current user: public

If you have questions about the server, please let us know.

Query: gi|6319259|ref|NP_009342.1| Protein of unknown function, localized in the nucleoplasm and the nucleolus, genetically interacts with MTR2 in 60S ribosomal protein subunit export; Ecm1p (YAL059W) [Saccharomyces cerevisiae], from S.cerevisiae

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210
# E-value Template Links and tools%idFirst MWEQRRQKVVFSLTILVRYRLKQSMAKKISKNSRAARQSDALEPEVKDLSELPRAEKTDLTNILIRTAAKNEALLEAKISKKANKSKRGKKLNKKALEDKLDNSISSMDRDRLVKALNFTNRLDGKIAKSISRAKYIQNTRKAGWDSTNETIKKELAFLNGGLSVQAKSASEGNAEKEDEEIPEVFDSLAEDNTVQKTPTNRFGVLPDDVEELast
1 3.000e-41UniRef50_P39715 Shuttling pre-60S factor ECM1 n=27 Tax=Saccharomycetaceae TaxID=4893 RepID=ECM1_YEAST  ali  99  1MWEQRRQKVVFSLTILVRYRLKQSMAKKISKNSRAARQSDALEPEVKDLSELPRAEKTDLTNILIRTAAKNEALLEAKISKKANKSKRGKKLNKKALEDKLANSISSMDRDRLVKALNFTNRLDGKIAKSISRAKYIQNTRKAGWDSTNETIKKELAFLNGGLSVQAKSASEGNAEKEDEEIPEVFDSLAEDNTVQKTPTNRFGVLPDDVEE 212
2 2.000e-30UniRef50_A0A151GUR4 Uncharacterized protein n=1 Tax=Drechmeria coniospora TaxID=98403 RepID=A0A151GUR4_9HYPO  ali  20  613.............................SKHSRAARRATSPGINTKSLKDVDLPSSTAVG---IPSSARPSIL-------AVHGSAGVQKKSKPVRKGRLSAKARRRHERGLEMAEAVTERTGKKIKRSFERARNIQS-RAKTWEEVNRVAEEAEEQRNAFAALDDDEHGGQEEDGDDKGWATDEDSSGSTSKAAEDAQPIPAGRDDDDDE 797
3 7.000e-23UniRef50_A0A094K4V6 Uncharacterized protein n=4 Tax=Pseudogymnoascus TaxID=78156 RepID=A0A094K4V6_9PEZI  ali  17  1...............MAKSAPPK-KKSITSVRSRAAKRASSPSIDTKSLKDAKPPSEEKTPAVL-----------------GIHHGAGITKKSKHGRKAVLSARAKRRQEISMDRAEAAMDKKSTKIEKSKDRARTIQS-RSKTWDEQNRRMLARKELEAAIAVEREQGGDWVDESGDDEVEE............................. 150
4 1.000e-20UniRef50_C5M2L8 Uncharacterized protein n=13 Tax=Saccharomycetales TaxID=4892 RepID=C5M2L8_CANTT  ali  35  30.......EICFCLFFLSKYNLHHSMAKKISKHSRAARRGAESSAEVKSLESLPR-ENSGVKKSIIRTTIKNENLLNKKLE--------------KNRIKKTNKKKTSALKHKLERSGRLSGVLEAKIEKSIARAKYVQNARKSGWDKINQGI-----TINSTDAKKPTSKDDDDDEDIMEEEEEEEEITDITLEIKDDNRFRALQLDEEDDE 219
5 2.000e-20UniRef50_G0WF16 Uncharacterized protein n=1 Tax=Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) TaxID=1  ali  44  61...................RRGKEVIKEIQETARQAESSLIP--ITKDLENITRAEDTNLTNILIRTAAKNERLLEAKLKKKEQKKSNNNNNRINKEAKLSQASITSMDKERLERALHFTNRLDGKIAKSISRAKFVQSTRKAGWESTNESIKRDLISQAGLVTKDKNDDIEKDIENANKVALENEEGEEKTIIVDQKPKNLFDLLPSEIEE 268
6 4.000e-20UniRef50_E7NEG1 Ecm1p n=3 Tax=Saccharomyces cerevisiae TaxID=4932 RepID=E7NEG1_YEASO  ali  96  1........................MAKKISKNSRAARQSDALEPEVKDLSELSRAEKTDLTNILIRTAAKNEALLEAKISKKANKSKRGKKLNKKALEDKLANSISSMDRDRLVKALNFTNRLDGKIAKSISRAKYIQNTRKAGWDSTNETIKKXAG....................................................... 133
7 6.000e-20UniRef50_A0A286UBB4 Uncharacterized protein n=1 Tax=Phellinus noxius TaxID=418867 RepID=A0A286UBB4_9HOMO  ali  18  30...........SLKSLTPNPTGFPLAQHRSKRSREARRKDSGTNESDRVNDVPVVQKSGSLLSSASGPIEGKEVLRTPENDGQNKTSSSKKTSEEQWKLQMQKSNERMVEERAQHAEEIMEQLGPNIKELLQR---VREARAKPQDAKNSNGDSEETPKKTKDTSVSTEDDKDLVIGSPATSENHEDSPPVELSQ-PTPNQLFNL....... 235
8 6.000e-20UniRef50_S6EJI7 ZYBA0S07-06018g1_1 n=3 Tax=Zygosaccharomyces TaxID=4953 RepID=S6EJI7_ZYGB2  ali  52  1........................MAKKVSRNSRAARQAAAFEPEAKSLANLPRNTKTDLSNVITRTAAKNEALLEAKIHKKGKKKVDKKKFKEHALDK-----LGNLDRNRVEKALNFSSRLDGKIAKSTSRAKYIQSIRKAGWDTTNELIKKEQALLQSESYPKKREENQDEGSGDEMETETPEDELVDPKPEQEKRINIFDMLPNDDE. 184
9 3.000e-19UniRef50_J7RZL8 Uncharacterized protein n=1 Tax=Kazachstania naganishii (strain ATCC MYA-139 / BCRC 22969 / CBS 8797 / CCRC 22969 / KCTC 17520 / NBRC  ali  47  1........................MRKPVSRNSRAARQAAYDDPNVDTLADVPRAEKTDLSNVVIRAAAKNEALLDAKINK-RRRGDRKNRVGKKFLEERLAASATSSDKGRLERALNITNRLDGKISRSISRAKYVQASRKAGWDMTNDNIRREAQRAVADKAAEATEESTEAEAGADEETAETFKSESQQRPNAQQ-TNLFALLPDVTDD 194
10 8.000e-19UniRef50_A0A1X7QZA8 Similar to Saccharomyces cerevisiae YAL059W ECM1 Pre-ribosomal factor involved in 60S ribosomal protein subunit export n=1 Tax=Ka  ali  54  1........................MAKKISKHSRAARRSEEIDSGVKDLESLPRAEKTDLSNILIRTAAKNEALLDAKIQKKQDRKKFREKYTKKTLEKKLQEALNNDDKERLEHALNITNRLDGKVSRSIARAKYVQSSRKANWDQTNEIIKRKL----NNASILDKAQTKKNNNEDEELDDEPFDEEDEKKIQKNTPQNMFGLLNTDVEE 186
11 1.000e-18UniRef50_G8BWR1 Uncharacterized protein n=1 Tax=Tetrapisispora phaffii (strain ATCC 24235 / CBS 4417 / NBRC 1672 / NRRL Y-8282 / UCD 70-5) TaxID=1071  ali  50  1........................MAKKIGKNSRAARQAAALEPESKSLSELPRVENTNLSNILIRVSAKNEALLDAKIGKKKQTKG-KSKATKKLLEQRINDSITSIDKDRLERALHITNKLDGKISKSISRAKYVQTTRKQGWDSINNAVRRELNPVAAEKKLDLENEDKMQDSEIAAEDAEGWDEERNEKKVADQNKNMFDLLPLMEDE 203
12 4.000e-18UniRef50_N4VFJ7 Microfibril-associated protein n=2 Tax=Colletotrichum TaxID=5455 RepID=N4VFJ7_COLOR  ali  20  9........................KSRQPSVHSRAARRATDVDIDTKSLKNVKAPSDTTDHRPSVLAAQHNSGV----------------SKKSKNRKSQLSAKAKKRQERGADRAAAIMERTANKIEKSKNQSKSIQ-ARSKGWEEVNKQAPAKKFPDEEDLEQEERKGRKQIVADKDWETDEEMDG........................ 156
