current user: public

If you have questions about the server, please let us know.

Query: gi|16758996|ref|NP_454613.1| homoserine kinase (STY0003) [Salmonella enterica subsp. enterica serovar Typhi str. CT18], from S.typhi

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .
# Score Template Links and tools%idFirst MVKVYAPASSANMSVGFDVLGAAVTPVDGTLLGDVVSVEAADHFRLHNLGRFADKLPPEPRENIVYQCWERFCQALGKTIPVAMTLEKNMPIGSGLGSSACSVVAALVAMNEHCGKPLNDTRLLALMGELEGRISGSIHYDNVAPCFLGGMQLMIEENGIISQQVPGFDEWLWVLAYPGIKVSTAEARAILPAQYRRQDCIAHGRHLAGFIHACYSRQPQLAAALMKDVIAEPYRARLLPGFSQARQAVSEIGALASGISGSGPTLFALCDKPETAQRVADWLSKHYLQNQEGFVHICRLDTAGARVVGLast
1 -96.900[E] COG0083 Homoserine kinase  ali follow..  70  3.VVVYAPASIGNVSVGFDVLGAAVSPIDGTLLGDRVKVEAAEAFTLKTAGRFVDKLPANPQENIVYDCWQVFARELEKKKPLTMTLEKNMPIGSGLGSSACSIVAALDALNQFHASPLDETELLALMGEMEGKISGSIHYDNVAPCYLGGVQLMLEELGIISQSVPSFDDWYWVMAYPGIKVSTAEARAILPAQYRRQDIVAHGRYLAGFIHACHTQQPELAAKMIKDVIAEPYREKLLPGFAKARNYAASAGALATGISGSGPTLFSVCKEQAVAERVARWLEQNYVQNEEGFVHICRLDKQGSKVTG 315
2 -81.500[E] KOG1537 Homoserine kinase  ali follow..  23  4.FQIKVPASSANIGPGFDVLGMSLEEYMTLDVE---VSTESGPCVLTYEGDGKEHVSLDVQKNMITQTSLYVLRCNNISYATKIHVINPIPLGRGMGSSGSAAIAGVMLANEIAKLGLSKLQMMDYVLMIER------HPDNVMASMMGGFVGSFPKSLGTFARLPWASELKAIVVIPEFHLATSKARSVLPTSYGRTDVVYNLQRLALLTTALGQTPPHLVYEVMKDKVHQPYRASLIPGLQNILATLNQPGLCGICLSGAGPTVLALATGN--FDEIAHAMLSIFEKGVKCRYLVLSPAFDGATV.. 335
3 -55.100[EH] COG1685 Archaeal shikimate kinase  ali follow..  14  5.GRASSAITIVNAFATGKGAAIGIELWTEARVRVTGD---------EVRGKIVVKGEEFKDYRLVNSVISVLREVTGEPFGVRFEIHSDIPVGKGLKSSSAAANSLTKALVEALRLNIDDLSIVKLGVEAAKRAGVTIAFDDACASYFGGLCIT-DNYEMEILVKREINPETVVLLIPRETVLTESLKGVDFSKIPFIGEALRLAISGEWKKAL----------VINGLLYSTFLGYDLA----PMREALKLGA-FVGLCGKGPAFFAIADEPEEIIEAWSSFGDVIATSLR................. 274
4 -52.000[R] COG1907 Predicted archaeal sugar kinases  ali follow..  14  1MLRLRTPSRNGSIGRVDGGVGLALE-----EPHIEIKAKESETFVLK-----------GEPINRERFEIAAAKMAEYCGRGAEIEVVSDYDAHVGLGSGTQISLAVGRAFSELYGLNLTTRQIAEIMGRGGT------SGIGVAVFDHGGLVVASRAKPAPMIARLDFPDWNVVLAIPDLKFFGEREVNLFQKSCPVPLEDVRHLILMKMLPAVVEADLDEFGKALKRIQELGFKKAEVEQYGELIKGCFD-LADCIGMSSTGPTVYAITDSN--AGGIERSLRDYFAEGYECRTIVTKARNRGVEI.. 311
