current user: public

If you have questions about the server, please let us know.

Query: d1dlwa_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Ciliate (Paramecium caudatum) [TaxId: 5885]}, from SCOP207

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .
# Score Template Links and tools%idFirst SLFEQLGGQAAVQAVTAQFYANIQADATVATFFNGIDMPNQTNKTAAFLCAALGGPNAWTGRNLKEVHANMGVSNAQFTTVIGHLRSALTGAGVAAALVEQTVAVAETVRGDVVTVLast
1 -56.200[R] COG2346 Truncated hemoglobins  ali follow..  24  25TLYEAIGGDATVRALTRRFYELMDTLPEAARCRAPADLSGSEAKFYDYLTGYLGGPPVYVEKMLRRRHFVAPIGPAERDEWLLCFRRAMDETIENAKLREIIWAPVERLAFHMQN. 145
2 -10.200[C] COG1017 Hemoglobin-like flavoprotein  ali follow..  13  22............PKLTAHFYDRMFTNPELKEIFNNQRNGDQREALFNAIAAYASNIENLPAEKIAQKHTSFQIKPEQYNIVGTHLLATLDEFNPGQEVLDAWGKAYGVLANVFIH. 133
3 -6.060[P] COG3626 Uncharacterized enzyme of phosphonate metabolism  ali follow..  1.MYVAVGGEKAIDAAHALQESRRRGDTDLPEL----SVAQIEQQLNLAVDRVMTEGGIADRELAALALKQASGDNVEAIFLLRAYRTTLAKLAVSEPLDTTEMRLERRISAVYKDI 112
4 -5.680[S] COG1630 Uncharacterized protein conserved in archaea  ali follow..  357...............VNIGYVRFERGDVIYMVQSTKKIEDILPLILHH------RVGGYI--PLQLAHDGAKISYKEARMALDALINYLRN-------KDPELKVFTKYGRSPLE. 442
5 -5.380[S] COG5452 Uncharacterized conserved protein  ali follow..  16  2.IFGLFKKKSGNIAIVKRQYAALTAAARQPFLYTDLDVPDTVMGRFEMLSAIL----LYFRRTRSSARAGQEIAQEIVDAFFEDVDHSIRELGVGDASVPKKMKKLAG........ 105
6 -5.080[S] COG4367 Uncharacterized protein conserved in bacteria  ali follow..  10  1......................................................................MSLNKEQRRITAEELQAHFEESTLSVQMIAEKLNVTTEDVEKVLAM 46
7 -5.000[V] COG2602 Beta-lactamase class D  ali follow..  13  128.YYQALAGEERMKTWLHTLYGNEDISGGIDQFWLQSSLTISPLEQETFLEKLAKEELPFDKPVMKIVKRMMIQEEGD....................................... 207
8 -4.990[S] COG3662 Uncharacterized protein conserved in bacteria  ali follow..  12  29.....MMGVWIG--AIQNMYPELGAGVEEHSILLREPLQRVARSVYPIMGVVYDGDRA-TGQQIKGYHRTIGLTEAEKHQLFEEHVRWYRMYGMSMRPVPKSWEDFQDYWDRVCR. 175
9 -4.910[K] COG2944 Predicted transcriptional regulator  ali follow..  13  82.........................................................ELTPSEIKALRENNHVSQPVFARYLNTSESTVQKAKRPSGPALKLLSIVRKHGLEMLS. 143
10 -4.870[O] COG0443 Molecular chaperone  ali follow..  16  198...THLGGDDFDQRVIDHLLAEFKKTEGIDLSKDKAILQRLKDELSGVTVTNINLPFLTVGPDGEPKHMDIDLTRAQFQKMTEDLRRALSDSKLTPNDLDKVILVGGATRMPAVV. 324

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 0 2 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.