13 6.000e-18UniRef50_M2SCZ1 Uncharacterized protein n=8 Tax=Pleosporales TaxID=92860 RepID=M2SCZ1_COCSN  ali  14  3...................KTAKVKKRQVTIHSRAARRAASPSLDLPKSAQKPAHTTRDSASPSRPSSVNPHALAAKDAGIQKRQKKGTN----------MTRAQRLRHQKGLERAEENMDKLANKRLKSLGKGRKV-TERAKGWEDVNGEGAKKVKKGGVLGDSEDVELKRGEREWGGDEDMDEAGEVKGEVKEVDVAVAQSVAVPEEVDE 184
14 9.000e-18UniRef50_C7Z3Y4 Uncharacterized protein n=34 Tax=Hypocreomycetidae TaxID=222543 RepID=C7Z3Y4_NECH7  ali  18  2.......................AKKRAPSIHSRAARRATSPSIDAKSLKDVKPPPRSAPHRPSVLAAQHSAGV-----------------SKKSKRKTAMSAKARRRHEKGLEMAEAVIERTKSKVEKSKGRGRNIH-LRSKAWEEINKVA-------ATEGEVEGDEVEKRNGGVELDEDMGGADEETLTAPVVPDAAPAAVPLPVDDDD 166
15 1.000e-17UniRef50_A0A1A0HH40 Uncharacterized protein n=1 Tax=Metschnikowia bicuspidata var. bicuspidata NRRL YB-4993 TaxID=869754 RepID=A0A1A0HH40_9ASCO  ali  33  1........................MAKKVSKHSRAARRGEIDGGEAKALENLPRDENDDVRKHIIRTTIKNENLLAKKMELEKVKKKGNKK-------------LSHTFKHKTEKNSRLEGVLAGKIQQSIEKARYVQTARKSGWDQINKSIRTDLTEAPAEKAGEAVSEKEAQQKEEDEYVKLFFGDDEAPVAKPKPSGNIFDMLEETD.. 185
16 3.000e-17UniRef50_A0A1G4IT06 LAME_0B00452g1_1 n=6 Tax=Lachancea TaxID=300275 RepID=A0A1G4IT06_9SACH  ali  44  1........................MGKKVSKNSRASRRFEALDTEAQTLAQLPRAQDLDVTNKLIRTASKNEQLLEAKMRKK------DKTSNKVGKKTIKKSALENLDSERVARALNISSRLDGKVEKAKTRAKYVQSARKAGWESTNESIRRDLAKLTEREGSVPEAATQSGSSGDQEVDSMVEDDPAEEIEQNPQAENMFGLLADDVE. 186
17 5.000e-17UniRef50_B2B5N0 Podospora anserina S mat+ genomic DNA chromosome 2, supercontig 2 n=1 Tax=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FG  ali  24  104............................PSKHSRASRREEPIDINTKSLKSLPPPISTDHHRPAVLAAQLASSV--------------SKPTRKTGRKAQLSSKARKRQERSMDMAEAVMERTITKIEKSKGHAKVI-NTRRKPWEEINNDVFGEGEKAKKL------TKKQLEKQREDEIVRKFFDEGAAEKDED................ 252
18 6.000e-17UniRef50_A0A1L0D9Y2 CIC11C00000003727 n=5 Tax=Clavispora TaxID=36910 RepID=A0A1L0D9Y2_9ASCO  ali  28  20...........................PVSKHSRAARRGESTDGEAKLLERIAKSENNDVKKSIIRTTIKNENLLARKMELDKVRKRGNKKNN-------------NAIKHKNDRGIKVEGVLATKIQQSIERARFVQNARKSGWEQINKSID--ISAKVEQFDKPEKTQAQIEKEEEDEYVKQFYTDAGNXXXXXXXXXNVFALLEETE.. 196
19 8.000e-17UniRef50_A0A179GEU2 Alb1 domain-containing protein n=3 Tax=Purpureocillium lilacinum TaxID=33203 RepID=A0A179GEU2_9HYPO  ali  26  2.......................AKSKPPSKHSRAARRATSPSINTKSLKAVSLPTSSSTTAHESTGATSNTNKNRPSVLAVHRAAGVSKKTSKPARKSRMTAKMRRRHERGLEMAEAVTERTGLKIEKSIGRARAVQ-ARSKGWDDINARAGDE......................................................... 137
20 1.000e-16UniRef50_A0A1E3P2P7 Uncharacterized protein n=5 Tax=Phaffomycetaceae TaxID=115784 RepID=A0A1E3P2P7_WICAO  ali  38  1........................MAKKVSKHSRAARRNEIDEPEAKSLASLPRAEKTDLTSAIIRTTKKNEDLLNNKMLKKDVKSGQVQKKNVAK-----SNLESNLNKIRMERAIMQSDILQDKILKSKQRSKQVQLTRKQNWDAINQAANEVIRSRSGTPADNGETPEQDEQPAEDAMEEEDKDDEEESTSEYKPQRNAFDLLNDEVE. 186
21 2.000e-16UniRef50_C6HKI5 Uncharacterized protein n=1 Tax=Ajellomyces capsulatus (strain H143) TaxID=544712 RepID=C6HKI5_AJECH  ali  23  1...............MAKTAKVKAKVSSKSMHSRAAKRAVSPTNES-LLKFVPRTEPIPTVKPHILSAQHNAGI------------------TKKSKSKQITRAQRKRQEKGLERAELIMDRTEKKMAKSMGKAKVVKERR....................................................................... 107
22 2.000e-16UniRef50_A6QYN7 Uncharacterized protein n=26 Tax=Onygenales TaxID=33183 RepID=A6QYN7_AJECN  ali  23  1...............MAKTAKVKAKVSSKSMHSRAAKRAVSPTNES-LLKFVPRTEPIPTVKPHILSAQHNAGI------------------TKKSKSKQITRAQRKRQEKGLERAELIMDRTEKKIAKSMGKAKVVK-ERRSTWDDMNRKALAVPGKVVSGGDVDGAEAMDEDAEPNEARTP............................. 148
23 2.000e-16UniRef50_A0A0F4ZKV3 Uncharacterized protein n=3 Tax=Ceratocystidaceae TaxID=1028423 RepID=A0A0F4ZKV3_9PEZI  ali  15  7......................KKKNREPSQRSRAARREASPSLDAGRAVRAPAAQPKVDSRPSVLA---------------IHHGAGVSKKAKTGRKAVKTHKQRRRHERGLDRAEAVADITAKKIERSLQQEKLVRS-RKKNWDDVNKGLGAPSKKTKFGFELLGEDDGEDQSVADVVVSTNLFATIPNTEVVMDESE............ 170
24 2.000e-16UniRef50_A0A1D2VJK4 Uncharacterized protein n=1 Tax=Ascoidea rubescens DSM 1968 TaxID=1344418 RepID=A0A1D2VJK4_9ASCO  ali  29  1........................MKKKISKHSRAARREVVQTPEEKNLLNEPRKSTIDKNKLIMRATIKNEKLLQKKLENKKTSNNYMNNKISKNSCSKRTLKNTRFLKEKIIKSLKLDGKLENKVQKSIKRAKVVQNERKSNWDVINQKIKLDST----NADSKDTKTTLETNTETAEMDVELMGSDEESDADAPKPLNPFDMLQEVE.. 184
25 4.000e-16UniRef50_A0A1Y2EM67 Alb1-domain-containing protein n=5 Tax=Xylariales TaxID=37989 RepID=A0A1Y2EM67_9PEZI  ali  20  3...................KVAISKRKPLSKHSREARRATSPSIDTKSLKNVKPPPESADHRPSVLAIHSGAGV-----------------SKKQKRGRNLSTKAKKRAEKGMDKAAAVMDRTENKIAKSKGRARSIQT-RAKTWDDINSSVPKVRHTT----TEDGIDEDEDVEDVSDFDDEMGEADAAAAVVLQARNTLLTPAMEQDEDE 174
26 1.000e-15UniRef50_A0A1E3NK43 Uncharacterized protein n=3 Tax=Pichia TaxID=4919 RepID=A0A1E3NK43_9ASCO  ali  32  3.........................KKGLSKNSRAARRGDVESSEAKELASLPRLEKTDTVSPLIRSSIKNQQLLNDRMTKASREGSKGDNIVTMHNSKKKQHMVSKTIRTKTQRFQNVDGRLGRKIENALKRKKTIANLRKTGWDKINEIA---KNSLSNDLVSQIDSEKKTDTDVEEEIIDEMRDDDE---PLVVENKNPFGFLEEEE.. 188