5 -47.600[I] COG1947 4-diphosphocytidyl-2C-methyl-D-erythritol 2-phosphate synthase  ali follow..  17  2RTQWPSPA---KLNLFLYITGQRADGYHTLQYGDTISIELRDDGDIRLLTPVE---GVEHEDNLIVRAARLLMKTAADSSGANISIDKRLPMXGGLGGGSSNAATVLVALNHLWQCGLSMDELAEMGLTLGADV----------PVFVRGHAAFAEGVGEILTPVDP-PEKWYLVAHPGVSIPTPVIFKDPELPRNTP----------------KRSIETLLKCEFSNDC-EVIARKRFREVDAVLSWLLEYAP--SRLTGTGACVFAEFDTESEARQVLEQAPEWLN..................... 266
6 -44.700[Q] COG4542 Protein involved in propanediol utilization, and related proteins (includes coumermycin biosynthetic protein), possible kinase  ali follow..  11  44SSDALCCGTFGELLQGQLPVGSIARDSHFL---VTMPIALFARAHFIPIAGTRSVTVYPSHKVKAKRLAENLVTALSAT-GGVLLLQSELPEGKGLASSSADLVATARSIACCFRRRVRTSLIEKLMAEIEPS----------DGVMYPGVVAYQQRACRLLSFLGQMPPLAIVGIDEGGTVETVDYDQRRG-EISTNQRAEYQELLNRARIAIPWGDAATIGKIATSSALLHQERTPKKHLNSMLKACEATSALGVIVAHSGTMIGILLDRMDFPRKLRSVLARVAPFYNSPKIYLT........... 328
7 -40.400[R] COG1829 Predicted archaeal kinase (sugar kinase superfamily)  ali follow..  13  2LVRAFVPAHITAFF-GSLGAGVNLS------RGTNVFISFEESLERHVHVALNGEPVKREDAKVTFHVIDKMLPQEY-VGEVEVWQYFDYPTGHGFGNSGGGALGTALCLAYKFR--RTLLSAAKVAHEAE--VLNRGGLGDIVAQLAGGVEVRIKEGGPGVAIVNLIVEGFKVLTISLGRLSTREVLD------SDVVEKIKVEGQKSLENLLANPTLETLMREARR--FAEVTGLMDDELKEIAREVDKVISLPSSMIMLGKGIFAMVRN-EEVERVKELVKDL-----GVPYDIAEIYWGKPTVG. 295
8 -31.800[I] COG1577 Mevalonate kinase  ali follow..  18  7..............................AGKIKVLIEALESGNYSSIKSDVYDGMLYDAPDHLKSLVNRFVELNNITEPLAVTIQTNLPPSRGLGSSAAVAVAFVRASYDFLGKSLTKEELIEKANWAEQIAHGKPSGIDTQTIVSGKPVWFQKGHAETLKTLSL--DGYMVVIDTGVKGSTRQAVEDVHKLCEDPQYMSHVKHIGKLVDVIEHHNFEALADIFNECHADLKALTV-DKIEQLMKIGKENGAIAGKLTGAG-SMLLLAKDLPTAKNIVKAVEKA....................... 267
9 -31.500[R] COG2605 Predicted kinase related to galactokinase and mevalonate kinase  ali follow..  15  1MLISRAPVRISFFGGGTDY-GAVLATAIDKFSYVTASPFLSHLFDYSIRVSYRKVELVKNPSEMEHVVFRECLKFCGLEKDIELHNVADLPAFTGLGSSSAFTVSLLQALHSFKGEFIRPLDLAYEAIYVERHLVKDK-QDQLM-AAMGGFNLVRKEDDIVVSRVTMAPERMAEFEEHIFIVFTGIKRRAANVVEKQLKRVGDNRETLKLMRAMVDKGWDILTSAFGELLDQAWQAKR-GDIDRIYQQGREAGAWGGKLLGAG-GFMLFFAPPSVHPRLAETFKDH-------QVLSVKINAPGSQII. 324
