current user: public

If you have questions about the server, please let us know.

Query: gi|6319263|ref|NP_009346.1| Putative peroxisomal membrane protein required for import of peroxisomal proteins, functionally complements a Pichia pastoris pex22 mutation; Pex22p (YAL055W) [Saccharomyces cerevisiae], from S.cerevisiae

Results of PSI-BLAST search in nr85s
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180
# E-value Template Links and tools%idFirst MPPPSRSRINKTRTLGIVGTAIAVLVTSYYIYQKVTSAKEDNGARPPEGDSVKENKKARKSKCIIMSKSIQGLPIKWEEYAADEVVLLVPTSHTDGSMKQAIGDAFRKTKNEHKIIYCDSMDGLWSCVRRLGKFQCILNSRDFTSSGGSDAAVVPEDIGRFVKFVVDSDVEDVLIDTLCNLast
1 4.000e-54UniRef50_P39718 Peroxisome assembly protein 22 n=18 Tax=Saccharomyces TaxID=4930 RepID=PEX22_YEAST  ali  100  1MPPPSRSRINKTRTLGIVGTAIAVLVTSYYIYQKVTSAKEDNGARPPEGDSVKENKKARKSKCIIMSKSIQGLPIKWEEYAADEVVLLVPTSHTDGSMKQAIGDAFRKTKNEHKIIYCDSMDGLWSCVRRLGKFQCILNSRDFTSSGGSDAAVVPEDIGRFVKFVVDSDVEDVLIDTLCN 180
2 1.000e-36UniRef50_A0A1E4S0X4 Uncharacterized protein n=3 Tax=Cyberlindnera TaxID=604195 RepID=A0A1E4S0X4_CYBJA  ali  24  4........RRQRRNASIIGALVVLGAGAYALYSYLTS--EGDGDVEVVNDNDSRRKYTQRPITIILTESILSSNLPLNEILKKDVVLVVPPDLSVDEDLQ----DEFEPDVEYKVIECETYEGVWSVVKHLNGEIIFVVKDDLP-------SELPDGLERYVGEIVELDQNSSEIN.... 160
3 2.000e-35UniRef50_J7RYN7 Uncharacterized protein n=1 Tax=Kazachstania naganishii (strain ATCC MYA-139 / BCRC 22969 / CBS 8797 / CCRC 22969 / KCTC 17520 / NBRC  ali  25  1MAPPRSQRKRALNCTGALVAAVGLGVTCWYLWKNYTG--------EAEGEQRLSREEAAESKCVVVTPSVCDVQVHWEMLIQEDIVFLVAPGCHDRFSSEVL--SLVDEQFKYKAINCETVDGIWYCVKSLMKQQLYVIPSEVSNG-------IPNDIARYVQDI............... 153
4 5.000e-35UniRef50_A0A1E3QK39 Uncharacterized protein n=1 Tax=Babjeviella inositovora NRRL Y-12698 TaxID=984486 RepID=A0A1E3QK39_9ASCO  ali  18  4........YKRKRNAILASLAVTVIAGIVYAVNKLSTEENDMELSREMSQPLTEKRYTTKAITVVLTSSIIAARLPLEELLSNNIVFVLPPKLRFADQRLMSRKGVNGVIHKYKIIECDNARGMWFVVKHLKPDTLIVCEDDLP-----LHCEMPQEINNFVRDVVILEQNSNAV..... 174
5 1.000e-34UniRef50_Q6BMZ7 Peroxisome assembly protein 22 n=5 Tax=Saccharomycetales TaxID=4892 RepID=PEX22_DEBHA  ali  22  1MPQAQIRKTQRNPKLWIAALVAASIVTISYKVYSSYIAEENIEDKKTEGDGRIAKRYTKKSIALTLSHSVLSSQLPLNEILSENVTFILPPNLSMDDLVCNIGNADEVERNNYKLLHCSNIDGYFNILKNLKPDTLLVCSEDLGIAN-----NVPRDLHRFVKEIINIDQNKD....... 184
6 7.000e-34UniRef50_C4Y073 Uncharacterized protein n=3 Tax=Metschnikowiaceae TaxID=27319 RepID=C4Y073_CLAL4  ali  21  2......ARKRNTRTWVALALATSVAAVAYKIYQEWLPNED--EQRESSNVKKIKSKYANKSVTLTLSHSVLNSDLEEILLNSNNVTFILPPYLSVDDLQCNISVVPEILQDNYKLLKCSNMQGYFQLLKNLRPDILIVCTDDLGI-----TEQIPKDLGRFVGKVVTIDQEKDKARTVLS 175