27 2.000e-15UniRef50_A0A232LWI7 Uncharacterized protein n=1 Tax=Elaphomyces granulatus TaxID=519963 RepID=A0A232LWI7_9EURO  ali  23  1...............MTKTAKLKTNAKSKSRHSRAARREVSPSVDLKSLTSLPRPERGIAKPTSFFSSHANAGVL-----------------KKRLKPRAASRTQRLRQQRGMERAEIVTDQMEKKIAKCFGKAKTVK-VRKAAWEDLNDSHIKKTDHQTVGTQDGDAK........................................... 137
28 2.000e-15UniRef50_A0A1E4SXC8 Uncharacterized protein n=1 Tax=[Candida] arabinofermentans NRRL YB-2248 TaxID=983967 RepID=A0A1E4SXC8_9ASCO  ali  37  1........................MAKKISKHSRASRRGEEITGEERSLDNIPRAQNTDVIGSLIRSTAKNEELLRTKMERKALQKAKSDLLAKASSSSKKSSMISKAVRTKKRKFTNIDGRLSSKIEASINRAKEVQSTRKTGWDIINKSAKEAVLKQGGNKKGRKRDADEQDAMDEDGWEDISDDDHHVDEPEFETKPNAFSVLEEVE.. 196
29 3.000e-15UniRef50_A0A2B7X376 Uncharacterized protein n=1 Tax=Helicocarpus griseus UAMH5409 TaxID=1447875 RepID=A0A2B7X376_9EURO  ali  21  1...............MARTAKPKAKAGAKSIHSRAAKRAASPSLDAKSLASVPRPEPTATVKPHILSAQHNSGI------------------NKKSKPKHMTRAQKRRQEKGLERAELVMDRTEKKVAKSVGRGKTVQ-ARRATWEELNQKVLAAQSKTASTAEGMEDDADAMDEDDSKATSTRPATEAPKASTIPQKPA............ 167
30 3.000e-15UniRef50_W0TCB4 Protein ECM1 n=5 Tax=Saccharomycetaceae TaxID=4893 RepID=W0TCB4_KLUMD  ali  46  3.........................KKPISKHSRAARRSEAAEPEAKALETLPRAEKTDFAATLIRTANKNEALLEAKIQKR----GQKNKKKNAGRVSKQLIDDSSLTSRKAIRALNITSRLDGKREKAIHRAKYVQSARKAGWDTTNQSIRKELSTLQNAANTVSDSVNKSTDKEGSANTEDAMIEDDQD.................... 165
31 9.000e-15UniRef50_A0A1B2J5M0 BA75_00935T0 n=3 Tax=Komagataella TaxID=460517 RepID=A0A1B2J5M0_PICPA  ali  33  1........................MARKVSKHSRAARRGEAMDAEIKSLESIPTAQETDVANSIIRATAKNESLLSQKMNKKRGPKNKISKES--------------LSKSSRSFRVDSGGRLSTKIQHSIERFKNVQFLRKSSWDTIDKVTKEELEKLRSEGFEVVSRKRKTKAERQEDNDKEILDSMEVET................... 156
32 2.000e-14UniRef50_A0A1V2L086 Uncharacterized protein n=1 Tax=Cyberlindnera fabianii TaxID=36022 RepID=A0A1V2L086_CYBFA  ali  33  14............................VSKHSRAARRNEIEEPEAKSLASLPRAEKTDTTSAIIRTAKKNEDLLYIREDCQERRVI-------------------------IERAMQLTDRLEGKIQKSKERARQVQTARKSNWDSINALARMEQTTTGATTTSNESKEEDVDEEDAMVDDFYNDEKDQQQESSGSKAANAFALLDEVE.. 171
33 2.000e-14UniRef50_A0A2H3FPS3 Micro-fibrillar-associated protein 1 n=1 Tax=Diplocarpon rosae TaxID=946125 RepID=A0A2H3FPS3_9HELO  ali  19  8..........................KKRGVHSRAAKRASSPGIDLKSLKHLKPPQASKTKQPSILA---------------IHQGAGISKRSKNGRKAVLSAKAKKRHEKGMDRAEAVIDKKEIKIEKSKGRARIVQD-RAKNWEELNKKMLEQKAREEATALEEEKDAENWEDDEEMEEAIQVEEAPAAGSKTGKQAADSTPIPAEAEDE 180
34 3.000e-14UniRef50_A0A1E5RZT1 Shuttling pre-60S factor ECM1 n=1 Tax=Hanseniaspora osmophila TaxID=56408 RepID=A0A1E5RZT1_9ASCO  ali  43  26.................................................ADLPRAAKTDITGSLIRTASKNEDLLNRKMERKQRGKNRVGKNSSRNKDRLKNADIGLLEQEKLQKSLNFTNVLDGKISKSISRAKYVQGARKAGWDATNSRIREELQLVQGAAPQNKETSEEVDQVEQEMEPVVTFGDLEEQEKQKKLQTNSFGSLENDVE. 197
35 3.000e-14UniRef50_F7W6W4 WGS project CABT00000000 data, contig 2.36 n=15 Tax=Sordariomycetidae TaxID=222544 RepID=F7W6W4_SORMK  ali  21  8.....................KSNKAAPVRKHSRAARRQTSPGIDLKSLKGVRPPQESVNLRPTVLAAHHSSGI------------------TKKAKKKQLSSKMRKRQEKSMDRAEAIMDRTSTKKAKSLRKAAVIES-RKRTWDDVNVVALAEIGKEPPKKEKKVDLQKK--AEDEADEVEGMDENAAVESLMAATMIPAVAPTMQEDDE 178
36 3.000e-14UniRef50_W1QBR1 Uncharacterized protein n=2 Tax=Ogataea TaxID=461281 RepID=W1QBR1_OGAPD  ali  39  1........................MAKKISKHSRAARRGEISEAEARDLERVPRLEKTDTIGPMIRASAKNEDLLRQKMEKKASKSNKSKSAISKA------------IKTRRKKAVVIDGRLGSKIEASINRAKEIQSMRKANWDTINKQAKEAVKSKLLYHDNNSQTEGRKDATEDDSDWENMDEEEEESNDLV--PSNRFALLEEVE.. 175
37 1.000e-13UniRef50_A0A1Z5SUD6 Uncharacterized protein n=1 Tax=Hortaea werneckii EXF-2000 TaxID=1157616 RepID=A0A1Z5SUD6_HORWE  ali  19  67.........IVGTLTMGKVAKA-TKKREVSVHSRAARRGEEP--PSKDLAIKSAPVQSDY--------------------KPWLHNAQNAAVGKKKKSKQLSRQQXXXXXXXXXXXXXXXXXXXXXIADSKARGKRVQ-ARRKDWEELNENLGDGQKKRVGAAGEEEQVSRARVDMEDVESQGETELPANMKIAEDQAPRQ........... 234
38 1.000e-13UniRef50_A0A2N3N4B8 Uncharacterized protein n=1 Tax=Lomentospora prolificans TaxID=41688 RepID=A0A2N3N4B8_9PEZI  ali  20  43............................PSLHSRAARRATSPSIDTKSLKEIQPPSERAESRPSVLAARQGAGV----------------TKKASKRKTMLSSKARRRLEKGSDKAEAISERVASKIEKSLKQGKLVRS-RGKTWDEVNGSAATKKSKKKGQNPPQEEAWETDDEEMAAEDAP............................. 182
39 1.000e-13UniRef50_A0A0D1YGW5 Uncharacterized protein n=1 Tax=Verruconis gallopava TaxID=253628 RepID=A0A0D1YGW5_9PEZI  ali  17  2..................SKTAKAKTRKPSIHSRAARRATSPSLVDKSLKDVQPPKRTSHAHLF--------------------AGARDAGVAKRKKGKQRTRAQLERQRRGAERAEAVKGQLETKLEKSLGKLKTIRD-RRKDWDVLNADSAAAVGRASRFAALDVDAGEAGDTPPSDEAGTMTLDLPVRPNAQEDRAAAENPDVPDDD.. 182
