current user: public

If you have questions about the server, please let us know.

Query: gi|16759006|ref|NP_454623.1| chaperone protein DnaJ (STY0013) [Salmonella enterica subsp. enterica serovar Typhi str. CT18], from S.typhi

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .
# Score Template Links and tools%idFirst MAKRDYYEILGVSKTAEEREIKKAYKRLAMKYHPDRNQGDKEAEAKFKEIKEAYEVLTDAQKRAAYDQYGHAAFEQGGMGGGFGGGFNGGADFSDIFGDVFGDIFGGGRGRQRAARGADLRYNMDLTLEEAVRGVTKEIRIPTLEECDVCHGSGAKAGTQPQTCPTCHGSGQVQMRQGFFAVQQTCPHCQGRGTLIKDPCHKCHGHGRVEKSKTLSVKIPAGVDTGDRIRLAGEGEAGEHGAPAGDLYVQVQVKQHPIFEREGNNLYCEVPINFAMAALGGEIEVPTLDGRVMLKVPSETQTGKLFRMRGKGVKSVRGGAQGDLLCRVVVETPVGLSEKQKQLLKDLQESFGGPTGEKNSPRSKSFFDGVKKFFDDLTRLast
1 -124.000[O] COG0484 DnaJ-class molecular chaperone with C-terminal Zn finger domain  ali follow..  58  1MSNQDFYATLGVARTATDDEIKKAYRKLAMKYHPDRNPDNKEAEEKFKEVQKAYETLSDKEKRAMYDQYGHAAFEGGGQGGFGGFGGAQGFDFGDIFSQMFG---GGSGRAQPDYQGEDVQVGIEITLEEAAKGVKKRINIPTYEACDVCNGSGAKPGTSPETCPTCKGSGTVHIQQAIFRMQQTCPTCHGAGKHIKEPCVKCRGAGRNKAVKTVEVNIPAGIDDGQRIRLSGEGGPGMHGAPAGDLYVTVRIRAHKIFQRDGLDLHCELPISFATAALGGELEVPTLDGKVKLTVPKETQTGRRMRVKGKGVKSLRSSATGDLYCHIVVETPVNLTDRQKELLEEFERISTGLENQT--PRKKSFLDKLRDLFD.... 373
2 -113.000[O] KOG0715 Molecular chaperone (DnaJ superfamily)  ali follow..  32  44SSARNYYDVLGVSPKATREEIKKSFHELAKKFHPDTNRNNPSAKRKFQEIREAYETLGNSERREEYDKLQYRNSDYVNNDGGDSERFAYQSNFSDTFHKIFSE------IFENNQIKPDIRVELSLSLSEAAEGCTKRLSFDAYVFCDSCDGLGHPSDAAMSICPTCRGVGRVTI----PPFTASCQTCKGTGHIIKEYCMSCRGSGIVEGTKTAELVIPGGVESEATITIVGAGNVSSRTSQPGNLYIKLKVANDSTFTRDGSDIYVDANISFTQAILGGKVVVPTLSGKIQLDIPKGTQPDQLLVLRGKGLPKQGFVDHGDQYVRFRVNFPTEVNERQRAILEEFAKEEINNELSD--SAEGSWWNLTGPQIIR... 410
3 -98.500[O] KOG0712 Molecular chaperone (DnaJ superfamily)  ali follow..  32  2VKETKLYEVLNVDVTASQAELKKAYRKLALKYHPDKNPN---AGDKFKEISRAYEILADEEKRATYDRFGEEGLQGGGADGGM--------SADDLFASFFGGGMFGGGMPRGPRKGKDLVHTIKVTLEDLYRGKTTKLALQKKVICPKCSGRGGKEGS-VKSCASCNGSGVKFITRMIQRMQMTCPDCNGAGETIEDRCKECDGAKVISQRKILTVHVEKGMHNGQKIVFKEEGEQAP-GIIPGDVIFVIDQKEHPRFKRSGDHLFYEAHVDLLTALAGGQIVVEHLDDRLTIPIIPGIRPNELKVLPGQGMLSQRHHQPGNLYIRFHVDFPEPATPEQLALLEKALPPRKIESAPKNAHTEECVLATVDP....... 371
4 -95.100[O] COG2214 DnaJ-class molecular chaperone  ali follow..  36  1MELKDYYAIMGVKPTDDLKTIKTAYRRLARKYHPDVSK-EPDAEARFKEVAEAWEVLSDEQRRAEYDQMWQHRNDPQFNRQHGDGQSFNAEDFDDIFSSIFGQ-HARQSRQRPATRGHDIEIEVAVFLEETLTEHKRTISY-------------------------------------------NLPVYN------------AFGMIEQEIPKTLNVKIPAGVGNGQRIRLKGQGTPGENGGPNGDLWLVIHIAPHPLFDIVGQDLEIVVPVSPWEAALGAKVTVPTLKESILLTIPPGSQAGQRLRVKGKGLV--SKKQTGDLYAVLKIVMPPKPDENTAALWQQLADAQSSFDPRKDWGKA................ 306
5 -91.600[O] KOG0714 Molecular chaperone (DnaJ superfamily)  ali follow..  28  3...VDFYKVLEVDRSANDDELKKAYRKLAMKWHPDKNPNNKEAEAKFKQISEAYDVLSDPQKRAIYEQYGEEGLNQAPPPGAGGGYP--------------GGSDAGASFRFNPRSADDI-------FSEFFGFTRPSFGTGSDSRAGPSGFRYGDDIFASFRAATTGGEASIPSRKERQLPCSLEDLYKGVSKKMKISRDVLDSSGRPPVEEILTIEIKPGWKKGTKITFLEKGNEHR-GVIPSDLVFIVDEKPHPVFKRDGNDLVVMQKISLVDALTGYTAQVTTLDGRLTVPVNNVISPSYEEVVKGEGMPIPKDPSKGNLRIRFIIKFPSKLTTEQKSGIKRMLS.............................. 334
