current user: public

If you have questions about the server, please let us know.

Query: gi|16758997|ref|NP_454614.1| threonine synthase (STY0004) [Salmonella enterica subsp. enterica serovar Typhi str. CT18], from S.typhi

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .
# Score Template Links and tools%idFirst MKLYNLKDHNEQVSFAQAVTQGLGKQQGLFFPHDLPEFSLTEIDEMLNQDFVSRSAKILSAFIGDEIPQQILEERVRAAFAFPAPVAQVESDVGCLELFHGPTLAFKDFGGRFMAQMLTHISGDKPVTILTATSGDTGAAVAHAFYGLENVRVVILYPRGKISPLQEKLFCTLGGNIETVAIDGDFDACQALVKQAFDDEELKTALGLNSANSINISRLLAQICYYFEAVAQLPQGARNQLVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNINDTVPRFLHDGKWAPKATQATLSNAMDVSQPNNWPRVEELFRRKIWRLTELGYAAVDDTTTQQTMRELKAKGYISEPHAAVAYRALRDQLNPGEYGLFLGTAHPAKFKESVESILGETLALPEALAERADLPLLSHHLPADFAALRKLMMTRQLast
1 -125.000IDP00901 gene: thrC; threonine synthase STM0004 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  99  1MKLYNLKDHNEQVSFAQAVTQGLGKQQGLFFPHDLPEFSLTEIDEMLNQDFVSRSAKILSAFIGDEIPQQILEERVRAAFAFPAPVAQVESDVGCLELFHGPTLAFKDFGGRFMAQMLTHISGDKPVTILTATSGDTGAAVAHAFYGLENVRVVILYPRGKISPLQEKLFCTLGGNIETVAIDGDFDACQALVKQAFDDEELKTALGLNSANSINISRLLAQICYYFEAVAQLPQGARNQLVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNVNDTVPRFLHDGKWAPKATQATLSNAMDVSQPNNWPRVEELFRRKIWRLTELGYAAVDDTTTQQTMRELKAKGYISEPHAAVAYRALRDQLNPGEYGLFLGTAHPAKFKESVESILGETLALPEALAERADLPLLSHHLPADFAALRKLMMTRQ 428
2 -115.000IDP02201 gene: thrC; threonine synthase [Yersinia pestis CO92] YPO0461 [Yersinia pestis CO92]  ali follow..  81  1MKLYNLKDHNEQVSFAQAIKQGLGKQQGLFFPLELPEFELTEIDKLLDLDFVTRSSRILSAFIGSEIAPDVLTKRVQAAFEFPAPVAQVENDIAVLELFHGPTLAFKDFGARFMAQMLAEVAGDQPVTILTATSGDTGAAVAHAFYGLKNVRVVILYPRGKISPLQEKLFCTLGGNIHTVAIDGDFDACQALVKQAFDDEELKTALSLNSANSINISRLLAQICYYFEAVAQLPQEARNQLVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPRFLVNGQWQPKPTVATLSNAMDVSQPNNWPRVEELYRRKIWQLKDLGHGAVSDKTTKDTMRELAGLGYISEPHAAIAYRVLRDQLQDGEFGLFIGTAHPAKFKESVEAILGQELPLPKPLAVRAQLPLLSHDLPADFAQMRAFLMALP 428
3 -90.800IDP01954 gene: thrC; threonine synthase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0812 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  26  1MKLVESRNVNNVSSFKEALINPNAPEGGLYSPLNLPIFEGEKYANL---SYKDFALKLIESFGEELFKKALKSYESFDDKNTPISLQKISEKTYINELWHGPTRAFKDMALQPFGVLLSEFSKDKNILIICATSGDTGPATLKSFENAKNVKVACMYPKGGTSGVQELQMRALKDNLKVFAIDEDFDAAQRTLKELLFSKDFQNEYELCAANSVNFGRILFQIIYHYYASLKLFNEFLEEVQIIVPSGNFGNALGAFYAKKMGAKISKIKIASNANNILSEFFNQGVYREKSLKKTISPAMDILISSNIERLLFAKFKDKRLQSLQEDFEADFCTDEECMQFIKQSKILIDPHTATCFKMLDP----LKPSIITSTAEWTKFTPSMIKALYDRDSKNEKEDLKFIAKEFNVQVKDEILALFDLKNSDE 452