40 2.000e-13UniRef50_G0RGY6 Predicted protein n=23 Tax=Hypocreales TaxID=5125 RepID=G0RGY6_HYPJQ  ali  23  1....................MAKSQNRPPSKRSRAARRATSPSINTKSLKEVSLPGSTSKSS----TSAVLPSVLAARHSAGVTK--------KSKRGRQLSARGRRRQEKGLEMAEAFVERTSKKLEKSIGKAKVVQ-ARAKKWDDINKAAEESRSEVLRMATGEDDDDKEGETKMEEWETEDEMDGETVGAAATEVAAPAAPVLDEDDD. 182
41 3.000e-13UniRef50_A0A084FZF1 Uncharacterized protein n=2 Tax=Hypocreomycetidae TaxID=222543 RepID=A0A084FZF1_9PEZI  ali  19  9........................KRKGPSIHSRAARRATSPSIDTKSLKELNPPSPRAESRPSVLAAHHGAGV----------------TKKSSKRKAILSSRARRRQEKGADRAEAISERVAAKIEKSVKAGKSVRS-RGKTWDEVNGTGVTKTKRKGQSAPKEDLWGTDDEAMGVEEE............................... 150
42 3.000e-13UniRef50_A0A2I2F870 Alb1-domain-containing protein n=2 Tax=Aspergillus TaxID=5052 RepID=A0A2I2F870_9EURO  ali  23  2.......................AKVRNQSVRSRAARRQASPSLDVKSLKSLPRAEDTPVSRESVLTDRRNSGIM------------------KKQKGKALTRAQKQRQMKGVERAEAVIDQMEIKVTRSSTRAKTIK-ARSADWDDLNKKSKGSVFQALNDAEGDVEDEGDGDAMVDDSGAPAPAATDAPAKPATQNPAVADHADNDEDEE 178
43 4.000e-13UniRef50_A0A2T3AJK8 Alb1-domain-containing protein n=1 Tax=Coniella lustricola TaxID=2025994 RepID=A0A2T3AJK8_9PEZI  ali  21  8........................KVKPPSIHSRAARRATSPSINTKSLKAVQAPEESLNQRPSVL---------------GIHQNAGVSKRIKRSRKSVLSSRARKRHERGLERAEEIVDRTANKVAKSKESARNIDSRRKA-WDEINASAGGEKAAALNKFASLMNEEDDDDDENESAVGAADLDDEMQDAQQSKAVKPA.......... 170
44 4.000e-13UniRef50_G3B3Y4 Uncharacterized protein n=1 Tax=Candida tenuis (strain ATCC 10573 / BCRC 21748 / CBS 615 / JCM 9827 / NBRC 10315 / NRRL Y-1498 / VKM  ali  26  3.........................KKSISKHSRAARRGEAESHEAKELQKVAK-QESEVKKSIIRNSILSENLLAKKLESKRNKKNKVAKNVAGSRA----------------RTSNMNGILSAKIQNSVARYNFIKTNRKSGWDKINDDIRRSSNVTENTSTSKSVNQQEEEDEYVKQFFEGSGVNIADETKATPNPRNMFALLEEND.. 171
45 4.000e-13UniRef50_W3X2Q5 Uncharacterized protein n=2 Tax=Xylariales TaxID=37989 RepID=W3X2Q5_PESFW  ali  20  9........................KRAPPSKHSREARRATSPGIDTKSLKEVRAPAESINHRPSVLAIHQNAGV-----------------SKKQKRGRAQSSRAKKRQEDAQDKAIAIIERTENKVEKSKDSSRNIQ-RRRKDWDDVNKSIPVTQNAFGSLQDENDDDDQSENSELDDEMSEV---KQANTAVLAQVPQIPAAVMDDDDD. 175
46 5.000e-13UniRef50_Q5AXR8 Uncharacterized protein n=49 Tax=Eurotiomycetidae TaxID=451871 RepID=Q5AXR8_EMENI  ali  28  2.......................AKARPPSKHSRAARRAASPSLDLKSLTNLPRAENTPLQRESILADRANAGV-----------------SKKQSKPKAKSRAQRLRQQKGMERAEAVMDRHEIKVAKSTKRAKTVKN-RRADWSDLNGKVSKFEALAGVDTGDDD............................................. 128
47 7.000e-13UniRef50_A0A194W6T3 Uncharacterized protein n=5 Tax=Sordariomycetes TaxID=147550 RepID=A0A194W6T3_9PEZI  ali  21  8........................KAKAPSLHSRAARRATSPSINTKSLKEVQPPAESVNNRPSVL---------------GIHQSAGVSKKTKRGRKSVLSTKARRRHERGLERAEEIVDRTALKIQKSKRSASEIAS-RKKAWDDVNGAAVAVKASLNKFAGLEDEDDVEEVDAFDDEMGDAAVKTSATAKPAVPAAAPPSEDEDEE... 177
48 7.000e-13UniRef50_A0A0F8U0T3 Uncharacterized protein n=1 Tax=Aspergillus ochraceoroseus TaxID=138278 RepID=A0A0F8U0T3_9EURO  ali  26  2.......................AKARPQSKHSRAARRAASPSLDVKSLTSLPRAEKTPVQRESILADRANAGI-----------------SKKQSKPKPKSRVQKLRQQKGIQRAEAVFDQMENKVTKSANRAKAVKS-RRADWEDLNRKTAKSMFAALNAAE................................................ 125
49 1.000e-12UniRef50_A0A150V733 Uncharacterized protein n=1 Tax=Acidomyces richmondensis BFW TaxID=766039 RepID=A0A150V733_9PEZI  ali  21  3...................KVAKIKRREISLHSRAARRDASPPAQE----------------------VGGKAILEENKYKPWLHGAQNVGINKKKQSKQLTRQQKLRQQKALEKAGVNVDKLEKKVADSKARGKKVQG-RRQDWDELNQKLSSTELRGGKKAYAFQFRDDSVEDAGKE................................. 139
50 1.000e-12UniRef50_A0A1W2TLC3 Putative microfibril-associated protein n=2 Tax=Fungi TaxID=4751 RepID=A0A1W2TLC3_ROSNE  ali  15  5....................TISKKKKAPSLHSRAARRATSPGIDTKSLKNVQPPPESVDHRPSVLAIHHAAGI-----------------SKRQKKGRALSSKARKRHEKAQDRAAAILERTEKKVVLSKDQSRTLQSRRRA-WDEINQQIPPNKSKTESRVITPRDEDSTEEVSDFDDAVAEMEDERESQQDDADPA............. 166
51 2.000e-12UniRef50_Q0TX04 Uncharacterized protein n=11 Tax=Pleosporales TaxID=92860 RepID=Q0TX04_PHANO  ali  15  3...................KTAKIKKREVTVHSRAARRAASPSIDLD--------------KKLKQTTRDSTSPSRPSQVKPHALAAQNGGIQKKQKKGNMTRAQRLRHQKGLERAADVMDKRQVKVVKSLGKERNIK-ERSKGWEDVNGDGKKRKKTTGLDDADEHDADGKDDREWVSDEEMDD........................... 153
52 2.000e-12UniRef50_A0A2B7Z3P5 Uncharacterized protein n=1 Tax=Polytolypa hystricis UAMH7299 TaxID=1447883 RepID=A0A2B7Z3P5_9EURO  ali  17  1...............MTKTPRLKNETKFKSIHSRAARRAGSPSLDLDRSLRSLPRVESTSIKPSVLAAQ--------------------SSGVKKSKAKPMTRAQRMRQEKGMERAETVMDKKEIKVRKSVQRTKVVHS-RKATWEDLNHGRTPAARMMMKILSGDVDLDAMDANE.................................... 140
53 3.000e-12UniRef50_A0A2T3AWW6 Uncharacterized protein n=8 Tax=sordariomyceta TaxID=715989 RepID=A0A2T3AWW6_AMORE  ali  15  1...............MAKTAPLK-KKGAASIHSRAAKRASSPSIDTKSLKNVKPPTESKPHRPSILA---------------VHQGAGVAKKSKNGRKAVLSAKARRRQEKGXXXXXXXXXXXXXXXXXXXXXARTVQ-ERAKAWEELNKNILAKKERAAQLAKEDLIDEEDGMDGMEEDVDVGDAPSIKPAAEAAAQSTPLTGPAEDDDE. 180