6 -89.600[O] KOG0713 Molecular chaperone (DnaJ superfamily)  ali follow..  19  13ANRRDPYEVLCVSKDANDQEIKSAYRKLALKYHPDKNANNPDASELFKEVAFSYSILSDPEKRRHYDNAGFEALDADGMDMEI--DLSNLGTVNTMFAALFS---KLGVPIKTTVSANVLEEAMNGTVTVRPLPIGTSVSGKVEKQCAHFFGVT--------ISEQQAESGVVSTAQSKFKLLYFEQDSSGGYGLALQEEREKTGKVTSAGMYFLHFQVYRMDTTVNALAAAKDPESARLEGLQPCEVSELKAGTH-IFAVYGDNFFKTASYTIEALCAKTYEDTTE----------KLKEIEAQILRKRNELRQFETEYRALARFQEVTNRYTQEKQTVDELLKQRDTIHSTFSVVKTPSGNN............... 360
7 -70.100[O] KOG0716 Molecular chaperone (DnaJ superfamily)  ali follow..  13  46ITDFDLYDLLGIDRSSDKSQIKSAYRALQKRCHPDIAGDP--GHDMAIILNEAYQLLSDPISRQAYDKEQAKLEELRGYTGKCGPETEQRAAFVDEVKCVGCAIETAYGRARVVAQWADPESKIKEAIEACPVDCISMVERSDLAPLEFLMSKQPRGN----VRIGVGNTVGERVSNVFVDVKKFQERYKAMSRTTKETSQREVQISAVEAIRSISNWLYWRSSPYTKPLSPESNMSLTFTKRKKAVDPDIRKLQDVVAAMKQADQSGRTKEKGSAYLLGEDYWSPSNAALPSSGNNNGSKASSNPQVTRKTFPSEEKSRRENRRQFRIKKFPIGTAIVAVFLVQYQASYRAASELNDH.................... 418
8 -58.900[O] KOG0691 Molecular chaperone (DnaJ superfamily)  ali follow..  17  2VKETEFYDVLGVSPTATEAEIKKAYYIKARQVHPDKNPNDPQAAHNFQALGEAYQVLSDPGQRQAYDTSGKSGISTEIIDPAAIFAMLFG---SELFEEYIGQLAIEKMRAVQKEREDKLAQILKDRLNLYMTNKDEFTSNAEAEVTRLSNAAYGVEMLNTIGYIYVRQAAKLGKKAIYLGVPFVAEWFRTKGHFIKSQVTAATGAYALFQLQEEMKRQLSAEGNYTEKELEEYMKTHKKKLNVADIESTISRVCEQVLQDPTAKREELRARAKGLKTLGKIFQ............................................................................................... 329
9 -54.200[O] KOG0718 Molecular chaperone (DnaJ superfamily)  ali follow..  15  10LDNEDYYSLLNVRREASSEELKAAYRRLCMLYHPDKHRDPSQAERLFNLVHQAYEVLSDPQTRAIYDIYGKRGLEMEGWEVVER-----RRTPAEIREEFERLQREREERRLQQRTNPKGTISVGVDATDLFDRYDEEYEDVSGSSFPQIEINKMHISQSIEAPLTATDTGSLSTQNGNGGGSINFALRRVTSAKGWGELEFGAGDL---QGPLFGLKLFRNLTPRCFVTTNCALQFSSRGIRPG-------LTTVLARNLDKNTMGYLQWRWGIQSAMNTSIVRDTKTSHFTVALQLGIPHSFALIIYQHKFQDDDSLKAGFFGTVVEYGAERKISRHSV...................................... 348
10 -46.000[O] KOG0719 Molecular chaperone (DnaJ superfamily)  ali follow..  18  28.MDIDPYSVLGVEKDASDELIRRAYRKKALQHHPDRIHDEVEARIEFDKVAIAYGVLSDKKRRKHYDKTGQLRETDADIDF----------DWKEWLDELYQGVVSGENEFKASYQYSEEEKCDVLKAYEKGKGSMDVIL--EEVMCCEISDEDR-----RQVINNAIKDGKISKYKRFAPNEKK--------------------RKRRAKAAEREAQEAEELSMELGLDENLKKRRKAGASDEEALSALIRSRQKSRMYNLISNL................................................................................................................. 261
11 -41.500[O] KOG0720 Molecular chaperone (DnaJ superfamily)  ali follow..  16  404LNCPDHYSALGLARNVDMAYLKREYRKKAMLVHPDKNMGNERAAEAFKKLQNAYEVLLDSVKQKSYDDELKREELLNYFRR-----FQNSSQKDTRGHGFSGSGFGSSGEGEEAFRECRQIACKKCGNLHAWFLTKKSKSTARW--CQDCKEFHQAKDGDGWVEQASQHVLFGLFQK---VDMPRAYVCADSKIYEASQWYICQGMRCPANTHKPSFHVNMNATAAKRGTSGSSGQKGNQRMPNTNPDETMTEEEF--YEWLQNAVQSGMFDNARENPSSATASSTSSSSSKKKKKGKKQ............................................................................... 694