7 1.000e-33UniRef50_K0KTQ5 Peroxisome assembly protein 22 n=2 Tax=Wickerhamomyces TaxID=599737 RepID=K0KTQ5_WICCF  ali  22  1MPLSFEINKRKIKNLGFISAAILFGIGCITLYKSIQSEETPNQSKSENKGDKTKNKYTSKPVTIVVTDSIISAKLRLGEILSQDVVLVLDPNLNKQDLIG------IEPQQEYKIIECESYDGLWSIVKHLNSELIFVVKDDL-------IEDLPKNLSRFVGEIIELEQNQKIISYIMN 177
8 1.000e-33UniRef50_G0VJL8 Uncharacterized protein n=1 Tax=Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) TaxID=1064592 RepID=G  ali  28  23.................TVLAVSTGVACYYLYKNFXXXXXXXXXXXXXESSVKETKKKQPSKCVIISNKISNVGMDWSELLDEDITLIVAPGVTFLD--QPKEEESIGREHQFKVIRCDTLIGMWACVKSLRKDQLIVCPGDIEDG-------IPEGIDQFVKKIIKVEDGTQLKRAVTN 194
9 4.000e-32UniRef50_A3LVY4 Uncharacterized protein n=13 Tax=Saccharomycetales TaxID=4892 RepID=A3LVY4_PICST  ali  17  11.........RSNPKLWLAAVVATSVVTGYQIYQLYSQEDERSGKVSEAIEGSVAKKYGNKSIALTLSHSILNSKLPLNEILNENMIFILPPNLSEDDVTYNLDPSKSGIMPNFKLLKCSNIQGYVQVLKNLKPDMLLICSDDLGLS----FMNLSKDLNNFIKTIVNMDQNSE....... 177
10 4.000e-30UniRef50_G8BWQ5 Uncharacterized protein n=1 Tax=Tetrapisispora phaffii (strain ATCC 24235 / CBS 4417 / NBRC 1672 / NRRL Y-8282 / UCD 70-5) TaxID=1071  ali  18  21...................VLVGLGIAGYMWYRN-AGNEERDADEELATNEKKTMMQKHSSIIILSTSLLKDTSIDWNSILENDCVILVMPGLKFDNL------ANINKSYKYKIIHCDTMTGIWSCIKHLRLNTLYYIKEELG----PDYDDISVDLRNIFTTIRILDVDKDMNMQLT. 169
11 7.000e-30UniRef50_A0A1G4IQA8 LADA_0A08768g1_1 n=1 Tax=Lachancea dasiensis CBS 10888 TaxID=1266660 RepID=A0A1G4IQA8_9SACH  ali  21  4.....RKTRDQAPRLVFAGIVAAFLVGASYRWFN-------RGSSSLTQDG---NSGKNQSICLILSEGLWSKGVDWNRLSERDAVVILTPDFKEAPAQDLFP--------KHRVIRCSTHEGVWYVVRHLRKDVVIVEKQQIE--------QIPSDIYKFSRPIENL............ 140
12 5.000e-29UniRef50_E7Q0H9 Pex22p n=2 Tax=Saccharomyces cerevisiae TaxID=4932 RepID=E7Q0H9_YEASB  ali  100  1.................................................................MSKSIQGLPIKWEEYAADEVVLLVPTSHTDGSMKQAIXDAFRKTKNEHKIIYCDSMDGLWSCVXRLGKFQCILNSRDFTSSGGSDAAVVPEDIGRFVKFVVDSDXEDVLIDTLCN 115
13 6.000e-29UniRef50_A0A109UWZ7 HDL177Cp n=1 Tax=Eremothecium sinecaudum TaxID=45286 RepID=A0A109UWZ7_9SACH  ali  27  30....RRALFSRNATLLAAGLAIVGAFVAYSC-----------SQAKSKQEEQPKSDEYRGSKCIILTPRVREV-INLKSILKTNAVVLLPPGV-------LLHEEDIDEGNSYKVIPCDSWKGVWACVRHLRFDSLLLNSNSIP-------DTIPHDIARYVSQMVEL............ 167
