current user: public

If you have questions about the server, please let us know.

Query: gi|16759010|ref|NP_454627.1| hypothetical protein (STY0017) [Salmonella enterica subsp. enterica serovar Typhi str. CT18], from S.typhi

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst MKTYIINSNCIYNEGKYELRTVSNSQVIKMTAMRAKCLSFIIENAHLEIIERQKITTALWGSRSHYVNDANLTQILYLIRRDLKALGINDLFITIPRQGLKVNSDIAIIATDSETKGRKKQIVRQTIAALTTVFSVTLGSLMYLHIHLast
1 -64.000IDP01845 hypothetical protein STM0017 [Salmonella typhimurium LT2] STM0017 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  99  1MKTYIINSNCIYNEGKYELRTVSNSQVIKMTAMRAKCLSFIIENAHLEIIERQKITTALWGSRSHYVNDANLTQILYLIRRDLKALGINDLFITIPRQGLKVNSDITIIATDSETKGRKKQIVRQTIAALTTVFSVTLGSLMYLHIH 147
2 -37.900IDP02145 gene: psaE; putative regulatory protein [Yersinia pestis CO92] YPO1301 [Yersinia pestis CO92]  ali follow..  13  1.....MSHCVVLNKLESVL--IIGDSRYALSKNEVLLLECLYLRAG-DVISHDELLTTCWP--DRVVSPTSLPVAIKHIRDVFRKITRSEVIKTYKNEGYSYQKDSVLIIIDDGSTEKESHSAAYTRKEKPDIPIKLVG........ 129
3 -36.400IDP93893 regulatory protein [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001005758 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  16  1.....MSSSVVLDKLKNVLM--INNEAHALSKNEVLLLEYLYLRGG-EVIPRDELISHCWPDR--VVSAVSLPVAIKHIRDVLRKATLNEVIKTHKSVGYSLQKDSLELVIYSLAYEQPANNLALNHVAADENIDVQRQP....... 130
4 -23.800IDP91279 DNA-binding response regulator [Bacillus anthracis str. Sterne] NT05BA4913 [Bacillus anthracis str. Sterne]  ali follow..  18  135.......EGLKLFPERPEIHF--GSEQVLLTKKEAILAEMLLSKFP-RTASREDLLAALWDDE-SFVEENTLNVNITRLRKKFNELGIENAIETVRGLGYRFNAT.......................................... 228
5 -23.200IDP01942 hypothetical protein lmo1745 [Listeria monocytogenes EGD-e] lmo1745 [Listeria monocytogenes EGD-e]  ali follow..  24  134.......NNVFLHIDTNTLTH--LEDKIELTKNEFLILYELMKQKG-SIVSRDEIMRALWEDE-SFVDDNTLTVNVVRIRKKLAEIGLSEFIKTKKGQGYMI............................................. 224
6 -22.300IDP91441 response regulator [Vibrio vulnificus CMCP6] VV1_0468 [Vibrio vulnificus CMCP6]  ali follow..  18  135.......QGLKLDPVSHRVTA--NDAPVDMGPTEFKMLHFFMTHQE-RVYSREQLLNNVWG-TNVYVEDRTVDVHIRRLRKALEDAGHDKLIQTVRGAGYRFSTK.......................................... 228
7 -22.200IDP95294 response regulator protein [Staphylococcus aureus subsp. aureus USA300_FPR3757] YP_494943 [Staphylococcus aureus subsp. aureus USA300_FPR3757]  ali follow..  20  130.......GNLTLNQSYLELQV--SNKTMTLPNKEFQLLFMLAARPK-QIFTREQIIEKIWG-YDYEGDERTVDVHIKRLRQRLKKLNATLTIETVRGQGYKVENHV......................................... 224
8 -21.900IDP95461 DNA-binding response regulator [Bacillus anthracis str. Sterne] YP_028080 [Bacillus anthracis str. Sterne]  ali follow..  14  160.......GTVLLNRKTFEVTI--GEQTVTLPLKEFELLFTLGSKAG-RTCSREQLIEDVWG-YDFEGNERTLDVHINRLREKFQEEKSKFSIKTIRGLGYRLEVS.......................................... 253
9 -21.700IDP02231 gene: lisR; two-component response regulator [Listeria monocytogenes EGD-e] lmo1377 [Listeria monocytogenes EGD-e]  ali follow..  15  134.......RNLIVEKENRIVK--RDEEIIDLTKREYELLLTLMENVN-IVLTREVLLNKVWG-YETEVETNVVDVYVRYLRNKIDHPDEESYIQTVRGTGYVMRT........................................... 226
10 -21.400IDP91042 AdeR [Acinetobacter baumannii] ACB0002 [Acinetobacter baumannii]  ali follow..  15  144.......KNIEIDTDTHSVYIHSENKKLNLTLTEYKIISFMIDQPH-KVFTRGELMNHCMNDS--DALERTVDSHVSKLRKKLEEQGIFQMLVNVRGVGYRLDNPVAIKDDA................................... 247
