|
current user: public |
|
Query: gi|16759008|ref|NP_454625.1| hypothetical protein (STY0015) [Salmonella enterica subsp. enterica serovar Typhi str. CT18], from S.typhi |
. 10 . 20 . 30 . 40 . 50 . 60 . 70 . 80 . 90 . 100 . 110 | |||||||
# | Score | Template | Links and tools | %id | First | MSIPNHVSTTEVVLLELEILLTIISIGAWGGFVSYLLRKDKTEYNSSHESIKYCLTQIVISCFTSFLLSAIAIEKECSFNIVLLAAGLGGVFASPILKILGRRIKKIIGGNNSD | Last |
1 | -6.100 | IDP92689 hypothetical protein SAVC_09040 [Staphylococcus aureus subsp. aureus VC40] YP_005291395 [Staphylococcus aureus subsp. aureus VC40] | ali follow.. | 7 | 308 | FRFQYFNPLKSERYYRNLDEQVLALITGEIGSMPDLKKPEDKPDSKQRSFEPHEKDDFTVV----------DNKKSASTAYSKSWLAIVCSMMVVFSIMLFLFVKRNKKKNKNE | 415 |
2 | -5.870 | IDP02042 gene: asd; aspartate-semialdehyde dehydrogenase [Coxiella burnetii RSA 493] CBU_0875 [Coxiella burnetii RSA 493] | ali follow.. | 25 | 1 | ............................................................................MAAVYDVAVVGATGVVGEMILQLLDER........... | 27 |
3 | -5.720 | IDP00998 gene: usg; hypothetical protein STM2369 STM2369 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] | ali follow.. | 22 | 1 | ............................................................................MSEGWNIAILGATGAVGEALLETLAER........... | 27 |
4 | -5.500 | IDP90732 gene: asd; aspartate-semialdehyde dehydrogenase [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1023c [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819] | ali follow.. | 18 | 1 | ............................................................................MSKKQKIAIVGATGAVGEELLNVLDEL........... | 27 |
5 | -5.440 | IDP02725 gene: bioA; adenosylmethionine--8-amino-7-oxononanoate transaminase [Bacillus anthracis str. `Ames Ancestor`] GBAA4341 [Bacillus anthracis str. `Ames Ancestor`] | ali follow.. | 13 | 225 | ...............EIAAIIVEPLMQGAGGMITMPKGYLRGLRNLCTKYNVLFITDEVATGFGRTGKMFACEHENVTPDILTAGKGLTGGYLPVAITVTTDEIYNAFLGSYEE | 323 |
6 | -5.400 | IDP02774 hypothetical protein FTT0392c [Francisella tularensis subsp. tularensis SCHU S4] FTT0392c [Francisella tularensis subsp. tularensis SCHU S4] | ali follow.. | 17 | 24 | ....................SFIALSEEVGELANEIMKKEIYEETNDNQKIKAELTDVFV-----------------------SLLELANVYNIDLETEFIEKIQT........ | 86 |
7 | -5.300 | IDP90617 gene: argC; N-acetyl-gamma-glutamyl-phosphate reductase [Yersinia pestis CO92] YPO3927 [Yersinia pestis CO92] | ali follow.. | 21 | 2 | ................................................................................LNTLIVGASGYAGAELTAYLNRH........... | 24 |
8 | -5.270 | IDP91420 hypothetical protein VV1_0667 [Vibrio vulnificus CMCP6] VV1_0667 [Vibrio vulnificus CMCP6] | ali follow.. | 11 | 32 | .......................LIYCALGGAIGHGSRY-------MKFGIPIEWATFFAATLVGMIGVYWSRRLLAHPKVFTVAALIPMVPGVFTFKAMIAMVEI........ | 109 |
9 | -5.180 | IDP04599 aspartate-semialdehyde dehydrogenase [Bacillus anthracis str. Sterne] BAS2268 [Bacillus anthracis str. Sterne] | ali follow.. | 20 | 3 | .............................................................................EKGYHLAVVGATGAVGQKIIELLEK............ | 27 |
10 | -5.100 | IDP02467 gene: asd-2; aspartate-semialdehyde dehydrogenase [Bacillus anthracis str. `Ames Ancestor`] GBAA3937 [Bacillus anthracis str. `Ames Ancestor`] | ali follow.. | 20 | 1 | ..........................................................................MEKQKTFHVAVVGATGAVGEQMLNTLEKR........... | 29 |
FFAS is supported by the NIH grant R01-GM087218-01
|
![]() ![]() ![]() ![]() ![]() ![]() |
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Rodrigues AP, Grant BJ, Godzik A, Friedberg I. The 2006 automated function prediction meeting. BMC Bioinformatics. 2007 May 22;8 Suppl 4:S1-4. |