14 9.000e-29UniRef50_C5DSJ5 ZYRO0C00638p n=3 Tax=Zygosaccharomyces rouxii TaxID=4956 RepID=C5DSJ5_ZYGRC  ali  32  44...............................................DNQGKSVQKTKGPSKAIIITKSVAQVGIDWIKLLQEDVVLLVPPGIPFLED----RDEEESPAHRYKIIRCDTMIGLWSCVKHLQKEQLLYVEEEIADG-------LPNDLTRYVKELVNCKDSEHLK..... 161
15 2.000e-27UniRef50_W0TB49 Peroxisome assembly protein 22 n=1 Tax=Kluyveromyces marxianus (strain DMKU3-1042) TaxID=1003335 RepID=W0TB49_KLUMD  ali  28  2....QSRHQKKIITATAIVCTLATAVGFIY-YKYCGSSPTP------------ESPGKQNSKCYVLSKSLYESVKDWETELYNDTVVLVPPECNGIANQLKA----IEPNFEHKVIQFKSWEALWSTVRHMKKTELIISEQYLPHK--------PPDIERFVKMTIIL............ 140
16 2.000e-27UniRef50_S6EU47 ZYBA0S07-05820g1_1 n=3 Tax=Zygosaccharomyces TaxID=4953 RepID=S6EU47_ZYGB2  ali  32  38...........................................SSNPERQGEEKNSKK-TSKTIVVTNTICQKEISWGDLLEKDVVLLVPPGVSF------LENPQDELSLHYKIIRCNKMAGLWSCVRHLRKDQLLYVAGEIA-------EDIPEDIPRYVKRVTALETNEQVRTSLS. 160
17 4.000e-27UniRef50_Q758W8 Peroxisome assembly protein 22 n=2 Tax=Saccharomycetaceae TaxID=4893 RepID=PEX22_ASHGO  ali  26  3....SKASRDQLRKYGAVSLASLLVAASIVAYRWWNAAP---------SIEVEKKLRRSVSRCVVVTQGIQNEDMIHDLLFEDTVMLLAPGCTAEGRLKSA------SRENAYKVISCTTWQSVWACVRHFRKHTLLVRTSEVPSG-------VPADIGGYVSDISDI............ 144
18 6.000e-27UniRef50_G8YPF8 Piso0_001169 protein n=2 Tax=Debaryomycetaceae TaxID=766764 RepID=G8YPF8_PICSO  ali  14  1MAGIQGRAFARNPKLWLXXXXXXXXXXXYKLYDSWASDDEKKTLQDNTIAKKDRKNYTKKSVALTLTHSVLSSKLPLIILNSENVTFILPPSLSLEDLEAIIDKDESGEAQNYKVLKSNNIQGYYSLIKSLRPDTLLVCADDMGID-----DHLPKEMNRFIKQIVTVEQNDQIFDQVTS 190
19 7.000e-27UniRef50_A0A1G4K3D0 LAMI_0F13498g1_1 n=1 Tax=Lachancea mirantina TaxID=1230905 RepID=A0A1G4K3D0_9SACH  ali  21  2.....SRKTTSRVKWALAGL---GAVATLFTYLYLTRERDETG-----TETDTDQLKSSAHRVILVTETVFKDYEKWRGELQNGCVLVIPPNRDYDSVLKLEN-----PKYESQIIKCDSMTGVWAVVRHLRKPLTLASED---------LDMIPDELSRFVGEIIEFTRHE........ 146
20 5.000e-26UniRef50_A0A060SYD8 ARAD1A11638p n=1 Tax=Blastobotrys adeninivorans TaxID=409370 RepID=A0A060SYD8_BLAAD  ali  18  3.....RRRKDPRWALVVAGATAVSAIG-YYVYSKY-------RQNPATTEHSKSGVTPDTKVAIVVNKSLVQSGVPLGNLLERNMVLILTPEVSDHANPDAFEDDQVASEAKYRMIPCETDVGVSHVLKHLRSALVVLPQQE---------SKIKDQIANFVGTVMEPDQFDLFND.... 163
21 6.000e-26UniRef50_H2ASY6 Uncharacterized protein n=1 Tax=Kazachstania africana (strain ATCC 22294 / BCRC 22015 / CBS 2517 / CECT 1963 / NBRC 1671 / NRRL Y-827  ali  28  62.........................................................KEPSRCVIVTKTLSEKDFDWQKFLKDDIVFIVVPGETFLDPSQGFE---IDPKVGYKIIRCDTILGVWSCVKSLKKDSLIVIGDEVEGG-------IPDDISNFTKNIRDVKSKEELLT.... 171