11 -21.000IDP01662 hypothetical protein lmo2583 [Listeria monocytogenes EGD-e] lmo2583 [Listeria monocytogenes EGD-e]  ali follow..  13  131.......GNITIDQKSYGIKI--GNQERMIPVKEFELLYQLASYPG-RIFTREELIERIWQ-RDYDGSDRTVDVHIKRLRDHFDEEKDGIRIVTVRGVGYKLEET.......................................... 224
12 -19.600IDP91359 response regulator [Vibrio vulnificus CMCP6] VV1_2847 [Vibrio vulnificus CMCP6]  ali follow..  14  130.......GDLSLDTRTSKVM--WQGQAVSLTALEYKVVAYFVHNAD-KVISRTELVEHIY-KQDFDRDSNTIEVFIGRIRKKIA----PNIIKTVRGLGYQLNAN.......................................... 219
13 -19.300IDP91047 gene: vanRD; response regulator [Enterococcus faecium] EFA0003 [Enterococcus faecium]  ali follow..  12  139.......RGMTISKSSHKCIL--FGKEIQLTPTEFSILWYLCERQG-TVVSTEELFEAVWGER-FFDSNNTVMAHIGRLREKMKEPRNPKFIKTVWGVGYTIEK........................................... 232
14 -19.300IDP04024 DNA-binding response regulator YycF [Bacillus anthracis str. Sterne] BAS5319 [Bacillus anthracis str. Sterne]  ali follow..  12  138.......GPIVINPNAYSVTK--REENIELTHREFELLHYLAKHLG-QVMTREHLLQTVWG-YDYFGDVRTVDVTVRRLREKIED-SHPTLIVTRRGVGYYLRDP.......................................... 232
15 -19.300IDP91043 gene: vanRG; response regulator [Enterococcus faecalis] EFE0003 [Enterococcus faecalis]  ali follow..  14  142.......NGLVINKNTHKCTL--YGKAVTLTPIEFSVLWYLCENRG-KVISSEELFENVWGEK-FLDNNNTVMAHIGRLREKLKEPRNPKFIKTVWGVGYTIEE........................................... 235
16 -19.200IDP02446 hypothetical protein lmo0287 [Listeria monocytogenes EGD-e] lmo0287 [Listeria monocytogenes EGD-e]  ali follow..  11  140.......GSLIIHPDAYVASK--RGETIELTHREFELLHYLAKHMG-QVMTREHLLQTVWG-YDYFGDVRTVDVTVRRLREKIED-SHPAWLVTRRGVGYYLRNP.......................................... 234
17 -19.100IDP90005 gene: qseB; quorum sensing Escherichia coli regulator B [Escherichia coli O157:H7 EDL933] Z4377 [Escherichia coli O157:H7 str. EDL933]  ali follow..  17  130.......GNVMLDPGKRIAT--LAGEPLTLKPKEFALLELLMRNAG-RVLPRKLIEEKLY-TWDEEVTSNAVEVHVHHLRRKLG----SDFIRTVHGIGYTLGEK.......................................... 219
18 -18.900IDP92626 gene: cpxR; DNA-binding response regulator in two-component regulatory system with CpxA [Escherichia coli str. K-12 substr. MG1655] b3912 [Escherichia coli str. K-12 substr. MG1655]  ali follow..  17  137.......DALVLNPGRQEASF--DGQTLELTGTEFTLLYLLAQHLG-QVVSREHLSQEVLGKR-LTPFDRAIDMHISNLRRKLPDRDGHPWFKTLRGRGYLMVSA.......................................... 231
19 -18.700IDP00057 lantibiotic biosynthesis DNA-binding response regulator, putative BA_3900 [Bacillus anthracis str. Ames]  ali follow..  17  129.......SGLTFHLSCKEIWY--DDTSIAFTKSEYGICEYLALNHG-QVFSREKIYENVFG-YEGESDNQVIVEHIKNIRHKLSKYG-MNPIETVWGIGYKWRK........................................... 220
20 -18.100IDP95471 hypothetical protein [Listeria monocytogenes 10403S] YP_005962623 [Listeria monocytogenes 10403S]  ali follow..  12  134.......TYFKISKRTREIF-YQDELLDALTPKEFDLLYFLMQHPR-QVFSREQLLEQVWG-YQFYGDERTVDVHIKRLRQKIATET-KPFLHTVWGVGYKFDET.......................................... 227
21 -9.130IDP90978 hypothetical protein y0549 [Yersinia pestis KIM 10] y0549 [Yersinia pestis KIM10+]  ali follow..  10  1...........................MLLSTKQFRHYTLALLLASGKPVDADDIYDKL-------CSGPTLTRALKELRETYN-----EIRYSKSTHSYQLTE........................................... 67

FFAS is supported by the NIH grant R01-GM087218-01
1 3 9 5 5 6   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Doctor KS, Reed JC, Godzik A., Bourne PE. The apoptosis database. Cell Death Differ. 2003 Jun;10(6):621-33. Review.