12 -36.800[U] COG5407 Preprotein translocase subunit Sec63  ali follow..  14  94LNIWDPYEILGIAKGTSVDDVRRHYKRLSIKFHPDKVRNMEEVEKHYIEITNAYRALTDDKTRENYALYGTPDVPQHISVGIA--ESENSIYILGFYGLVFGIVLPYAVGKWWYGSRTYTRDHVHVTVDEWFPKMETSLTLDELLSLFASSKELTSLVPNEKNPKEYILK-FDHLNRKKTNNFNTHQILSQSDVVLNALLSVATAFGFANPVDNV-LKLWQHIVQAIPLDAPFP------------------LLQLPHLLMEDVKNLSIRNISSIPQFLSLSEELPNYSKNQLKEMREIANGIPRISVVAADDEYITVGAIANLILDLKCSYGTEVVPEVSTDGTETATKKDEEDAEKYHQSKDVVLGDVET....... 467
13 -36.800[O] KOG0721 Molecular chaperone (DnaJ superfamily)  ali follow..  14  94LNIWDPYEILGIAKGTSVDDVRRHYKRLSIKFHPDKVRNMEEVEKHYIEITNAYRALTDDKTRENYALYGTPDVPQHISVGIA--ESENSIYILGFYGLVFGIVLPYAVGKWWYGSRTYTRDHVHVTVDEWFPKMETSLTLDELLSLFASSKELTSLVPNEKNPKEYILK-FDHLNRKKTNNFNTHQILSQSDVVLNALLSVATAFGFANPVDNV-LKLWQHIVQAIPLDAPFP------------------LLQLPHLLMEDVKNLSIRNISSIPQFLSLSEELPNYSKNQLKEMREIANGIPRISVVAADDEYITVGAIANLILDLKCSYGTEVVPEVSTDGTETATKKDEEDAEKYHQSKDVVLGDVET....... 467
14 -35.900[O] KOG1150 Predicted molecular chaperone (DnaJ superfamily)  ali follow..  28  66..NLNPFEVLQIDPEVTDEEIKKRFRQLSILVHPDKNQDDDRAQKAFEAVDKAYKLLLDQEQKKRALDVIQAGKEY............................................................................................................................................................................................................................................................................................................... 140
15 -32.000[O] KOG0717 Molecular chaperone (DnaJ superfamily)  ali follow..  30  25.TMKCHYEVLEVERDADDDKIKKNYRKLALKWHPDKNPDREECTQQFRLLQAAYDVLSDPREREFYDRHRESILKGKNTDFEYQGYENDKNGFFTVYRKVFN..................................................................................................................................................................................................................................................................................... 140
16 -31.400[O] KOG0724 Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains  ali follow..  30  121.QQQDHYALLGLSNLATEDQIRKSYREAALKHHPDKLAKADEIESRFKAIQEAYEVLMDPTRRRIFDSTDEFDDEVPSDCLP--------QDFFKVFGPAFKRNARWSVNQRIPDLGDE.................................................................................................................................................................................................................................................................... 238
17 -29.000[O] KOG0723 Molecular chaperone (DnaJ superfamily)  ali follow..  32  92MSRREAGLILGVSPSAGKAKIRTAHRRVMILNHPDKG----GSPYVAAKINEAKDLLETTTKH............................................................................................................................................................................................................................................................................................................................ 150
