current user: public

If you have questions about the server, please let us know.

Query: gi|16758999|ref|NP_454616.1| putative amino-acid transport protein (STY0006) [Salmonella enterica subsp. enterica serovar Typhi str. CT18], from S.typhi

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .
# Score Template Links and tools%idFirst MPEFFSFINEILWGSVMIYLLLGAGCWFTWRTGFIQFRYIRQFSRSLKGSLSPQPGGLTSFQALCTSLAARIGSGNLAGVALAIAAGGPGAVFWMWVSAIIGMATSFAECSLAQLYKERDPTGQFRGGPAWYMARGLGMRWMGVVFALFLLVAYGLIFNSVQANAVSRALHFAFNIPPLISGIALAFCALLIIIRGIKGVARLMQWLIPLIALLWVAGSVFICLWHIEQMPGVIASIVKSAFGWQEAAAGAAGYTLTQAITSGFQRGMFSNEAGMGSTPNAAAAATSYPPHPVAQGIVQMIGVFSDTIIICTASAMIILLAGNHASHSSTEGIQLLQHAMVSLTGEWGASFVALIVILFAFSSIVANYIYAENNLFFLRLHNAKAIWLLRLATLGMVIAGTLISFPLIWQLADMIMACMAITNLTAILLLSPVVYTLAGDYLRQRKLGVRPQFDPRRFPDIEPQLAPDTWDAASRDLast
1 -135.000IDP91426 Na+/alanine symporter [Vibrio vulnificus CMCP6] VV1_0536 [Vibrio vulnificus CMCP6]  ali follow..  51  1MTDLINLMNDLLWGSILVYLLVGVGIYFTVRLGFIQFRHFGHMFSVLKNSRKSDNAGISSFQALCTSLAARVGTGNMAGVAVALTAGGPGAIFWMWLIAMLGMATSFAESTLAQLYKTKDDDGNYRGGPAYYMEKGLGMRWMGVLFSIFLIIAFGLVFNAVQANSIANAMQNAFGWENAYVGVVIVVLSGVIIFGGIKRIARTAELIVPVMALAYLALALFVMLSNLEKLPDVLMLIFKSAFGLQEAAAGGLGYAIAQAMINGIKRGLFSNEAGMGSAPNAAASATPYPPHPASQGYVQMLGVFMDTIVICSATVAIILMSGEYVPHGEITGIELTQLALSSQVGSWGSIFVAVAIFFFAFTSIIANYSYAETNLVFLEHNHKAGLNVFRLVVLGLVGFGAIAPLPVVWALADVSMGLMAIVNLVAILLLSGIVIKLAKDYNRQLQAGKLPTFNADDFPELKSQLEEGIWDNNKKD 476
2 -124.000IDP04213 putative transcriptional regulator [Salmonella typhimurium LT2] STM1003_1_478 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  27  1MLEQLSQLFEFLWGGPLFLCVIGIGFYFTVRLNFFQIINLKDIYRNTIGTEVASKKSLKSIEVAATVLSGSLGAGTIAGVAAAIAVGGPGAIFWMWIIAVVGMMTKMVEVTLAVKYRSKGENGEYYGGPMHYIKKGLNKKWLAGLYAFALMILVITDACFVQTNTMAAVIHYTFDIPTSVIGGFIVIVGALVILKGLSSLGKFCTIALPPITIAYFIGAAGVVVLNIEAIPQVIKSIFYYAFAPAPAAGGFVGSTIMMAISKGASRGIFTNEAGMGTSATVHATANVD--YAFRQGMWGAVEVFFVSMITCNFTAFAVLASGMWT-DASYQGIQIIFAALKETWHPIIVQVLCLGVALILFTSYLGSYIKFRTSINYIFGDK--LERIIKWLYFLPPLIAVNMEIPVIWLMADIAVGFLVIPNVIALFLLRKEFISEFNLFRTRTQRDTNSEKTTQITHVNMSKSE.......... 474
3 -11.900IDP05208 putative carbon starvation protein [Clostridium difficile 630] CD2373 [Peptoclostridium difficile 630]  ali follow..  12  9..........YKWGDIMTTFLIGLAILL------IGGALYGAYCEKVFGPDDRKTPAMKKWKNSLIELLNIAGTGPILGPIQGILF-GPIAFILIPIGCVFGALHDYMSGMISIREKGAQ-------PSLISRFLGNKVFQVYNIFLCLLMLLVGAVFIYTPGDLVVTQILNINNPVVWIVYGLIFLYYLCATLFPIDKIIGKVYPIFGAILLLSAAGVGIGIFTQGYDLAN----LSLANWKGIHPDGIPLIPTFFVTVACGIVSGFHSTQATL---------IARSVSNEKEGKTTFYNMMILEGLIAMIWAAAAMGIYNKGIPKELVGSPDVIGLVARDLLGSIGGIIAIIGVIVLPITSGDTALRSLRLMLADYFHYDQKEKKHRVILSICIFIPVIAIGFNILWRYFSWSNQTIAIFAFAMITVY.............................................. 427