54 3.000e-12UniRef50_A0A2V1DWH9 Uncharacterized protein n=1 Tax=Periconia macrospinosa TaxID=97972 RepID=A0A2V1DWH9_9PLEO  ali  17  1...............MAKTAKLK-KKQQPAPHSRAARRALSPTDP--SLVKSTTTNTTQRSTSPTDASTAKPHILAAKNAGIQKRASKN--------GKQLTRAQRQRQLKGMERAEHNMDKLEVKVMKSVGKEKKVK-ERSKGWEEVNSGGRKKGAKVRGLDDGEEETGKRGSKWAFDEEMEEDGAGGGAAQDEG................ 170
55 3.000e-12UniRef50_M1W6F2 Uncharacterized protein n=2 Tax=Clavicipitaceae TaxID=34397 RepID=M1W6F2_CLAP2  ali  21  7...........................PPSKHSRAARRATSPSINTKSLKSVAPPSRSSDTRPSVL---------------EVHRSAGVTKKTRPARKARLSSKMRKRHEKGLEMAAAVTERTGKKLEKSIGRARVVVER---------SRAXXXXXXXXXXXXXXXXXXXXXXVTKEKKEVVAENYGVQVGGILGNGAVQAGAVVDEDEDE 168
56 4.000e-12UniRef50_A0A0K8L4S4 Uncharacterized protein n=5 Tax=Aspergillus TaxID=5052 RepID=A0A0K8L4S4_9EURO  ali  25  2.......................AKARPKSIHSRAARRAASPSLDVKSLTALPRAENNVIQRESVLNERANAGV------------------SKKSKAKAKTRAQRLRQQKGMERAEIVYSRLENKVAKSVSRAKNVK-ARRSDWESLNRNVSGSMF---ETLQEQDDDSHLDDAMVDVSGAPENKKRTSKPAKVTQNP............. 156
57 6.000e-12UniRef50_H8X787 Ecm1 pre-ribosomal factor n=2 Tax=Candida TaxID=1535326 RepID=H8X787_CANO9  ali  31  1........................MAKKISKRSRAARRGEITDAPIITTSTKESHENDGVRKSIIRTQIKNETLLSKKIEASRIRKQQQDHKKK-----------SSALKHKVNRSDKLQGILASKIDASIARAKYVQNARKSNWDKTNSSIEIRNHMIEE-GAKKELTQEDIDKMEEDEYVRKFYEDEVVEN................... 158
58 7.000e-12UniRef50_F9X4B9 Uncharacterized protein n=6 Tax=Mycosphaerellaceae TaxID=93133 RepID=F9X4B9_ZYMTI  ali  22  3...................KTPKVKKREVKVNSRAARRGASPAP--KDAEVKATTTETDY--------------------KPWLHTPQGAGISKKKKTKTLTRQQRARQERGLEKAAAIGGKLEKKVADSTNRGRKV-DARRADWEELNEKIAGKKLKKESKSKAMKSEDTGAPKPMEDVVI--MADSMHAPPSRVDVPDTLAGS....... 163
59 7.000e-12UniRef50_A0A2S4PNV3 Uncharacterized protein n=1 Tax=Erysiphe pulchra TaxID=225359 RepID=A0A2S4PNV3_9PEZI  ali  20  15...............................HSRAARRLTSPSIDLKSLKYIKPPSYTKKSRPSIL---------------EIHQGAGVNKKAKTHRKSVLSAKARRRNEKGLDHAVAVLERTEKKIKKSKVKARVSQ-ERSINWEEVNKQMETQKAKRSTILTGETSTPIQSERS.................................... 144
60 8.000e-12UniRef50_A0A0B1NZ45 Uncharacterized protein n=1 Tax=Uncinula necator TaxID=52586 RepID=A0A0B1NZ45_UNCNE  ali  19  6.......................AKTKTASVHSRAARRLTSPGIDLKSIKNIQPPTFIKKSRPSLL---------------EIHQSAGVSKKSKSRRKTVLSAKAKRRYEKGLDHAVAVMQRTEKKVKKSKSKARIVH-ERSLDWDNLNRQMDTQKIIRSNLSTLETSSNIESNKS.................................... 143
61 1.000e-11UniRef50_A0A225AM66 Uncharacterized protein n=1 Tax=Talaromyces atroroseus TaxID=1441469 RepID=A0A225AM66_9EURO  ali  27  3...................RTGKLKKKATSVHSRAARRGASPSDVNKSLESVPRMEAP-TKPSSILAAHTSAGI-----------------SKKKSKAKPLSRAQRLRQQKGIERAEMVIDQLETKVAKSIGKAKAI-NARRAQWEDLNSKNDKTKAIQQGQESDDEQMKE......................................... 135
62 1.000e-11UniRef50_A7EE60 Uncharacterized protein n=5 Tax=Helotiales TaxID=5178 RepID=A7EE60_SCLS1  ali  18  1...............MGKTAPLKNKG-STSVRSRAAKRASSPSIDTKSLKNVKAPTETVYHP-----------------QALSPHQGAGVSKKKSGRKSQLSSKAKRRQDKGLDRAEAVMDRTSTKIEKSKYRGRNVQ-ERAKAWETLNKKAQEAVQAAMEKEKENEDEVSEEDSQGEVEMDDVAAAPIAPTATDAVQPTPLTAPLEDEEE. 183
63 1.000e-11UniRef50_A0A165JU70 Uncharacterized protein n=1 Tax=Xylona heveae TC161 TaxID=1328760 RepID=A0A165JU70_9PEZI  ali  15  1...............MGKTPKPK-KGRPVSVRSRAARREASPSIDVKSLTETKPPTPSANERPSVLALHQGAGV-----------------TKKSKKAKPMSRAQRRRHEKGLERADTVIDQLEKKVNKSLARGRNVDN-RRAEWEDINLATTTAAKQKNQEQKDDADEKISEIDVEQPSKRFDGLSEVEMGPNAQES.............. 165
64 1.000e-11UniRef50_G1WYZ4 Uncharacterized protein n=3 Tax=Orbiliaceae TaxID=47021 RepID=G1WYZ4_ARTOA  ali  22  5.........................RKVLSVHSRAARRAVSPSLNLKSITTAPRPSSPTRTSLTTPTADKTRKVLDVIHRTLSSGVQKSSNPNKHLKRGQKSKTQKKRREVGKEKAAAVAEILEVKQEESRKKVKVIKD-RSGDWDNVNSKI............................................................ 132
65 3.000e-11UniRef50_M7TPL6 Uncharacterized protein n=6 Tax=Leotiomycetes TaxID=147548 RepID=M7TPL6_BOTF1  ali  14  1...............MGKTAPLKNKA-STSVRSRAAKRASSPSIDTDKSLKNVKAPAETVYNPQILSPHQGAGV------------------SKKKGGRQLSSKAKKRQNKGMDRAEAVMDRTSTKVEKSKYRGRNVQ-ERAKTWEALNKKAQEAVQAAMDKENEVSEEEEDVDVEDDQSQGEIEMDDTSAAPAALQSAPLPTPVEDEEE.. 175
66 3.000e-11UniRef50_A0A1E5RS35 Shuttling pre-60S factor ECM1 n=5 Tax=Hanseniaspora TaxID=29832 RepID=A0A1E5RS35_9ASCO  ali  31  3.........................KNKISKNSRAAKRAVSTRNELKELQNVARAEKTDFSRVHIKQAIKNSNLLQSKIDRKRESKIKNNINKRKEKKLENLKIDNKALLANIEKSLNISNQLHNKIMKSKQRARYVQSARKAGWEQTNALAKQEIEQVNTIYNKEDPTTKSSETTEENDDVETFAQQEERLRNERNKPRNIFEALEVEYEE 205
67 7.000e-11UniRef50_A3LYN6 Cell wall structure or biosynthesis (Fragment) n=2 Tax=Debaryomycetaceae TaxID=766764 RepID=A3LYN6_PICST  ali  40  1............................VSKHSRAARRGLAEEGEAKDLSKVPKTESDEVKKSIIRTTIKNENLLAKKME------------NSKIRKSNQNKRKTSSLKHKLDRSDKLSGVLSTKIEQSIARAKYVQSARKSGWDQINKSI............................................................ 113