4 -43.800IDP02380 gene: thrC; threonine synthase [Bacillus anthracis str. `Ames Ancestor`] GBAA1969 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  18  7.....................................................NQYASYLPVNENTPDVSLMEGNTPLIPLLNISKQLGI-QLYGKYEGANPTGSFKDRGMVMAVAKAKEEGSEAIICASTGNTS----ASAAAYAARLGMKCIIVIPEGKIA--HGKLAQAVAYGAEIISIEGNFDDALKAVRNIAEEEPI------TLVNSVNPYRIEGQKTAAFEICDQL-QRAPDVLAIPVGNA--GNITAYWKGFCEKKPRIHGFEAEGAAAIVKGHVID-------EPETIATAIRIGNPASWSYAVEAA----EQSHGEIDMVSDEEILHAYRLLAKSEGVFAEPGSNASLAGVMKHIKKGETVVAVLTGNGLKDPDIAISSNTLDIA----------------SVSNNIEQIKEHIKG.. 348
5 -41.100IDP06230 tryptophan synthase subunit beta [Streptococcus pneumoniae TIGR4] NP_346245 [Streptococcus pneumoniae TIGR4]  ali follow..  13  13.......................GKFGGRFVPETLMTAVLE-----LEKAYRESQADPSFQEELNQLLRQYVGRETPLYYAKNLTQHIGGAKIYLKREDLNHTGAHKINNALGQVWLAKRMGKKKI--IAETGAGQHGVA-TATAAALFNMECTIYMGEEDVKRQALNVFRMELLGAKVEAVTDGSRVLKDAVNAALRDDTHYILGSALGPHPFPEIVRDFQSVIGREAKQQYGRDLPDALVACVGGGSHPFVEDESVAMYGTEAAGLGVDTEHHAATLTKGRPGVLHAHGQILEAFSISAGLDYPGIGPEHSHYHD----IKRASYVPVTDEEALEGFQLLSRVEGIIPALESSHAIAFAVKLLGPEKSMIVCLSGRGDKDVVQVKDRLEADAAKKGEAHA.......................... 407
6 -40.900IDP01813 gene: trpB; tryptophan synthase subunit beta [Bacillus anthracis str. `Ames Ancestor`] GBAA1253 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  11  1MNYAYPDEKGH-----------YGIYGGRYVPETLMQSVLE-----LEEAYKEAMEDEAFQKELNHYLKTYVGRETPLYFAENMTEYCGGAKIYLKREDLNHTGAHKINNTIGQALLAVRMGKKKV--VAETGAGQHGVA-TATVCALLGLECVIFMGEEDVRRQKLNVFRMELLGAKVESVSGTLKDAVNEALRYWVSHVHYIMGSVLGPHPFPQIVRDFQSVIGNETKKQYEGKLPEAVVACIGGGSYPFVHDEEVALYGVEAAGKGVHTEKHAATLTKGSVG-QNEEGQIQEAHSISAGLDYPGVGPEHSLLKD----IGRVSYHSITDDEALEAFQLLTKKEGIIPALESSHAVAYALKLMKEDEGLVICLSGRGDKDVESIKRYMEE.................................... 396
7 -40.400IDP06553 tryptophan synthase subunit beta [Mycobacterium tuberculosis H37Rv] NP_216128 [Mycobacterium tuberculosis H37Rv]  ali follow..  12  26..........................GGRYVPEALM-------AVIEEVTAAYQKERVSQDFLDDRLQANYAGRPSPLYEATRLSQHAGSARIFLKREDLNHTGSHKINNVLGQALLARRMGKTRV--IAETGAGQHGVA-TATACALLGLDCVIYMGGIDTARQALNVARMRLLGAEVVAVQTGSKTLKDAINEAFRDWVANADNTAAGPHPFPTMVRDFQRIIGMEARVQIQGRLPDAVVACVGGGSHAFLDDPGVRLVGFEAAGDGVETGRHAATFTAGSPG-QDEDGQTIESHSISAGLDYPGVGPEHAWLKE----AGRVDYRPITDSEAMDAFGLLCRMEGIIPAIESAHAVAGALKLLGRGAVIVVNLSGRGDKDVETAAKWFGLLGN................................. 409
8 -35.100IDP90720 gene: trpB; tryptophan synthase subunit beta [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0348 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  13  10..........................GGQFLPESANELEGAFLKFSKDKLFKKELNELLKTYVGRPTPLYFARNLSKKY----------QHEIYLKREDLNHTGAHKINNAIAQALLAKKMGKKKI--IAETGAGQHGLATATA-AALLGLECEIYMGATDVQRQALNVYKMELLGAKIHAVQSGLKTLKEATTAAIQAWVGDIKNIFYVVGSAPKMVMHFQSIIGKECKMQLQKLNKKVDYIIAAVGG-GSNAAGIFYDFIKDENVKLIGIEAGGHGMKTKVLQDDLGNILPVHSVSAGLDY--PGIGPLHAFLFE----SKRAQYHAISDEECMQALKLLCKEEGIIAAIESSHALAFLEKLLKKKSVIVVNLSGRGDKDMQMIRDYKKGVI.................................. 390
