current user: public

If you have questions about the server, please let us know.

Query: gi|16759001|ref|NP_454618.1| molybdenum cofactor biosynthesis protein MogA (STY0008) [Salmonella enterica subsp. enterica serovar Typhi str. CT18], from S.typhi

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .
# Score Template Links and tools%idFirst MNTLRIGLVSISDRASSGVYQDKGIPALEEWLASALTTPFELQTRLIPDEQAIIEQTLCELVDEMSCHLVLTTGGTGPARRDVTPDATLAIADREMPGFGEQMRQISLRFVPTAILSRQVGVIRKQALILNLPGQPKSIKETLEGVKADDGSVSVPGIFASVPYCIQLLDGPYVETAPEVVAAFRPKSARRENMSSLast
1 -73.000[H] COG0521 Molybdopterin biosynthesis enzymes  ali follow..  75  3.AVLKIGLVSVSDRASQGVYADQGIPELQAWLEKALCEPFEIETRLIPDEQDRIEQTLCELVDDYHCHLVLTTGGTGPAKRDVTPDATLAVADREMPGFGEQMRQVSLHFVPTAILSRQVGVIRKNSLILNLPGQPKAIKETLEGVKDENGQVIVKGIFSAVPYCLQLINGIYIDTHPDVIESFRPKSARR..... 192
2 -23.300[R] COG1058 Predicted nucleotide-utilizing enzyme related to molybdopterin-biosynthesis enzyme MoeA  ali follow..  22  7.QAVRAAMLAIGDELLSGRTKDRNIGHLADVLTAAG--IDLKEVRIVPDEEDAIVAALNALRAN--YDYVFTSGGIGPTHDDITADAVSTAFGVPC--YARRGLEFTESRKRMARMPQGSQHIPNPV-VYVMAGVPSVFQAMLDNVL................................................. 168
3 -20.100[EH] KOG2644 3`-phosphoadenosine 5`-phosphosulfate sulfotransferase (PAPS reductase)/FAD synthetase and related enzymes  ali follow..  16  12.QRKTAAILVIGDEILKGTTRDTNSHFLCKRLHKLG--VNIRKISVIGDDISEISREVQSASGA--YDYVITSGGVGPTHDDKTYLGLAHAFTDQMQFSDEIREAVRLATEKLCTIPKMSQLLWGTQ-VVALPGVPKFCERAFDELQDQLF............................................. 196
4 -19.000[H] COG0303 Molybdopterin biosynthesis enzyme  ali follow..  14  183VRKPVVGIIATGTELLNGKIRNSNASMVYAQAIEAG--ATPLYLGKISDELDKSFAAVKEAMKK--VDFLITTGGVSVGDFDFLPAIYEKL------GADVLFNKVAMR-------SVTTVAHANDMLLFGLSGNPSACYVGFELFVKPIIQTWL......................................... 329
5 -8.160[IT] KOG4435 Predicted lipid kinase  ali follow..  12  65.TRPKRVFVLVNVEGNSRGCFDQFNKNALPLFHLAG-----VQVDVVKADNQAQLEALAGAVDTQEADILYVVGGDG-------------TIGTVVTGI---FRNREKAQLPVGFYPGGYDNLWLKRMLPSVFENSDDVRHACETAM................................................. 189
6 -6.460[L] COG0323 DNA mismatch repair enzyme (predicted ATPase)  ali follow..  16  1MSHIIELPEMLANQIAAGEVIERPASVVKE---------------LVENAIDAGSSQIIIEIEEAGLKKVITDNGHGIAHDEVE--ALRRHATSKIKNQADLFRIRTLGFRGEALPS--IASVSVLTLLTAVDGASHGTKLVAR.................................................... 127
7 -6.330[IT] KOG1116 Sphingosine kinase, involved in sphingolipid metabolism  ali follow..  12  189....KQLLILLNPKSGSGKGRELFQKQVAPLLTEAEVQYDL----QITTHPQYAKEFVRTRRDLTRYSGIVVASGDGL-------EVLNGLMERM--------WRRACRELPLGIIPCGSGNGLAKSVCNEPYEPKPILHATLTCM.................................................. 318
8 -6.060[M] COG2825 Outer membrane protein  ali follow..  12  76....DGSTMKASDRTKLENEVMKQRETFSTKAQAFEQDNRRRQAEERNKILSRIQDAVKSVATKGGYDVVIDANAVAYADSDITADVLKQV......................................................................................................... 164
9 -6.000[R] KOG1541 Predicted protein carboxyl methylase  ali follow..  20  33...................................................AKMTLRALELLNLQPCSFILDIGGSGLSGEDISPSMLATGLSRELEG--DLMLQDMGTGIPFR--AGSFDAAISISAIQWLCNADTSYNDPKQRL.................................................. 137
10 -5.790[S] COG4333 Uncharacterized protein conserved in bacteria  ali follow..  27....YTLFIGLNPSYADAEKDDRTLSRCISFAKSWGYGGVYMSDPIGKDNDSHLIRLVSG------AGLVVAAWGNEGRHLKRSTTVRQLLPES...................................................................................................... 127

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.