current user: public

If you have questions about the server, please let us know.

Query: gi|16759004|ref|NP_454621.1|(removed signalp:1-23) hypothetical protein (STY0011) [Salmonella enterica subsp. enterica serovar Typhi str. CT18], from S.typhi

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst NDHKILGVIAMPRNETNDLALKIPVCRIVKRIQLTADHGDIELSGASVYFKTARSASQSLNVPSSIKEGQTTGWININSDNDNKRCVSKITFSGHTVNSSDMARLKVIGDDLast
1 -6.680[S] COG4425 Predicted membrane protein  ali follow..  285.TWESLGREFVAEGPAGTQISAFTHRPAKEPLRVYARVGGFERKVLLVVIPTGTGWIDPEALDTEYLHDGDIASVAVQGVETARALFEAVYGYWTTLPKETRPKLYLHGLS 434
2 -5.770[G] COG4724 Endo-beta-N-acetylglucosaminidase D  ali follow..  436ESFYGGSSLKLSGDLSKEKTNLLIEKDTEIQLTYKTPVKKHGL-KVGISFLDDPDEFIFFDLKKQGDHEWVTEKVKLKKHKG--NQIAAISLYVESDQRITDYQLYV-GE. 549
3 -5.350[R] COG2229 Predicted GTPase  ali follow..  1..........................................MRENKIIFTGPVGVGKTTAIAAISDEALVQTDASASDMTLDRKRNTTVAMDYGAISLDEDTKVHLYG.. 67
4 -5.280[K] COG5450 Transcription regulator of the Arc/MetJ class  ali follow..  21.DWSQIPPQQIRL----DELVTTTTVLALDRLLSEDSTFYGDLFPHAVKWRGTDGLHRAVRAALRNRTVLHARVFDMDASPGGRRS......................... 105
5 -5.110[O] KOG1730 Thioredoxin-like protein  ali follow..  12  63......RSKFVESDADEELLFNIPFTGKLKGIIIMGEDDDSHPSEMRLYKNIPQDDTEREPDQTFSLNRDLTGELEYATKISRFSNVYHLSIHISKNFGADTTKVFLRGE. 174
6 -4.800[C] COG3052 Citrate lyase, gamma subunit  ali follow..  11  2..............................KINQLAVAGTLESGDVMIRIAPLDTQDIDLQINSSVEKQFGEAIRATILEVLSRYDVRGVQLNVDDKGA............ 70
7 -4.620[S] COG3430 Uncharacterized protein conserved in archaea  ali follow..  10  46.....ISAPTPQASMTVTNQTQQASNDGVYTIYISGVNQNISLAKVTLEFQASDGNITVVPL................................................. 102
8 -4.400[A] KOG3448 Predicted snRNP core protein  ali follow..  9.............SLVGKEVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPDKYPHMLSVKNCFIRGSVVRYVQLPGDEVDTQLLQD...................... 84
9 -4.320[C] COG0852 NADH:ubiquinone oxidoreductase 27 kD subunit  ali follow..  14...EARGSLVVSADIAYGELTLNTTPENVIALLTFLRDDVQCGFVNIIDICGVDQREKRFDVVYHLLSPRQNLRVRIKLQVAEDEGVPSSTPVYMGAEWFEREAWDMYG.. 121
10 -4.280[NU] COG3167 Tfp pilus assembly protein PilO  ali follow..  15  113............................LEDITRTGLGSGLEFEEIKLLPEVAQQFYIELPIQISVVGGYHDLATFVSGVSSLPRIVTLHDFEIKPVAPGSTSKLRM.... 191

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.