22 1.000e-25UniRef50_A7TPQ1 Uncharacterized protein n=1 Tax=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) TaxID=436907 RepID=A7TPQ1_VANPO  ali  33  64..........................................................QDSKTIILTKSLCNKGIDWKRLFDTNCVVLVTPGLKFQP-----SKDSVNSTNDYKIIHCDTMEGLFSCAKHLGKKKLLYVPDELESG-------LPVDISRFVREVVELDSDNLRKD.... 170
23 2.000e-25UniRef50_A0A1X7R4Y5 Similar to Saccharomyces cerevisiae YAL055W PEX22 Putative peroxisomal membrane protein required for import of peroxisomal protei  ali  30  33........................................KSSKEEAEEDKTSKTVHKYKSRCIIMTKSISESQIKWATIMKDNVVVIVAPKVEFPQLV--YPNQVIDNNDLFKIIHCDTNNGVWACVKSLKKDELLLVSHDLEH-------EIPTDIIRYVKHINDIKDTPNVVSYLNS 165
24 2.000e-24UniRef50_A0A0N7MKZ4 LAQU0S01e15962g1_1 n=1 Tax=Lachancea quebecensis TaxID=1654605 RepID=A0A0N7MKZ4_9SACH  ali  29  2...ASKKVKHRLVTLATIGAATAFAIGLSYSWIT-------RETRQPTNESDK-----SISRCIIFDVATQCC-VDWRQLEHLDIAVVVPPSINLEHAFAALKNIP-----KHKIIVCDTEEGVWSVVRHLRKDEVII--------GGYELSKIPDDIYRYSVPKHNLS........... 141
25 2.000e-24UniRef50_A0A1E3NGV8 Uncharacterized protein n=1 Tax=Pichia membranifaciens NRRL Y-2026 TaxID=763406 RepID=A0A1E3NGV8_9ASCO  ali  17  8...ASTSRGGRNPTLRLLAGSMALATLAYGSYKYLTSAAAVTGQKQEQSNRLRPKQRTDVSISLVVSKSVLRQMEQYNTEHEDGVVVVLYPGLTPADVECYFE---LDDDVRHRVLETGKEESVFHVLKQVGSDITLLCFDDFAIDRATIDKRFR--LDNVLRNVVSLDR-AFFIDYI.. 206
26 6.000e-24UniRef50_A0A1G4MCC8 LAFE_0D12596g1_1 n=1 Tax=Lachancea fermentati TaxID=4955 RepID=A0A1G4MCC8_LACFM  ali  32  49..............................................................TIIVTNTVYRAVDNWESILQDDVVLLIPPNCGFKDDLQSL-----DRDNSHKIIGCDTMEGLWSVTRHLRKKELVLLPGEL--------DGIPDDLARYCERIVRLGADNIAI..... 148
27 2.000e-23UniRef50_A0A1G4J3V3 LANO_0C00760g1_1 n=1 Tax=Lachancea nothofagi CBS 11611 TaxID=1266666 RepID=A0A1G4J3V3_9SACH  ali  29  32.............................................KKRTSSADANYRKPKSICVVLTESLF-SGIDWAKLASIDSVIIQPPNFKVTIDQGVFP--------EHRIITCETNEGVWSVVRHLRKDELVVRTEEF--------QQIPNDIHRFSKPTEDL............ 137
28 3.000e-23UniRef50_Q6FP25 Peroxisome assembly protein 22 n=2 Tax=Candida glabrata TaxID=5478 RepID=PEX22_CANGA  ali  28  40.....................................NQQDDGTAQDNQIKEKPKKRLHRSLCVIISNKLSNLELDWDEILQEDIVFLILPSVND------FQNSNDIKTDTHKIINCDTELGLWACVRTLKKNELLVCADDI---------KVPDDIGRYCDKISQIKSSQQLMNYL.. 171
