current user: public

If you have questions about the server, please let us know.

Query: d3ci3a1 a.25.2.0 (A:2-188) automated matches {Lactobacillus reuteri [TaxId: 1598]}, from SCOP207

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .
# Score Template Links and tools%idFirst KIYTKNGDKGQTRIIGKQILYKNDPRVAAYGEVDELNSWVGYTKSLINSHTQVLSNELEEIQQLLFDCGHDLATPADDERHSFKFKQEQPTVWLEEKIDNYTQVVPAVKKFILPGGTQLASALHVARTITRRAERQIVQLMREEQINQDVLIFINRLSDYFFAAARYANYLEQQPDMLYRNSKDVFRLast
1 -88.400[S] COG2096 Uncharacterized conserved protein  ali follow..  40  10KIYTRTGDKGTTALVSGPRRLKHDLRVEAYGTVDETNSAIGIARLHTSG-LETLDAMLFRIQNDLFDLGADLATPDNGEPLSPLRIVESQVMRLENEIDELNAALEPLTSFVLPGGSAAAANLHMARTVCRRAERLMVELSVTEIVSPAALKYANRLSDFLFVAARFTNE-AGRADILWVPGKN... 195
2 -44.300[E] COG4812 Ethanolamine utilization cobalamin adenosyltransferase  ali follow..  13  84RQPVAKKPDTLTHLSAEKMVAKSDPRLGFRAVLDSTIALAVWLQIELA---EPWQPWLADIRSRLGNI---MRADALGEPLGCQAIVGLSDEDLHRLSHQPLRYLDHDHLVPEASHGRDAALLNLLRTKVRETETVAAQVFITRSLRPDILQALNRLSSTVYVMMILSVTKQPLTVKQIQQRLGETQ 267
3 -7.260[O] KOG0448 Mitofusin 1 GTPase, involved in mitochondrila biogenesis  ali follow..  10  69.................EVLSRRHMKVAFFGRTSSINAMLW--DKVLPSGIGHITNCFLSVEGYLMTEGSDEKKSVKTVNQLAHALHMDKDLKAGCLVRVFWPKAK-LRDDLVPGTDVTTELDSWIDKFCLDADVFVLVANSESTLMNTEKHFFHKVNPNIFILNNRWDASASEPEYMEDVRRQHME 258
4 -5.900[R] COG1574 Predicted metal-dependent hydrolase with the TIM-barrel fold  ali follow..  11  46RVTTLDRTNPNA-----TAIAIKDGLFLEVGSDSEVMALAGSGTKIVDLKGKGVLPGLIDNHTHVVRGGLNYNM----------ELRWDGVRSLADAMDMLKRQVAPAPQWVRVVGGFTEHQF---------AEKRLPTIEEINAVAPDTPVFLLHLYDRALLNGAALRAVGYTRDTPNPPGGEITR 210
5 -5.870[S] COG2237 Predicted membrane protein  ali follow..  13  17KIYKRTGSPGEKYLHKNDRGDKAKMETPIVGREANVRAAVALGIADPEDSDTNTIFGGIRILDELLEKGVDAEIVSFAGDKNVGVISDQ---KIAEQLELYLQMNEVKRAVFVSDGAEDETLVPIVQSRMKIDSVKRIVVMQSENLESTYYILKHVFSD............................ 190
6 -5.820[R] COG3969 Predicted phosphoadenosine phosphosulfate sulfotransferase  ali follow..  18  11...........................................................................................NVLEAAQERIMWTLETLPRVCVSGGKDSGLMLHLTATLARKMNKKIHVLFIDWEAQSCTITYIESLREYY.......................... 83
7 -5.580[K] KOG4552 Vitamin-D-receptor interacting protein complex component  ali follow..  12  3....................FHLSTKERLLLLIDDIEMIAKELIEQAHQKISS--TELVDLLDLLVAKDEEFRKMLELAEEQAKV--EEAMDQLRAKVEVHDREIQKLQKSLKDAELILSTAIFQARQKLASINQ-----ANKRPVSEELIKYAHRISSA........................... 134
8 -5.490[H] COG2227 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase  ali follow..  14  59..............................GILSEAMAQRGASVTGIDMGEAPLAVARLHQLESGVAVDYRQITAEQMAEEMPGQFDVVTCLEMLEHVPDPASVIRACHRLVKPGGQV------FLSTINRNPKAYLFAVIGAEYILQLLPRGTHDFRKFI.......................... 183
9 -5.340[J] COG2813 16S RNA G1207 methylase RsmC  ali follow..  12  210TIHNHANVFSRTGLDIGARFFMQHLPENLEGEIVDLGCGNGVIGLTLLDKNPQAKVVFVDESPMAVASSRLNVETNMPEALDRCEFMIN---------NALSGVEPFRFNAVLPFHQQHALTDNVAWEMFHHARRCLKINGELYIVANRHLDYFHKLKKIF.......................... 364
10 -5.340[S] KOG4559 Uncharacterized conserved protein  ali follow..  10  69...........................EDYKLLEEMNKATIAKYKDMRQIAENLNTSTSELSLKFQQLAPMM----------------QQIDEISDTVDKLEAAAYKLDAYSI.......................................................................... 138

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 8   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Plewczynski D, Tkacz A, Godzik A., Rychlewski L. A support vector machine approach to the identification of phosphorylation sites. Cell Mol Biol Lett. 2005;10(1):73-89.