18 -28.000[JO] COG5269 Ribosome-associated chaperone zuotin  ali follow..  31  94.KTADLYAAMGLSKRATESQIIKAHRKQVVKYHPDKQSGSLDQDGFFKIIQKAFETLTDSNKRAQYDSCDFVADVPPPKKGTDY-------DFYEAWGPVFEAEARFSKKTPIPSLGNK.................................................................................................................................................................................................................................................................... 210
19 -27.300[O] KOG2813 Predicted molecular chaperone, contains DnaJ domain  ali follow..  14  93.............QFLDEIEIRELLIDHIGHRCCWGSRPARTWKIHAVEDCNVYTLDTFIEEREALTQTVPFTGGEFNGKKHGSEPGLWELDL---------------RPQFPTLFVPYKETQVLVPNSETVEKCT-GCTGRGDVVCPTCNADGEPGFYKMMKCSTCYGRGLVAHKDGSDTIKLPCPTCQSRGLI---KCQTCDSTGSLLTSSIAVVKWKTLSKRKVSATRGAGSVPEE---------VFDRAEGVQLCNTQAYQCLNRFSSEVISLRAEVPPTANVVCERHTISVVPVTRRGKAFSFYIIGF---------GKEIYLKDYYPARFCWGLCPCLEWLK............................... 418
20 -23.800[L] COG1107 Archaea-specific RecJ-like exonuclease, contains DnaJ-type Zn finger domain  ali follow..  15  1..........................................................................................................................................MRNTMIQSCNECKGKGYR-VKSYKICSACHGTGFRSTEDLEDSHEVPCEVCRGKGEVVRETCPTCGGKGEVNICPSCGRMMKGRDEQKKEKVYILHPACTMDDLEVGSIYKITRVEKYGVFVSLNSHVWGLMRGLFPDYKVGDELFVRVSQGEVDMIPASIKGPYEVIKLKKDRIADIDTKSLGKT-VRIVGEV-IQIQQTSGPTIFTVSDETGTTWAAAFDEPGIRVYPHIQ........ 264
21 -15.900[O] COG1076 DnaJ-domain-containing proteins 1  ali follow..  26  2...SQYFTLFRIEPDIDTENLEQTYRALAARFHPDKFASASAFEQKQAVINDAYRTLKNPIDRAAY......................................................................................................................................................................................................................................................................................................................... 71
22 -13.200[O] KOG3192 Mitochondrial J-type chaperone  ali follow..  29  84.DSVDYFQIFGLEKEIDPGSLEGKYKDWQKKLHPDLVHNKSKKERDYAAVTEACRTLTKRLSRAMY......................................................................................................................................................................................................................................................................................................................... 155
23 -11.000[OU] COG5082 Arginine methyltransferase-interacting protein, contains RING Zn-finger  ali follow..  16  58.............................................................................................................................................EAAPKCNNCSQRGSRHCPKAIQCSKCDEVGHYRSQCPHKWKKVQCTLCKSKKHSKER-CYNCGGKGHFGDD....................................................................................................................................................................... 176