68 8.000e-11UniRef50_V5GD24 Uncharacterized protein n=1 Tax=Byssochlamys spectabilis (strain No. 5 / NBRC 109023) TaxID=1356009 RepID=V5GD24_BYSSN  ali  19  1...............MAKTPKVKGNSKP-STHSRAARRAASPSVDLKSLISLPRPET-----PQIPSTHVNSGITKKKSKSKPK-----------------TRAQRLRQEKGXXXXXXXXXXXXXXXXXXXXXGRSI-NRRKVDWEDLNRKSNRFTAALEVENDGQEEQDNAMEDDNDVRIEKFTRQTVFSAATAGPVAEQPAGLDEDEE.. 172
69 1.000e-10UniRef50_A0A0U1LMX4 Uncharacterized protein n=5 Tax=Eurotiales TaxID=5042 RepID=A0A0U1LMX4_TALIS  ali  22  3...................RTGKLKKKSDSLHSRAARRETSPSADVDKSLKSMPRVEAPAKQPLIHAA---------------------GISKKKSKTKAMSRAQRLRQQKSIERAESVMDQLETKVAKSIGKAKAV-NARKAQWEDLNSKHDAAVKILQETQDDEEMESEQPSE..................................... 136
70 1.000e-10UniRef50_A0A0G4KQQ2 Uncharacterized protein n=5 Tax=Verticillium TaxID=1036719 RepID=A0A0G4KQQ2_9PEZI  ali  19  9........................KAKAPSKHSRAARRETDVDIDTKSLKNVKAPAESVDSRPSVLQAQ---------------HGAGITKRNKAGRKAVLSTKARRRAEKGADRAEAIMDRTANKKEKSRGHSKVIQG-RAKNWEDVNKKSLDEVRRALMAAENDSADEDEDVKDAAAAGEGQEDKGAETDEEMDAAP............. 168
71 4.000e-10UniRef50_I1RXC9 Uncharacterized protein n=12 Tax=Sordariomycetes TaxID=147550 RepID=I1RXC9_GIBZE  ali  20  2.......................AKKRAISIHSRAARRATDIDIDTKSLKEVQPPPRDAPHRPSVLAAQ---------------HSAGISKKAKRGRKDKMSAKARQRHEKGLEMAAAVAERTQNKIEKSKGRSRNIQT-RAKNWEEXXXXXXXXXXXXXXXXXXXXXXXXXAKKDEDDEDMDGADEKTLTAPVTDDSAAISADPIQADED. 174
72 4.000e-10UniRef50_A0A1E4TP69 Uncharacterized protein (Fragment) n=1 Tax=Pachysolen tannophilus NRRL Y-2460 TaxID=669874 RepID=A0A1E4TP69_PACTA  ali  43  1............................VSKHSRAARRGEIKDAEAKSLSKIPRAENTNIASSIIRLAAKNEGLLQKKMGKNKTRGQP-----------------TRIVKERKQKALKMDGKLTFKIEQSLERAKNVQFSRKSGWDSINKNI............................................................ 108
73 5.000e-10UniRef50_A0A2P7Z7R6 Uncharacterized protein n=1 Tax=Elsinoe australis TaxID=40998 RepID=A0A2P7Z7R6_9PEZI  ali  20  11..........................REVSSHSRAARRAASPSLDVKSILDIKAPEKDTNVS----------------------YGGVYAGISKKKKPKPLTRQQRLRQEKGMERASNNLDKLSKKVADSQFREKKVKN-RNAAWEELNEKVATKTGATRNKGEVGVEERDSDVDVNDDTASRRAADHDIAQAPMASATIPTDDTAEDEVE. 175
74 5.000e-10UniRef50_A0A2H3EHV5 Uncharacterized protein n=2 Tax=Dermateaceae TaxID=76657 RepID=A0A2H3EHV5_9HELO  ali  19  1...............MAKTAPPK-KRGVTSVHSRAAKRASSPGIDLKSLKDLRPPQATKTKQPSILA---------------IHQGAGISKKSKNGRKAVLSSKAKKRQEKGMDRAEAVIDKKEIKIEKSKGRARIVQD-RAKNWEELNKKMLEQKAREEAAALEKDKDAEGWEDDEEMEEAIQDEEASATGSKALKN.............. 167
75 5.000e-10UniRef50_A0A1Y2LM34 Uncharacterized protein n=1 Tax=Epicoccum nigrum TaxID=105696 RepID=A0A1Y2LM34_EPING  ali  19  3...................KTAKLKKKQAAPHSRAARRAASPSIP---ISKDPKPVTRDSHSPSRPSEVKHHVLSAEK-----------GGGIRKSKNTKMTRSQRVRAEKAMERAADDMDKWELKKAKSLEKAASIK-ERAKLWEDVNEESEKMLKKKSAFAVLXXXXXXXXXXXXSVWDGDKAVGDVVMDVEEVP............... 165
76 9.000e-10UniRef50_I2JWJ8 Uncharacterized protein n=1 Tax=Brettanomyces bruxellensis AWRI1499 TaxID=1124627 RepID=I2JWJ8_DEKBR  ali  24  21.......................................VEQDSQIQQLDSLPRAENTDVIGPMIRASKKNQRLLDIKLEKKHHRNSKDVTETVVGHKKKHTNMISRAVKSRRRRGVSVNGRLSKRIEETIKRRNQRRYLRSSDWDAVNKMAKDAVTKEDVDAAGKNT............................................ 153
77 2.000e-09UniRef50_A0A0D2E7W0 Unplaced genomic scaffold supercont1.1, whole genome shotgun sequence n=2 Tax=Fonsecaea TaxID=40354 RepID=A0A0D2E7W0_9EURO  ali  18  25.............TQISKLRTFSHKRFTANPRSRASKRATSPSIDVKSIRDAPRASD----ATPILAARPNGGITKPK-----------------RKQKPLSRGQRRRHEKGLARAEMVQDQHARKIEDASHRLKKRR-ERKGMWEEVNGTNKFDKLRAALGDDDANENDEDEWVDDNMEEVENEGGNVEILEKST................ 186
78 2.000e-09UniRef50_A0A074Y8Q1 Uncharacterized protein n=5 Tax=Aureobasidium TaxID=5579 RepID=A0A074Y8Q1_9PEZI  ali  19  3...................KATKAKARPVSTRSRAARREASPSINLDKSITSEKTT---------------------KEPAEYHSGAHDAGVSKKKRSKPLTRAQRVRKEKGLERGEANLDVLHTKKAKSFVRARRI-DDRRVDWATMNEKANRFVQPKVAKGSKAVDKDANSSDEE................................... 138
79 3.000e-09UniRef50_A0A1E3QME7 Uncharacterized protein n=1 Tax=Babjeviella inositovora NRRL Y-12698 TaxID=984486 RepID=A0A1E3QME7_9ASCO  ali  30  2.............................................................................................................KQKQTKFMKLEGRLSTKIEQSIERSRSVQTTRKSGWDSINKSIKTENFYLANLFDEDSEDEKVTEKMEEDKYVAEFFGTGAEPVEKLEKPRNAFALLEETE.. 112
80 3.000e-09UniRef50_E7Q0H6 Ecm1p n=1 Tax=Saccharomyces cerevisiae (strain FostersB) TaxID=764102 RepID=E7Q0H6_YEASB  ali  82  6...........................................................................KQRYLRKPIKVRRGKKLNKKALEDKLANSISSMDRDRLVKALNFTNRLDGKIAKSISRAKYIQNTRKAGWDSTNETIKKRAG....................................................... 87
81 2.000e-08UniRef50_G9MZR9 Uncharacterized protein n=1 Tax=Hypocrea virens (strain Gv29-8 / FGSC 10586) TaxID=413071 RepID=G9MZR9_HYPVG  ali  18  1....................MAPTQKRAPSKRSRAARRATSPSIDT----------DKSLKDVSLPSTKSASSSSARPSVLAARHSAGVTKKSRRGR--QLSAKGRRRQEKGLEMAEAFIERTSKKLEKSIGKARVVQ-ARSKKWEDINKAVQESRTNAFEALKQDDDEDDEAKGAEWETDDDMDGEASAKTDAAAA------PVLDNDDDE 173