29 9.000e-23UniRef50_I6NCM2 Uncharacterized protein n=1 Tax=Eremothecium cymbalariae (strain CBS 270.75 / DBVPG 7215 / KCTC 17166 / NRRL Y-17582) TaxID=931890 Re  ali  27  33............................................NSSDTPEKKRNYKEYRRKCIIWSPAVEQSSNLETILLEDSVILIPPESGSLQDLLA------VGNENAYKIIKCDTWQGVWSCVRHLRAHYLLLKECEIP-------EAIPVDILNYVNKIISI............ 143
30 4.000e-22UniRef50_G0W5E6 Uncharacterized protein n=1 Tax=Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) TaxID=1  ali  25  12.....GSNNNKMVRTLITGLAITTGLLCWAWYKNSVASTQNKDESGKEKNTVIDTDNKKPSKCIIVTEQINNTNVNWEKLLKKDVVLLLSPDIS---KIHELNEDNVEKANLSKVIHCETGLGMWACVKSLRKDQLICMPSDLEDG-------IPDDIKHFVKQIIAVDSEESFK..... 186
31 6.000e-22UniRef50_A0A0C7NGN2 LALA0S14e01442g1_1 n=3 Tax=Lachancea TaxID=300275 RepID=A0A0C7NGN2_9SACH  ali  28  41.................................................PTIDETEQNSISACIVFTEDMYESGLDWEGLISMQAVVILPPKITLRSTVVQFPVS--------QIIECGTEDGVWSVVRHLRKDIVVVSPLSLNS--------VPADIYRFSEPVTEL............ 143
32 7.000e-22UniRef50_G9A0A3 Uncharacterized protein n=1 Tax=Torulaspora delbrueckii (strain ATCC 10662 / CBS 1146 / NBRC 0425 / NCYC 2629 / NRRL Y-866) TaxID=107  ali  33  34...........................................SGPPVSDNKDSSKR--KSRCVVITDSVASKEFNWDDFLTRDIVLLVAPGIHF-------------SQESFKVIHCDTMVGLWSCVRHLKKDQLLLEQSEINES-------IPVDIPRYTKEILNIS........... 138
33 1.000e-21UniRef50_W6MPJ8 Uncharacterized protein n=1 Tax=Kuraishia capsulata CBS 1993 TaxID=1382522 RepID=W6MPJ8_9ASCO  ali  20  3.........RGNRRYVYPVLALAGLISVSVAYAYRTRI----------QVSQKQRKYASKRVSIVLSESVVEARLPLEELSNQDIVFILHPKVTRESLQ-------LQNAQQFKFIECNSEEGVIHVLKHLRGLVNFICFEDFESLKPEDL-----HLDTFLVETRELAKDP........ 145
34 1.000e-20UniRef50_A0A1V2LKC3 Uncharacterized protein n=1 Tax=Pichia kudriavzevii TaxID=4909 RepID=A0A1V2LKC3_PICKU  ali  12  1MTPRRQQRYK------VAGASIVVALMAYATYKYWTVSENESTSAQKQESGGDTTEYESTSIALVITPAILDKEYNSNQENQIDIVTLAVVLWPGLQIEDLENYFVVGPPIRNRILRVEKMESISIILRHLNKDLNLVVEG....................................... 151
35 1.000e-20UniRef50_UPI000D553DC6 T9SS C-terminal target domain-containing protein n=1 Tax=Dysgonomonas sp. Marseille-P4361 TaxID=2161820 RepID=UPI000D553DC6 :_  ali  23  619.....EVNNDKDRTSDRMSVVFNDAATTYYAYDTSKGISDKFEEFVPEYNGEKTKTRYEGSKSIIFTKSTEGKQLLGNAIPADGLFFMPPSSTEELSLKF------------YGIENLESVPGVWLIDRHLDKKVRIYPGDEYKVSDVSTTKTYTADNNRFVLRFYDGDSDDIITN.... 785
36 6.000e-19UniRef50_A5DX24 Uncharacterized protein n=2 Tax=Candida/Lodderomyces clade TaxID=1535325 RepID=A5DX24_LODEL  ali  14  73...............................YTNNKNHSSLTQTQLERKVYTISKKFLNKSIAITLSSSFLSSQLPLVDLITSNLIYIIPPNLNEEDNIVLQNKQELQLPPNFKILKCSNIQGYLQILKNLKPDCLLLCSDDLGISNFNGV--VLRDLSNFIKNIINIDQNQDVLSQI.. 227