10 -24.000[I] KOG1511 Mevalonate kinase MVK/ERG12  ali follow..  14  5.LIVSSPGKTILFG-GATALAAAVS------LRSYCKLQTTNNNEIVIVMSDIGTERRWNLQSLMLCTLYLFTSLSSPSQGCTLTISSQVPLGAGLGSSATISVVVATSLLLAFGNNKALALIEAWSFLGECCIHGTPSGIDNAVATNGGLIAFRKATAAMKEFLKPKDTLSVMITDTKQPKSTKKL-TVIDSIIDAIDGISKSAVLALTSESDKNSSAKKLGEFINQKLLECLGVS--YSIDRVLQATKSIGWTKLTGAGGGGCTITLLTPECKEEEFKLCKESLLAHK--NSIYDVQLGGPGVSVVT 375
11 -22.700[I] COG3407 Mevalonate pyrophosphate decarboxylase  ali follow..  31IHYGSGYPITGLI-ANFPSISLNTD-----VSEAYSAFMISKDNGNDTAVVEGENSPNITKKAMTAINVFKNLYDIKGSFHFYLRIKRKYAGAKGLGESAAVAAAASRSLVSALFEKEALKDSNFISIVAR------LASGSGSKSVAGPLSLWLTAPASFSLNLRKEIDDIFLCAVPIRDSVSTAEAHNTVIKSPFYQQWSRLQFDAVYSIISRGGYSAQIIENATTLMHSLLWNQDTLRAMGIVEDMRRIGRLIGFSIDTGPSVLVMADREDLIKEFKERYN......................... 329
12 -20.200[G] COG0153 Galactokinase  ali follow..  14  23...IQAPGRVNLIGEHTD--GFVLPCAIDYQTVISCAPRDDRKVRVMAADYENQLDEFSLDANYVRGVVKHLQLRNNSFGGVDMVISGNVPQGAGLSSSASLEVAVGTVLQQLYHLPLDGAQIALNGQEAENQFVGCN--DQLISAL--DHALLIDCRSLGTKAVSMPKGVAVVIINSNFKFQQPALRDVTIEEFNARHILTENARTVEAASALEQGDLKRMGELMAESMRDDFEIT-VPQIDTLVEIVKAGDKGGVRMTGGG-CIVALIP-EELVPAVQQAVAEQYEAKTGIKETFYVCKSQGAGQC. 382
13 -18.400[I] KOG4519 Phosphomevalonate kinase  ali follow..  11  4LRAFSAPGKALVLDTKYEAFVVGLSARMHAVAHPYGSLQGSDKFEVRVKSKQFKDGIGGSKNPFIEKVIANVFSYFKPNMDSFHSHRIEEVPKTGLGSSAGLVTVLTTALASFFVVDKYREVIHNLAQVAHCQAQGKI---DVAAAAYGSIRVDEEDWNITIKSNHLPSGLTLWMGDIKNGSETVKLVQKVKNWYDSHMPESLKHANSRFMDGLSKPEITEVRDAVATKITKESGADI-PVQTSLLDDCQTLGVLTCLIPGAGDAIAVITQDVDLRAQTANDKRFS-----KVQWLDVTQADWGVRK.. 441
14 -18.400[I] COG3890 Phosphomevalonate kinase  ali follow..  11  4LRAFSAPGKALVLDTKYEAFVVGLSARMHAVAHPYGSLQGSDKFEVRVKSKQFKDGIGGSKNPFIEKVIANVFSYFKPNMDSFHSHRIEEVPKTGLGSSAGLVTVLTTALASFFVVDKYREVIHNLAQVAHCQAQGKI---DVAAAAYGSIRVDEEDWNITIKSNHLPSGLTLWMGDIKNGSETVKLVQKVKNWYDSHMPESLKHANSRFMDGLSKPEITEVRDAVATKITKESGADI-PVQTSLLDDCQTLGVLTCLIPGAGDAIAVITQDVDLRAQTANDKRFS-----KVQWLDVTQADWGVRK.. 441
15 -16.900[I] KOG2833 Mevalonate pyrophosphate decarboxylase  ali follow..  13  9MVTAQTPTNIAVI-PVNDSISVTLDPDHLCTVTTVAVSPAFDRDRMWLNGKEISLSGSRYQNCLDMEKGIKIRKKDWEKLNLHIASHNNFPTAAGLASSAAGFACLVFSLAKLMNVDEDPSHLSAIARQGSG---------SACRSLFGGFVKKEDGSDSVAVQLADEKHWDLVIIIAVETSSTSGMRESVETSLLLQHRAKEVKRILQMEEAIKNRDFASFTQLTCTFYMNDTSHRIISLVEKWNR--SEGTPQVAYTFDAGPNAVLIARNRKVAVQLLQGLLYYFPP.................... 332

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.