current user: public

If you have questions about the server, please let us know.

Query: d1ecaa_ a.1.1.2 (A:) Erythrocruorin {Midge (Chironomus thummi thummi), fraction III [TaxId: 7154]}, from SCOP207

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .
# Score Template Links and tools%idFirst LSADQISTVQASFDKVKGDPVGILYAVFKADPSIMAKFTQFAGKDLESIKGTAPFETHANRIVGFFSKIIGELPNIEADVNTFVASHKPRGVTHDQLNNFRAGFVSYMKAHTDFAGAEAAWGATLDTFFGMIFSKMLast
1 -41.000[C] COG1017 Hemoglobin-like flavoprotein  ali follow..  13  2LDAQTIATVKATIPLLVETGPKFYDRMFTHNPELKEIFNM----------SNQRNGDQREALFNAIAAYASNIENLPALVEKIAQKHTSFQIKPEQYNIVGTHLLATLDEMFNGQEVLDAWGKAYGVLANVFIHR. 134
2 -27.300[C] KOG3378 Globins and related hemoproteins  ali follow..  10  259ITERQKHIFTETFPVIFKEGLVLFAKYFSEFPHYKNIWPQFRTLQDSALLASNELANHCSVYMSGLKV.................................................................... 330
3 -9.800[R] COG2346 Truncated hemoglobins  ali follow..  40....................TRRFYELMDTLPEAARCRAI----------HPADLSGSEAKFYDYLTGYLGGPPVYVEK-PMLRRRHFVAPIGPAERDEWLLCFRRAMDETIENAKLREIIWAPVERLAFHMQNQ. 146
4 -6.800[S] KOG3077 Uncharacterized conserved protein  ali follow..  11  156FTLQEWLKGMTSLQCDTTEKLRNTLDYLRSFLNDSTNFKLIYRYAFDFAREKDQRSLDINTAKCMLGLLLGKIWPLFPVFHQFLEQSKYKVINKDQWCNVLE-FSRTINLDLSNYDEDGAWPVLLDEFVEWYKDK. 289
5 -6.270[A] KOG1914 mRNA cleavage and polyadenylation factor I complex, subunit RNA14  ali follow..  1MSGLSMRNPERAWNLL-DQERDFYESLVKQFPNSGRYWKAYIEHELR--------SKNFENVEKLFSRCLVSVLNIDLWKCYIHYVFETKGQRDQYREEMAKAYDFALEKVGMDVQAYSIFTEYIAFLKKV..... 141
6 -6.110[L] KOG2249 3`-5` exonuclease  ali follow..  10  123.RGRVSELARCS--IVSYHGDVLYDKYIRPEMPIADYRTRWSGITRQHMRKAVPFQVAQKEILKLLKGKVVVGHALHNDFQALKYVHPRSQTRDTTYVSLKDLALQLLHKKIGHSSVEDA................ 259
7 -5.530[M] COG2173 D-alanyl-D-alanine dipeptidase  ali follow..  42LHKDAITALAKSISIAQLSGLQLVI--YRPQQAQAMLWQACPDPQYVVDVTVGSNHSRGTAIDLTLRDEHGNILDMGAGFDEMHERSHAYHPSVPPAAQRNRLLLNAIMTGGGFVGISSEW............... 163
8 -5.470[K] KOG3779 Homeobox transcription factor prospero  ali follow..  11  580LSPNHLKKAKLMFFYTRYPSSNMLKTYF---SDVKKWFSNFREF---------QMEKYARQ---AINDGVTSTEELDCELYRALNMHYNKAVPERFLEVAQITLREFFNAIIAGKDVDPSWKKAIYKVICKLDSEV 721
9 -5.330[E] COG4401 Chorismate mutase  ali follow..  10  20ILDATEGLMRTICEENEIDPENVAQVILTVTEDLTATFPAKALRRLAGWTHVPVMCAQEIPVPNGLEKCIRVMITLNTTKAQSEIHHV................................................ 107
10 -5.170[A] KOG2047 mRNA splicing factor  ali follow..  43.................KKRFIIYERALKALPGSYKLWYAYLRERLDIVRNLPVTHPQYDSLNNTFERGLVTMHKMPRIWVMYLQTLTVQQLITRTRRTFDRAL-----CALPVTQHDRIWEPYLVF......... 147

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 0 2 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.