37 7.000e-19UniRef50_Q59KM6 Pex22p n=2 Tax=cellular organisms TaxID=131567 RepID=Q59KM6_CANAL  ali  15  2MSRKASRNPKLYVSALIATSAIALTYKLYSTYLAPTPTPTNKDKKQRELDGSISKRYSNKSIAITLSSTFLSSNLPLNEILSENMIFIIPPNLNEDDLPTNTNTSFYKDQSNFKLLKCSNFQGYLQILKNLKPDLLLLCSDDLGINFKKLQSDL---LNNLKLDFINIDQNIDALIQLES 204
38 9.000e-19UniRef50_I2GVS9 Uncharacterized protein n=1 Tax=Tetrapisispora blattae (strain ATCC 34711 / CBS 6284 / DSM 70876 / NBRC 10599 / NRRL Y-10934 / UCD 77  ali  28  43..................................................SKKIEYDTKYSKCFVVTKSIKDK-YNWNRVLQGNSVAILAPNIEIG---------TIDENLKHKIVVCSLEDSIWPVIKHLKKDCLIISTDDF--------KEIPNDIPRFVKIILDPTIDNE....... 147
39 1.000e-18UniRef50_Q6CLU6 Peroxisome assembly protein 22 n=1 Tax=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37  ali  24  47.........................................RGQRNPNIRDVKPK-----SKCYVLTQDLFDKIENWQEELSKDSVMLVLPEVAHLGNHLKLQLSSI----EHKIVIFNNSSAVWSAVRHLKKYELVISRD--------KTSDMPVDLRRYVGQISHI............ 156
40 6.000e-18UniRef50_Q9UW82 Peroxisome assembly protein 22 n=4 Tax=Komagataella TaxID=460517 RepID=PEX22_PICPA  ali  16  2........KSTKRNTFFGLAALGALGLGYSVYKSFITSDKPSSLINL-GINQERKSYTRQKVAIIVSESILAIQLPIQEILKNDVVFVLAPTIAKD---EFLRENEVDSGLSFKVIETGTAIGCFHVLKHIKATYNIFNLHDFSTKTSSDNEQLTFDLEEYVNLHLNNFLQNVV...... 168
41 9.000e-18UniRef50_A0A0A8LAM9 WGS project CCBQ000000000 data, contig 00272 n=1 Tax=Kluyveromyces dobzhanskii CBS 2104 TaxID=1427455 RepID=A0A0A8LAM9_9SACH  ali  24  37..................................................TTPKSELKRNAKCFILTPEMFSQGINWKQEVSHGSVVLVSSELNNLADELK----SILPSHQHRIIIVDNPKAIWSAVRHLKKYELIISRNQISS--------MPADIRRYVSTISVV............ 142
42 3.000e-17UniRef50_A0A1E4SUI1 Uncharacterized protein n=1 Tax=[Candida] arabinofermentans NRRL YB-2248 TaxID=983967 RepID=A0A1E4SUI1_9ASCO  ali  13  1MPPKSRQSFKLLTTLVFLGGL------AYSTYNYIQSHSLDQPQSQSQSQSTKTKIPLNRSISLVITPNILKSDLIDLLENYSNLTIIFHPSI--------LDIPNVPRSYKYRLIQTLKEESIFHVLKQINSTMNLIPFKQLSMSSKEIEN---FHLDRFLSGLIDITGDA-IDDYI.. 165
43 4.000e-17UniRef50_A2T0X6 Peroxin 22 n=3 Tax=Ogataea TaxID=461281 RepID=A2T0X6_PICAN  ali  13  2.....SRNSRKLWTRAVAATVVAGLVIGGAWALKTI----NPGLFEEPAKTSEASKSNGQSVSLVLTQ--KDLDFFSAAYLNENLTVILHPSVDKSEFLSRFNVQ----RNSHQVIQVRTEESIFHVLKQLSSNINLITLGNLEMSANEVE---TFHLDKFLTNVHEVDR---INDYI.. 160