4 -11.400IDP05527 putative carbon starvation [Clostridium difficile 630] CD2600 [Peptoclostridium difficile 630]  ali follow..  13  1................MVSFLGSIVVLI------VGYFVYGTFVEKVFGTNDKNQ-PMKWKRIFLIQFLNIAGLGPIFGAIQGALFGPSAFL-WIVFGTIFGGVHDFASGYLSMKNK---------GTSASELVGLYLGNGAKIAMRIFSVILLVLVGVVF-VTGPAGLLKTLTGVNAQIWVGVIILYYIMATVLPIDKLIGKIYPLFGAALLIMAVGVAGGLIIKGYNIPNI-------NLQNMNPNGTPLFPYLFITIACGAISGFHATQSPL----MARCVEKESEARPVFYGSM-VAEGIIALVWAAAAMSYFHGIPQLNVIFNDGGAATVVNTVSVGLMGPIGGALAILGVVACPITSGDTAFRSARLTIADAMNYNQDAVKNRFLIALPLFAVGVALTFNIIWRYFSWANQTLAMIMLWTGSAY.............................................. 401
5 -11.200IDP04470 putative amino acid antiporter [Yersinia pestis CO92] YPO2306 [Yersinia pestis CO92]  ali follow..  13  2......................................................EKKLGLTALTALVLSSMLGAGVFSLPQNMAEVASPAALLIGWITGIGIIFLAFAMLLLTRLRPDLD------GGIFTYAKEGFGD--LIGFFSAWGYWLCAVIANVSYLVIVFAALSFFTTWQALLGASFLLWLVHALVLRGVQTAASINL----AATLAKLLPIGGFIILAGIAFSLDTFSIDFTGLALHTPVWQQVKDTMLITL------------VFIGVEGAVVVSARARNKKDVGRATMLAVISALSVYLLITLLSLGVV-----RAELAGMRNPSMAGIMVEMIGPWGEIIIATGLIISVCGAYLSWTIMAAE-VPMVAAKHGAFPKIFRVQVALVLIWLTGSNYNTLLTIASEMILVPYFLVGAFLFKVA............................................. 381
6 -6.920IDP00179 putative transmembrane transport protein YPO0277 [Yersinia pestis CO92]  ali follow..  10  28...............................................................VILCIGMAIGSGIV----MPVQVGIKGIWVFIAAVIISYPAIYLLQNLYLRTLSESDNCTDYTSVITQYL--GKNWGVGLGIAYFLMLLHGMFSYSLAVTFDSASYIKTFGLTESIWYGLIILTVLVAIAAQGEKILFKVSGPMVCVKFGIIVVLGVVMVFNNISAFPELFSFLRDVLLTLPFTLFSILFVQILSPMNIAYRKVESDKRIATYRAIRANRVAY----------------IILAVAVLFFAFSFTFSISHEQAVSAFEQNISALAIAAQVIPGSIVRIMTALLNIFAILTAFLGIYLGFQEAIKGIVVNNQKVLHIGVCVGVILTLWLWVSTRFSILFFLQLGGPLFGVVSCLIPCYLVYKVPVLHK..................................... 402
7 -4.910IDP92744 hypothetical protein lpp1221 [Legionella pneumophila str. Paris] YP_123545 [Legionella pneumophila str. Paris]  ali follow..  1.................................................................MAKNSANDYSALLDIIRSHTPVRYNEL---------NIPLTITQKHAEAVLHVVHDVGGQPDGPL---STHKPTLWEKNTHCTAECLAWRGHWVAEERRRRENDLGETIYFGTPYYARWLLAMAKMLLDKGYITPDELMNKMAEVRKREEI.................................................................................................................................................................................................................................................................... 141