9 -20.400IDP04493 pyridoxal-phosphate dependent enzyme [Yersinia pestis CO92] YPO4089 [Yersinia pestis CO92]  ali follow..  14  32......................................................................................QHSGCEIYLKCEHLQHTGSFKFRGANKLRLLNEAQRQQGVITASTGNHGQGVALAAKLA----GIKSTIYAPEQAAAI---KLDVIRALGGQIELVSGDALNAELAAGIAAEQQGKVYISPYN-----DPQVIAGQGTCGMEMVEQQ----PDLDAVFVAVGGGGLISGIATVLKTLSDKTQVIGCWPANTSLYTCLEKGQIQEVAEQETLSDGTAGGIEPG-----AITFALCQQLIDQKVLVSEQEIKEAMGLIARTDRWMIEGAAGVALAAALKLAPQGKKVAVVLCG................................................... 305
10 -19.500IDP90613 gene: ilvA; threonine dehydratase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0828c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  14  31......................................................................................DICQSEIYLKNENLQITGAYKIRGANKIANLSTEQKQHGVIAASAGNHAQGVAISAKKF----SIKAVIVMPE---STPLLKVSATKALGAEVILRGDNFDEAYAFATSYAKENNLSFIHPF------DEFVMAGQGTLMLEMLDEI----SDLDMIIAPVGGGGLISGISSTAKQINPNIKIIGVGAKGPAMYESFHAKKIKNAKSVRTIADGIAVRDANPINFNI-------LECVDDFIQVDDEEIANAVLFLLEKHKIIVEGAGAASVAALLHQK-NHKKIGVVLSGGNIMLNIIIEKGLFKSYRKMQIYVTLVDKPGALLHLTDSLKIANANIVK.. 356
11 -19.400IDP02497 gene: cbs; cystathionine beta-synthase (cystein synthase) [Francisella tularensis subsp. tularensis SCHU S4] FTT1287 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  13  21...........................................................................................NLYAKCEWLNPTGSIKDRVAKYILENLIKNKKKPQQAIIEASSGNMGTS-LAAIGKLYKHPVYITCPE-KTGQIKREMIKSFGANLTICKNTSDHTDPDFYVNKA---KQLTEDLDGILVNQYNLLNTECHKTTGQEIVDYFLTQNVDIDYFITVGGSGGTITGCAKKIKEFFPKTQVIMPDPYGSVYYDIFYYGAPIKENIHSYKVEGPGNPFCKSMDF----------AYIDEIIQFSDNQAIQACHELASEQGIYAGHSSGANYFIAKKLLEQSYNILIMVLDSGMKYA............................................. 306
12 -18.800IDP91399 threonine dehydratase [Vibrio vulnificus CMCP6] VV1_1028 [Vibrio vulnificus CMCP6]  ali follow..  13  37......................................................................................ARIGNNVQIKREDRQPVHSFKLRGANMVANLSQAQKDAGVITASAGNHAQGMALSGTRL----GIETTIVMPRTTPDI---KVDAVRGFGGKVVLHGSNFDEAKAEAERLSQEKGYTFVPPF------HPLVIAGQGTIGMEMLQQN----GHLDHIFVPVGGGGLAAGVAVLVKQLMPEIKVIAVEPEDACLKAALDAGEPVVLDQVSMFADGVAVKRIGDETFRL-------QHYIDDHVTVSSDEICAAVKDIFEDTRAIAEPSGALALAGLKKYAEKGHNLGTVLSGANTNF-HGLRYVSERCELGEKREGLLA------VTIPERKGAFFEFCH... 352
13 -16.600IDP01631 cystathionine beta-synthase, putative [Coxiella burnetii RSA 493] CBU_2024 [Coxiella burnetii RSA 493]  ali follow..  14  28...........................................................................................ELYGKCEFLNPGGSVKDRIGAAMIESAEKQGKKPGDTLIEPTSGNTGIG-IALAGAVKGYRVIITMPE-KMSHEKQVVLEALGATIYRTPTEAAYDDPESHISLAKRLNQEIPNSYIQYSNAENP------DIHYQTTGQEILDDMGENLMVVMGVGTGGTIIGVAKKLKEVNPSIQIIGVDPIGSILGGGDEIKPYLVEGIGYDFIPEV------------------DNNLIDEYIKINDKDSFLMARRLIREEGLLVGGSSGSAVWAACQAAQEGERCLVILPDAIRNYLTKF.......................................... 304