44 5.000e-17UniRef50_A0A0J9XBL2 Uncharacterized protein n=1 Tax=Geotrichum candidum TaxID=1173061 RepID=A0A0J9XBL2_GEOCN  ali  14  62......................................................RTKSKRHIAVLVTQACLEHGLPISLLLEKYAVLLLAPDL--VDLAHPRLVDQVPAAEHYRLIRCESYKGALHVLKHLRPALAMLPPADVCGIGL-------NDLDNFAQQTEVISDESV....... 173
45 4.000e-16UniRef50_A0A1V2L9Y6 Peroxisome assembly protein 22 n=1 Tax=Cyberlindnera fabianii TaxID=36022 RepID=A0A1V2L9Y6_CYBFA  ali  25  5........RQRRRQLGIIGGLLVLSAGAYSLYKYIYSSNQP----SPQQSSTTDEKYTRKHITIILTDSIISSKLPINEILTKDVVLVIPPELTVDDL-----NEPLDPTIAYKAIEC-------------------------------------KGIERYVGEIIELDQNVSVIN.... 128
46 1.000e-14UniRef50_Q6C2P3 YALI0F06226p n=2 Tax=Yarrowia lipolytica TaxID=4952 RepID=Q6C2P3_YARLI  ali  12  59.........................................................TNSKITVVVSQELVQSQLDFKHLMSPNLVVIVPPMVA--NKFHRALKSSVGHDHGVKVIRCDTDVGVIHVIKHIRPDLALI--------ADGVGDNIQGEIKRFVGSSEALSGDVNL...... 168
47 3.000e-13UniRef50_A0A1Z8JJ09 Uncharacterized protein n=1 Tax=Pichia kudriavzevii TaxID=4909 RepID=A0A1Z8JJ09_PICKU  ali  12  1MTPRRQQRYK------VAGASIVVALMAYATYKYWTVSENEFTSAQ-KQDLLRPKQQLSTSIALVITPAILDKEYNSNQENQIDIVTLAVVLWPGLQIEDLENYFVVGPPIRNRILRT.............................................................. 120
48 7.000e-13UniRef50_A0A2T0FL08 Uncharacterized protein n=1 Tax=Wickerhamiella sorbophila TaxID=45607 RepID=A0A2T0FL08_9ASCO  ali  19  31...........................................SRSYTSDEIPAVKKLGDSVCVVVSES-----KDYSKLLQAYPRLVIVGAQSIALKS--------GTADDYRLIETETAEGWIHVVKHLRPEKLVV-EDELS-------PELPAGIERFVKKILT............. 133
49 1.000e-11UniRef50_A0A1E3PI78 Uncharacterized protein n=1 Tax=Nadsonia fulvescens var. elongata DSM 6958 TaxID=857566 RepID=A0A1E3PI78_9ASCO  ali  20  89...................................................................................NIVVVLTKEVSIDNTPLA---SQIPRGMEHKIIPCETTIGIIHILKHLKPQYVVLAAD--------TASYVERDIKGFVGQITSLTGDMETDNQI.. 172
50 1.000e-06UniRef50_A0A099NJ94 Uncharacterized protein n=2 Tax=Pichia kudriavzevii TaxID=4909 RepID=A0A099NJ94_PICKU  ali  19  1MTPRRQQRYK------VAGASIVVALMAYATYKYWTVSENGSTSAQKQESGGDTNEYELRPK...................................................................................................................... 56

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Li Z, and Godzik A. Modeling and Analyzing Three-Dimensional Structures of Human Disease Proteins Pacific Symposium on Biocomputing 11:439-450(2006) [PDF]