPDHLTMEEGALCEPLNVGVAAARMAKVKLNSKVLIVAAGPVGIATAIVCQAIGASKIMVIDKKKDRLEMAKGFGMTMALEGDDGKDFNKTAKKIHEMGCIPDKVIDCYGSQESFKLSIRSTGWGGTCCLVGMASGNFTNFPLMDDVMREVLITANFRYC-NDYPPAIAIAAQSK---YDLLKMISHHFDIEDAL-CAFETAHKQEEGTMKVMVHPRDTNNKK 398
338