8 -4.790IDP04225 gene: ipaB; IpaB, secreted by the Mxi-Spa secretion machinery, required for entry into epithelial cells [Shigella flexneri] CAC05803 [Shigella flexneri]  ali follow..  11  271...................................DLALFQSLQESRKTEMERKSDEYAAEVRKAEELNRVMGVGKILGVVAAAFSGGASLAL-----AAVGLALMVTDAIVQAA-----TGNSFMEQALNPIMKAVIEPLIKLLSDAFTKMLEGLGVDSKKAKMIGSILGAIAGALVLVAAVVLVATVGKQAAAKLKIIGKTLTDLIPKFLKNFSSQLDDLITNAVARLNKFLGAAGDEVISKQIISTHLNQAVLLGESVNSATQAGGSVASAVFQNSASTNLADLTLSKYQVEQLSKYISEAIEKF........................................................................................................................................................................ 546
9 -4.690IDP00228 putative chloride channel protein YPO3388 [Yersinia pestis CO92]  ali follow..  13  86.............................RWWRVIPVKFIGGLGTLGAGMVLGREGPMVQMGGNSGRMIVDLATGAAAGLSAAFNAPLAGILFVIMRSQFRYSLVSIKAVFIGVITSTIVYRYFNGERAIIEVGKLSDAPLNTLWLYLLLAVGVIFNALIFRTQDMFVRFHGGDWRKLVLIGGLLGGMCGLLALGGFALIPIAAAG-IGMLLFIFIARVITTLLCFGSGAPG-------GIFAPMLALGTILGTAFGLSCAHGIEAGTFA----AGMGALFAASVRAPLTGIV---MTDNYQLILPMIVTCLGATLI............................................................................................................................................................... 398
10 -4.530IDP91947 amino acid ABC transporter, amino acid-binding protein/permease protein [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100001889 [Streptococcus pneumoniae str. Canada MDR_19A]  ali follow..  295..ELIKAIAKDQGFEIEITNPGFDAAISAVQAGQADGIIAGMSVTDARKATFDSESYYTANTILGVKESSNISYEDLKGKTVGVKNGTASQTFLTENQSKYGYKIKMDDEPVLKYSISQGQKLKTPISGTFAVKKGANPELIEMFNNGLANLKANGEFQKILDKYLASESSTALTLISFAIAIVIGIIFGMFSVSPYKSLRVISEIFVDVIRGIPLMILAAFIFWG---IPNFIESITGQQSPINDFVAGTIALSLNAAAYIAVRGGIQAVPVGQMEASRSLGISYGKTMRKI-QATKLMLPNFVNQFVIALKDTTIVSAIGLVE-------LFQTGKIIIARNYQSFKMYAILAIFYLVIITLLT.............................................................................................................. 710

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 1 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Li Z, and Godzik A. Modeling and Analyzing Three-Dimensional Structures of Human Disease Proteins Pacific Symposium on Biocomputing 11:439-450(2006) [PDF]