24 -10.600[V] KOG0624 dsRNA-activated protein kinase inhibitor P58, contains TPR and DnaJ domains  ali follow..  53  376.GKRDYYKILGVKRNASKREITKAYRKLAQKWHPDNFSDEEEKEKKFIDIAAAKEVLQDEEKRRQFDQ....................................................................................................................................................................................................................................................................................................................... 445
25 -10.400[O] KOG4400 E3 ubiquitin ligase interacting with arginine methyltransferase  ali follow..  18  74.............................................................................................................................................NRDKFCFACRQQGPEAKDNVSICFRCGSKEHSLNA----LKFAKCFICHENGHLSGQCCKFCSSVHHLAKD....................................................................................................................................................................... 165
26 -10.400[O] KOG0550 Molecular chaperone (DnaJ superfamily)  ali follow..  54  345SKRKDHYKILGVSKEATDIEIKKAYRKLALVYHPDKNAGNLEAEARFKEVGEAYTILSDPESRRRFDS....................................................................................................................................................................................................................................................................................................................... 412
27 -9.480[J] COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation  ali follow..  18  12..............................................................................................................................................EPPICSSCGKIHPREKGVEFYCPNCG-----------EVLIRRDHMCRKQGA--EYICPNCGFKG............................................................................................................................................................................ 64
28 -9.330[O] KOG2824 Glutaredoxin-related protein  ali follow..  16  132.....YFTSLRGIRRTYEDAVRMIFRGFRVWI-------------------DERDVSMDIAYRKELQIA-----------------GEKSVSLPQVF--IMGKYVGGADVIKSLFEIGELAKIL-----------KEFPMRQPGFVCHCCGDIRFVP------CSNCSGSKKLFDEDED--RVKRCPECNENGLI---RCPDCSS.............................................................................................................................................................................. 274
29 -9.250[O] COG3058 Uncharacterized protein involved in formate dehydrogenase formation  ali follow..  12  44...........LAENNPLGDYLRFAALIAEVVLYDHPLEMDLTARIKEASAQGKPPLDIHVLPRDKHWQKLAELKPEMSGPALAVIENLEKASTQELEDMASALFASDFSSVSSDKAPFIWAALSLYWAQMANLIPGKARAEQRQYCPVCGSIGTTQGLRYLHCNLCETEWHVVRVK--------CSNCEQSGKL--ESCDDCGTYLKILYQEKEP-KVEAVADDLASLVL--------------DA-----RMEQEGYARSSINPF................................................................................................................ 302

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.