82 2.000e-08UniRef50_C4JRE0 Uncharacterized protein n=1 Tax=Uncinocarpus reesii (strain UAMH 1704) TaxID=336963 RepID=C4JRE0_UNCRE  ali  25  2.................KTPRLKSSSAK-SVRSRSARREASPGLDVKSVTSLPRAERTAVTRSSVLNAQHDSAV-------------------SKKKQKRQTRSQRLRQEKGLERAEVVMDKTEKKLAKSVHKGKVVK-ARKSTWDDLNKRGKNAYKILEDQVDAMDTDDKE........................................ 136
83 3.000e-08UniRef50_A0A1Y2ABE6 Uncharacterized protein n=1 Tax=Clohesyomyces aquaticus TaxID=1231657 RepID=A0A1Y2ABE6_9PLEO  ali  17  3...................KVGKIKKKPATPHSRASRRALSPSLSISVSKTLPSPSTNPRPPVT---------------SKPHILSASTSSGIRKPKYKQLKHSQRVRQQAGIQRAFDVMDKREVKVLKS.................................................................................. 98
84 4.000e-08UniRef50_A0A0J9YHA7 Uncharacterized protein n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9YHA7_GEOCN  ali  18  2.......................AKKKQPSIRSRALRRAASPPPSGEAV--VPAPAKRVDGKTRVKEAIAELQVRSSNGISIRTRKNNNKIRKQEKRESMVSWKKRKRQAEAIERAENLKDMFKEKVDKSLQRFKR-TNDRKKGWEETNKKIYKMKTENTNIFSLLDVDNADDNKDDDEWSDEGMATSD....................... 176
85 8.000e-08UniRef50_A0A1V8TFX8 Uncharacterized protein n=4 Tax=Rachicladosporium TaxID=470018 RepID=A0A1V8TFX8_9PEZI  ali  16  3...................KPTAPKRRPVSTHSRAFRRAASPP---------PKDPNSTSTTSAKDSAPANEHWLYTAQAAGVHKKA--------AKGKTLTRQQKQRQVKALEFAERNSAKHEVKVEKSKGRARKV-AERAKAWEEIDGVAVEMKKAGEGETGGEMEGGEDEWXXXXXXXXXXXXVSAMEQGLEGIIAETSTRPIEE.... 173
86 9.000e-08UniRef50_M2Z6C1 Uncharacterized protein n=5 Tax=Capnodiales TaxID=134362 RepID=M2Z6C1_PSEFD  ali  17  1....................MAKAKKREVSVHSRAARRGEAP-PSKDLLTSKTPAEQSDY--------------------KPWLHSVQNSGIQKKQKKQQLTRAQKLRQQKGXXXXXXXXXXXXXXXXXXXXXGKAVKS-RNPDWEELNGKLVAVKEAQRDALATNLAKLREDSGMEERDRDGDEQMVPDLEQPLPIRSTEMSGAEEE.... 166
87 2.000e-07UniRef50_B6HKS2 Pc21g03240 protein n=34 Tax=Aspergillaceae TaxID=1131492 RepID=B6HKS2_PENRW  ali  19  25..............................................KSVTSLPRAESPTTTRPSVLADRATSGI-----------------QKKQKKNDKISRAQRLRQQRGMDRAEAVMDQLEIKKAKSLARGKTV-NSRRADWEDTNRKTLTFAALQQDDDEEGDEDDDAMAEDSAPAKIAVANNVFQIATEGTNPATDDSATVDEADE. 171
88 2.000e-07UniRef50_A0A1W5D0J7 Ribosome biogenesis protein Alb1 n=1 Tax=Umbilicaria pustulata TaxID=136370 RepID=A0A1W5D0J7_9LECA  ali  20  1...............MAKTAKLKKNAKSTSIHSRAAKRASSPSLNLKSLTSIKAPAETSAHRSSVLSVHNGAGI-----------------TKRKGKGKPMSRQQXXXXXXXXXXXXXXXXXXXXXVEKSLVRGKVVKG-RSSAWEELNGSIKSKKAK...................................................... 126
89 3.000e-07UniRef50_A0A1B8AI29 Uncharacterized protein n=8 Tax=Hypocreales TaxID=5125 RepID=A0A1B8AI29_FUSPO  ali  21  2.......................AKKKAPSIHSRAARRATDIDIDTKSLKEVQPPPRDPPHRPSVLAAQ---------------HSAGISKKAKRGRKDKMSAKARQRHEKGLEMAAAIAERTQNKIEKSKGRGRNIQFRXXXXXXXXXXXXXXXXXXXXXXXXXXXEEQPKKSGIELDEKMD-GADEAPVTEDSAPAPVQA.......... 165
90 4.000e-07UniRef50_A0A0N1H4E7 Uncharacterized protein n=1 Tax=Phialophora attae TaxID=1664694 RepID=A0A0N1H4E7_9EURO  ali  18  17............................VNPRSRAAKRASSPSVNLKSLRDAPRASD----ATPVLAAQH----------------GGGVHKASKKKAKPMKRSQRARQERTLARAET---------ESFQARQKKVRG-RRAIWEEINDGAEEEKRKTPRFQVLGEDGHDQVIENGNDEEWEDENGDAEMK.................... 151
91 7.000e-07UniRef50_A0A2I0RLL9 Uncharacterized protein n=1 Tax=Cercospora zeina TaxID=348901 RepID=A0A2I0RLL9_9PEZI  ali  16  15...............................HSRAARRGAEPA--RKDLESVKPPKEETDYKP-------------------WLHNAQNAGIQKKQKKKQLTTAQRRRQEKALEKADAISGKHEKKVADSKRRSARTQT-RSREWEELNEQAAATKGAAEETKKTVKAGKAAAATVGAVGDETMADTQVPVVTAQPTVPQ............ 161
92 1.000e-06UniRef50_A0A1E4RUS8 Uncharacterized protein n=1 Tax=Cyberlindnera jadinii NRRL Y-1542 TaxID=983966 RepID=A0A1E4RUS8_CYBJA  ali  28  2........................................................................................NKKERSKNKVTKKSTPMTNINKERVERAINLSERLEGKISKSKQRAKMVQTTRKANWDVINSEVKIHTETLEAATDDKDSEKLQEDSMVDDFY--------EVEKPKIQTAKNAFALLDEVE.. 115
93 2.000e-06UniRef50_G8Y8T4 Piso0_004438 protein n=3 Tax=Debaryomycetaceae TaxID=766764 RepID=G8Y8T4_PICSO  ali  22  2.............................................................................................ESNRIKKANRKNTSHLKSKIERSNRNSGILSNKIEQSIARANYIQKYRKADWEKINKEINS--GAVMNEDDDSLQTKKQIEREEEDEYVKQFFDEDNDKKDEGDESQD........... 107
94 3.000e-06UniRef50_A0A168I7S9 Ribosome biogenesis protein Alb1 n=10 Tax=Hypocreales TaxID=5125 RepID=A0A168I7S9_CORDF  ali  17  5.........................KTQPSKRSRAARRATSPSIDTD--KSLKTAQPPPRTKPTDRPSV------------LAVQHAAGVQKRSSHRKTHLSAKARKRREKGMEMAEAVMERTSNKVQRSLNRQRTV-DKRRKEWDAINKDVNEAEGDEDEDDEDMEVEEEGVETKKKKKKNGKKETKKAEDKDKED............... 161
95 4.000e-06UniRef50_A0A0E9NJP4 Uncharacterized protein n=1 Tax=Saitoella complicata NRRL Y-17804 TaxID=698492 RepID=A0A0E9NJP4_9ASCO  ali  18  2.......................AKAKPQSTRSRAAKRAVTPDASDAVAIEKVVESMPATHEEALPA---KQRVHYEIASLSARGDSGIQKPKLAARKKALSAKARKRMEASQDRAEAVMEQMAKKVQKRTKSVKIIKDRRGA-WDEINQKAEREKARLAALSQLLHEKE.......................................... 144
