current user: public

If you have questions about the server, please let us know.

Query: gi|16759003|ref|NP_454620.1| hypothetical protein (STY0010) [Salmonella enterica subsp. enterica serovar Typhi str. CT18], from S.typhi

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .
# Score Template Links and tools%idFirst MNVTYLHDEDLDFLQHCSEEQLADFARLLTHNEKGKARLSSVLSHNELFKAMEGHPEQHRRNWQLIAGEFQHYGGDSIANKLRGHGKQYRAILLDVAKRLKLKADKSMSTFEIEQQLLEHFLRHTWQKMDAAHKQEFLQAVDAKVSELEELLPLLMKDRSLAKGVSHLLSTQLTRILRTHAAMSILGHGLLRGAGLGGPVGAALNGVKAMSGSAYRVTIPAVLQIACLRRMMAAVQALast
1 -81.000[S] COG4735 Uncharacterized protein conserved in bacteria  ali follow..  87  1MNVNYLNDSDLDFLQHCSEEQLANFARLLTHNEKGKTRLSSVLMRNELFKSMEGHPEQHRRNWQLIAGELQHFGGDSIANKLRGHGKLYRAILLDVSKRLKLKADKEMSTFEIEQQLLEQFLRNTWKKMDEEHKQEFLHAVDARVNELEELLPLLMKDKLLAKGVSHLLSSQLTRILRTHAAMSVLGHGLLRGAGLGGPVGAALNGVKAVSGSAYRVTIPAVLQIACLRRMVSATQV 237
2 -7.140[K] KOG2652 RNA polymerase II transcription initiation factor TFIIA, large chain  ali follow..  21  3.........................................................................CLNPVPKL-------YRSVIEDVIEGVRNLFAE----EGIEEQVLKDL-KQLWEKVLQSKATE..................................................................................................... 54
3 -7.060[R] COG2406 Protein distantly related to bacterial ferritins  ali follow..  13  13...GVDVDKLLELLIKNAAAELTTYYYYTILR-----ANLIGLEGETIKEIAEVARIEDRNHFEALVPRIYELGGKTVQEILRVLVAAERCAVKGYTEICNMTAGKDHRTYELSLAILESWFSEFLGEGPSG......................................................................................................... 165
4 -6.920[K] COG5149 Transcription initiation factor IIA, large chain  ali follow..  13  1........................................................................MSNSIVGEV-------YHHVILDVIANSRSDFEE----NGVDDATLRELQNLWQSKLVATDVAT..................................................................................................... 53
5 -6.540[T] KOG0027 Calmodulin and related proteins (EF-Hand superfamily)  ali follow..  67...AIGNEELKQAMISINKAEIDNVIKEVDADGNGEIDFEEACMKKSQNIVKSTNEELIRECFEIFDQD--IITENEFKYIAKEFGDFDDELAEKVFRELDVSANGHLSADQ-----FATIVEDYLLNDPKHDIDTGDSDV................................................................................................ 206
6 -6.460[S] KOG3819 Uncharacterized conserved proteins (Hepatitis delta antigen-interacting protein A)  ali follow..  13  45..LQWSKEELIRSLRRAEAEKVSAMLDHSNLIREVNRRLQLHLGEIRGLKDINQK-DDDRQKGKRVSREWQRLGRYT-AGVMHKEVALYLQKLKDLEVK-----QEEVVKENMELKELCVLLDEEKGAGCAGSRCSIDSQ................................................................................................. 190
7 -6.400[A] KOG2669 Regulator of nuclear mRNA  ali follow..  13  1MSSPFSEEILIDNLAKLNSTQIQTLSQWCIV-----------------------HRSEAELVVTTWEKQFHSTQIGQKVPLL------Y--LANDILQNSK---RQGNEFVQEFWKVLPGALKDIVSLGDDYGKGVVSRLVNI.............................................................................................. 111
8 -6.380[TZ] KOG2546 Abl interactor ABI-1, contains SH3 domain  ali follow..  12  1MLTPMASENIMDELASLIRTEIPDGRQSLRDSYTNLERVADYCEDTYYRADNKKAA----------LEATKNYTTQSLAS------VAYQTLAYSYMQLLEL---QAQQLGEMESQMIAQTVHIHKEKVARREIGVLTAN................................................................................................. 127
9 -6.240[S] COG3877 Uncharacterized protein conserved in bacteria  ali follow..  14  23.EVTVRGRFRASPFDFLDKDELEFVILFFRARG-------------------------------------------NLKEIERYTGQGYFALLEKILEKMNLQPLGEMKEEISEEDLFKQVKE---GKIGVEEALEILKKRKKGGES.......................................................................................... 125
10 -6.150[P] COG2193 Bacterioferritin (cytochrome b1)  ali follow..  11  1MKGD---TKVIERLNEALFLELGAVNQYWLHY-----RLLNDWGFTKLAKKERAESIEEMQHADKIIDRIIFLEGQNVKEVLEADLAGEYDARTSYKKSRDICSEAGDYVS---MKLFEALLID--EEGHIDFLETQLELLG............................................................................................... 142

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.