current user: public

If you have questions about the server, please let us know.

Query: d3ldqb1 a.7.7.1 (B:151-260) BAG-family molecular chaperon regulator-1, BAG1 {Human (Homo sapiens) [TaxId: 9606]}, from SCOP207

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110
# Score Template Links and tools%idFirst NSPQEEVELKKLKHLEKSVEKIADQLEELNKELTGIQQGFLPKDLQAEALCKLDRRVKATIEQFMKILEEIDTLILPENFKDSRLKRKGLVKKVQAFLAECDTVEQNICQLast
1 -22.500[T] KOG4361 BCL2-associated athanogene-like proteins and related BAG family chaperone regulators  ali follow..  18  127KRFLEMRKIAKTEKASKAISDISLEVDRLGGRVSAF------EMVTKKGGKIAEKDLVTVIELLMNELIKLDAIVAEG---DVKLQRKMQVKRVQNYVETLDALKVKNSM 227
2 -6.560[S] COG1885 Uncharacterized protein conserved in archaea  ali follow..  12  14...........VKDVESVEEAIEAAVNKVMTALEKEKLDFVRVELGYSKGAHFESAFVVGNIGLVGIYLTLKVFNAQSLEHAERIAKAVVGKALKKVLKLFE........ 109
3 -6.080[U] KOG3838 Mannose lectin ERGIC-53, involved in glycoprotein traffic  ali follow..  315NQRELRQIWQGQSQIADHLRELSRKVDEIIGRQETTLSLVSRNAGQALPPPAAGGVPQQQLPVGAVSRSDVDLL---TNQNMLLSSIREIRQLVGDINVRTDNIQTNQKH 422
4 -5.790[UR] KOG4677 Golgi integral membrane protein  ali follow..  11  390............QEMKRQGDQHQSKMLEKENELRKTISD-LRSRMRDEQTKQEDDGSSQLTDLLLQKQQQLEDVLRNNQVLNVRLERNINNPQTRNALHTVDSTAFKL.. 514
5 -5.710[U] KOG3251 Golgi SNAP receptor complex member  ali follow..  3...................NTLYNHCTKLFQSIQRSLDELERGVQDESNTISLAGIQGQISASFLSLSRSIDDYDSMVQRELVPAKKKKATIRIQEFRQKHVQLLEKFDE 93
6 -5.650[S] KOG3270 Uncharacterized conserved protein  ali follow..  15  287.EPSLEAKRQTVLDKYELLTQMKSTFEKKMQRQHELSESCSASALQAVAAHEAEEESDNIAEDFLEGKMEIDDLSSFMEKRTICHCRRAKEEKLQQAIAMHSQFHAPL.. 397
7 -5.560[R] KOG3768 DEAD box RNA helicase  ali follow..  21  809NTELKAQIMKEIRKPGRKYERIFTLLKHVQGSLQ-------------------------TRLIFLQNVIK----------EASRFKKRMLIEQLENFLDEIHRRANQINH 883
8 -5.510[U] KOG0412 Golgi transport complex COD1 protein  ali follow..  11  5.EQLGALDIGTNEQVDETLQRIADEEAKVNEKLESLLAKQCQIEAKMSGIGRSLSLLHTVDSDSNKLNDQIVNTA-------------QLAESVSAKVRRLDLARCRASE 100
9 -5.410[R] KOG4253 Tryptophan-rich basic nuclear protein  ali follow..  12  36..................................................NELSKKYLAKVKERHELKEFNNSISAQDNYAKTKNNRK--LDSLDKEINNLKDEIQS... 91
10 -5.330[L] KOG4835 DNA-binding protein C1D involved in regulation of double-strand break repair  ali follow..  12............VEIHEYLSAFENSIGAVDEMLKTMMSVSRNELLQKLDPLEQAKVDLVSANSMFWVYLATQGVNPKEHPVKQELER------IRVYMNRVKEITDKKKA 106

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 2 0 9   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35