96 5.000e-06UniRef50_A0A135LFJ9 Ribosome biogenesis protein Alb1 n=5 Tax=Aspergillaceae TaxID=1131492 RepID=A0A135LFJ9_PENPA  ali  24  26..............................................KSVLALPRAESPTTTRPSVLADRATAGI-----------------KKKQNKNDKISRAQRLRQQKGMDRAEAVMDQLEIKKAKSVARGRTV-NSRRADWEDTNRKTLSFNALRXXXXXXXXXXXXXXAED.................................... 137
97 8.000e-06UniRef50_A0A0D2KKJ1 Uncharacterized protein n=23 Tax=Chaetothyriales TaxID=34395 RepID=A0A0D2KKJ1_9EURO  ali  18  1...............MAKTSKIK-KDPTANPRSRASKRATSPSIDVKSIRDAPRASD----ATPILAARPNSGI-----------------TKAKKKQKPLSRGQRRRHEKGLARAEMVQDQHARKIEDASQRLKKRR-ERKGMWEEVNGTNNKFVTLMAAIGDDAEQNGEEDGWEDEDNMEEVDIEGGRVKDIENSATT............ 163
98 9.000e-06UniRef50_M3B5H6 Uncharacterized protein n=3 Tax=Mycosphaerellaceae TaxID=93133 RepID=M3B5H6_SPHMS  ali  20  2...................KVPKVNKKGVSVRSRAARRGAEPA--RADLESIKPPKEETDYKP-------------------WLHNPQNAGIQKKQKKKQLTTAQKKRQEKALEKADAITSKHEKKVEDSKKRSARTQ-ARAKQWEELNDKLEADKAREEAKKAVKSKSTHSTTAALTERIGDEVMPDLEATLPVGST.............. 159
99 1.000e-05UniRef50_A0A2J6T8F2 Uncharacterized protein (Fragment) n=1 Tax=Meliniomyces bicolor E TaxID=1095630 RepID=A0A2J6T8F2_9HELO  ali  15  1...............MAKTAPPK-KKGVASVHSRAAKRASSPGIDLDKSLKDVKPPETKTQRPSVLA---------------IHQGAGISKKSKNGRKAVLSAKAKKRQEKGMDRAEAVMDKKEKKVEKSKGKARTVQ-ERAKAWDELNKRMLAKK........................................................ 124
100 3.000e-05UniRef50_A0A0B7JUW0 Uncharacterized protein n=1 Tax=Bionectria ochroleuca TaxID=29856 RepID=A0A0B7JUW0_BIOOC  ali  17  2.......................AKQRTISKRSRTARRAASPTFETKALKDYKPPARASAPRPSVLAIHQSAGI--------------DKKPSKRGRKSQLSSKARRRQERGLQMAEAI--------------------ERSKTWDSINKKALDAKEVQAEDDDEDEPEQDASKAVEDKWETDEDMGGKQDDAAAESKPETA.......... 148
101 3.000e-05UniRef50_A0A2P4M850 Uncharacterized protein n=1 Tax=Quercus suber TaxID=58331 RepID=A0A2P4M850_QUESU  ali  18  45...................KVAKPKKKDVSVHSRAARRGGSPSAD---LNVKPPVDETDY--------------------KPWLHNAQNAGISKKKKTKQLTRQQXXXXXXXXXXXXXXXXXXXXXXXXXXXXARRV-DERRAAWEDLNTKFTEADEAEAKKISKAVKAGSEASAAALPTDVVEMTGATPHAAANQTEQSTAIPAAEEEIDE 222
102 4.000e-05UniRef50_U1G2P7 Uncharacterized protein n=1 Tax=Endocarpon pusillum (strain Z07020 / HMAS-L-300199) TaxID=1263415 RepID=U1G2P7_ENDPU  ali  13  1...............MAKTPKLKANPSSANPRSRASRRATSLSTSAPALSSSDPTPNLTHPPPHLEKRNNNAN------------AVLNGGITKKRGQKRQTRHQRLRQEKGLARAEDVLGKMEVKVERVVRRVKVGRER-RRAWDEVNGDVDGVKKNAMGNAKDEEENKGEVKDGMDIEDEAEWVDEEEKEAEIFSIKSNVVPPEPEVDE. 192
103 6.000e-05UniRef50_K1Y3U5 Uncharacterized protein n=26 Tax=Leotiomycetes TaxID=147548 RepID=K1Y3U5_MARBU  ali  14  21.............................SVRSRESRRAASPGIDLKSLKDLKPPTATKIKQPSVLA---------------IHQGAGISKKTKNGRKAVLSAKAKKRQEKGXXXXXXXXXXXXXXXXXXXXXARTVQ-ERAKNWEELNKRMLXXXXXXXXXXXXXXXXXXXXXDDEMEADEDLTAETNVAEDAKT................ 172
104 1.000e-04UniRef50_A0A1Z5SZA4 Uncharacterized protein n=1 Tax=Hortaea werneckii EXF-2000 TaxID=1157616 RepID=A0A1Z5SZA4_HORWE  ali  17  8.......................TKKREVSVHSRAARRGEEPPSKDLAVKSASVQSD----------------------YKPWLHNAQNAAVGKKKKSKQLSRQQXXXXXXXXXXXXXXXXXXXXXIADSKARGKRVQ-ARRKDWEELNENLGDGQKKRVGAAGEEEQVSRPRVDMEDVELQGETELPANMKVAENEAPRQ........... 162
105 3.000e-04UniRef50_A0A0L0NX56 Uncharacterized protein n=1 Tax=Candida auris TaxID=498019 RepID=A0A0L0NX56_CANAR  ali  26  7.................................................................................................RKKANKRKTSALKNKLDRNQKVEGVLATKIQQSIERAKYVQSARKLGWDQINKSIQKKVEDLKKQQEEEPKLDEQMELEEEDAYVRDFEGKKEELESLKASDQNAFALLEETE.. 126
106 8.000e-04UniRef50_A0A0S6XMF7 Uncharacterized protein n=1 Tax=fungal sp. No.11243 TaxID=1603295 RepID=A0A0S6XMF7_9FUNG  ali  29  12............................VSVHSRAARRATSPSIDVKSILSAARPQTDA......................................................................................................................................................... 43
107 0.002UniRef50_A0A063CDT1 Uncharacterized protein n=1 Tax=Ustilaginoidea virens TaxID=1159556 RepID=A0A063CDT1_9HYPO  ali  22  1........................................................................................................MRRRHDRGLEMAAAVTERTGRKMEKSIGRARAVQS-RSRPWEQVNREATGEGEPGGGGFAALVDEGAGAGAGAEEPGEGGLAADD....................... 84
108 0.003UniRef50_A0A0G4NMV9 Uncharacterized protein (Fragment) n=1 Tax=Verticillium longisporum TaxID=100787 RepID=A0A0G4NMV9_9PEZI  ali  15  1..................................................................................................AVLSTKARRRAEKGADRAEAIMDRTANRKEKSRGHSKVIQG-RAKNWEDVNKKSLDEVRRALMAAENDSADEDEHVRDAAAAGEDKGDKEAETDEEMDAAP............. 100

FFAS is supported by the NIH grant R01-GM087218-01
1 3 7 5 6 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35