14 -16.500IDP90558 gene: cysM; cysteine synthase A [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0912c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  12  14................................................................................TPIIHLKKFGINVFAKCEFLNPSHSIKDRAAFEMIKDALDSKKNQDTTIVEATSGNTGIS-LAMICADLGLKFIAVMPE-SMSLERRKMITLFGARLELTPANLGMKGAVDKANEILLNTP-------QFENISNK------NAHRKNTALEILRDLDNELIFVAGFGTGGTISGVGEILKEKLEKVHIVGVEPLNSPLLSKGEAGSHKIQGIGANFIPAI------------------NKEVIDEVITVSNEDAINTAKELA-KSGLMVGISSGANVFAASMLAKPDKRILTMLNDTAERYLST........................................... 295
15 -16.400IDP00302 gene: trpBF; N-(5`phosphoribosyl)anthranilate isomerase/tryptophan synthase, beta subunit CBU_1155 [Coxiella burnetii RSA 493]  ali follow..  10  228..............................LMAPLQELQESMTRIVKSNVFQTTFHDILQHYAGRPTPLTEAKRLSD---------FIQGPRIFLKREDLLHTGAHKINNSLGQCLLAKKLKKTR---IIAETGAGQHGVASATACAYFDLRCDIYMGAEDMKRQAPNVERMKLLGANVIPVLAGSQTLKDAVNEALRDWSASYENTHYCLGSA----ALFQSVIGKEAKTQVHEKQPDAIIACVGGGNAIGIFSAFIDDPT--VRLIGVEAGGKGHGTYTYLLQDENGQIAKTHSISAGLD------YPAIGPQHAFLFETGRAIYTSVSDKDALTAFKLLAKTEGIIPALESSHAIAYLLKEFSRKDIVIVNLSGRGDKDIPALKE........................................ 597
16 -16.000IDP90762 cysteine synthase A [Vibrio cholerae O1 biovar eltor str. N16961] VC0968 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  15  27...........................................................................................KVLAKIEARNPSFSVKCRIGANMIWEAEKQGKKPGVELVEPTSGNTGVA-LAFVAAARGYKLTLTMPE-SMSLERRKLLKALGANLELTEAAKGMKGAIAKAEEIVASNPEKYLLLQQFNNPANP------QIHEKTTGPEIWDATDGQIVFVAGVGTGGTLTGTSRYIKGTQG-ILSVAVEPAESPVITQALAGEEIKPAPHKIQGIGAGF-IPGNLDL----------SLIDRVERVTSDEAIEMARRLMEEEGILAGISSGAAVVAANRIAQEGKTIVTVLPSSGERYLSTA.......................................... 309
17 -11.600IDP00979 gene: yedO; D-cysteine desulfhydrase STM1953 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  10  34...........................................................................................EIYIKDVTPIAMGGNKLRKLEFLVADALREGADTL--ITAGAIQSNHVRQTAAVAAKLGLHCVALLENPIGTTAENYLTNGNRLLLDLFNTQDALTDPDAQLQTLATRIEAQGFRPYVIVGGSSALGAMGYVESALEIAQQCEEVVLSSVVVASGSATHAGLAVGLEHLMPDVELIGVTVSRSVAEQKPKVIALQQAIAGQLALTATADIHL----------------WDDYFAPGYGVPNDAGMEAVKLLASLEGVLLDPYTGKAMAGLIDGISQDGPILFIHTG................................................... 316

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 5 6 0   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.