|
current user: public |
|
Query: gi|16759004|ref|NP_454621.1|(removed signalp:1-23) hypothetical protein (STY0011) [Salmonella enterica subsp. enterica serovar Typhi str. CT18], from S.typhi |
. 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 | |||||||
# | Score | Template | Links and tools | %id | First | NDHKILGVIAMPRNETNDLALKIPVCRIVKRIQLTADHGDIELSGASVYFKTARSASQSLNVPSSIKEGQTTGWININSDNDNKRCVSKITFSGHTVNSSDMARLKVIGDD | Last |
1 | -6.550 | IDP91909 cell wall surface anchor family protein, partial [Streptococcus pneumoniae str. Canada MDR_19A] SpneCM_010100002785 [Streptococcus pneumoniae str. Canada MDR_19A] | ali follow.. | 13 | 28 | .............................HVIPYELFAGDGMLTRLLLKASDKNGEAKNPALENVKTKGQYFYQVALDGNVAGKEKQALIDQFRANGTQTYSATVNVYGNK | 118 |
2 | -5.860 | IDP00770 superantigen-like protein SACOL0473 [Staphylococcus aureus subsp. aureus COL] | ali follow.. | 7 | 150 | .............FSINELFFIQKEEVSLKELDFKIRKLLIEKYRLRIVINMKDEKKHEIDLSEKLSFERMFDVMD-------SKQIKNIEVNLN................ | 232 |
3 | -5.670 | IDP91753 TSST_STAAU [Staphylococcus aureus] | ali follow.. | 6 | 151 | .............SPLKYGPKFDKKQLAISTLDFEIRHQLTQIHGLYWKITMNDGSTYQSDLSKKFEYNTEKPPIN-------IDEIKTIEAEIN................ | 234 |
4 | -5.650 | IDP00769 superantigen-like protein SACOL0472 [Staphylococcus aureus subsp. aureus COL] | ali follow.. | 10 | 229 | ...............DVSEFKITKEQISLKELDFKLRKQLIEKNNLKIVIKMKNGGKYTFELHKKLQENRMADVIN-------SEQIKNIEVNLK................ | 308 |
5 | -5.640 | IDP91143 superantigen-like protein [Staphylococcus aureus subsp. aureus NCTC 8325] SAOUHSC_00393 [Staphylococcus aureus subsp. aureus NCTC 8325] | ali follow.. | 6 | 151 | ..............SIDEFFFIQKEEVSLKELDFKIRKLLIKKYKLRIVINMKDENKYEIDLSDKLDFERMADVIN-------SEQIKNIEVNLK................ | 232 |
6 | -5.570 | IDP91125 superantigen-like protein [Staphylococcus aureus subsp. aureus NCTC 8325] SAOUHSC_00391 [Staphylococcus aureus subsp. aureus NCTC 8325] | ali follow.. | 6 | 147 | ..............SKDSKFKITKEEISLKELDFKLRKKLMEEEKLKIVVKMEDDKFYTFELTKKLQPHRMGDTID-------GTKIKEINVELEYK.............. | 231 |
7 | -5.300 | IDP91101 superantigen-like protein [Staphylococcus aureus subsp. aureus NCTC 8325] SAOUHSC_00389 [Staphylococcus aureus subsp. aureus NCTC 8325] | ali follow.. | 8 | 229 | ...............DVSEFKITKEQISLKELDFKLRKQLIEKNNLKIVIKMKNGGKYTFELHKKLQENRMADVID-------GTNIDNIEVNIK................ | 308 |
8 | -5.100 | IDP04720 hypothetical protein [Yersinia pestis CO92] YPO1174 [Yersinia pestis CO92] | ali follow.. | 13 | 11 | ..............................NIHSAGFNNSNSIQKYTGAVSSISDDLRINNEKCKSDIGTISGDIKINRHSAVYGNVNSVSGDITVKNSIVDKDITTVSGD | 91 |
9 | -4.980 | IDP95150 hypothetical protein KP1_2431 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] YP_002919177 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] | ali follow.. | 10 | 11 | ....QTGDSLIFKVPEPEAFPVAEAEAVIQPIALSIHSWVVQTPYDLIVIDTATGNGRERGGNPLYHQLNTPYLENLRAAGVNPEDVTLVLLTH................. | 111 |
10 | -4.810 | IDP90084 hypothetical protein CGSHiII_00674 [Haemophilus influenzae PittII] ZP_01795673 [Haemophilus influenzae PittII] | ali follow.. | 7 | 27 | ......DTLEQQFQQGSEATTRGDYQTTFKFLLPLAEQGNALAQMLGVMYAKGQGVKQDDVYRKAAEQGYADAQAMLLGQSGVQVNKSLAKEWFGKACDNGDQNGC..... | 137 |
FFAS is supported by the NIH grant R01-GM087218-01
|
![]() ![]() ![]() ![]() ![]() ![]() |
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Pawlowski K, Rychlewski L, Zhang B, Godzik A. Fold predictions for bacterial genomes. J Struct Biol. 2001 May-Jun;134(2-3):219-31. Review. |