current user: public

If you have questions about the server, please let us know.

Query: d4i0va_ a.1.1.1 (A:) automated matches {Synechococcus sp. [TaxId: 32049]}, from SCOP207

Results of FFAS03 search in COG1018
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120
# Score Template Links and tools%idFirst ASLYEKLGGAAAVDLAVEKFYGKVLADERVNRFFVNTDMAKQKQHQKDFMTYAFGGTDRFPGRSMRAAHQDLVENAGLTDVHFDAIAENLVLTLQELNVSQDLIDEVVTIVGSVQHRNDVLNRLast
1 -56.200[R] COG2346 Truncated hemoglobins  ali follow..  17  24VTLYEAIGGDATVRALTRRFYELMDTLPEAARCRAPADLSGSEAKFYDYLTGYLGGPPVYVEKHGHPMLRRRHFVAPIGPAERDEWLLCFRRAMDETIENAKLREIIWAPVERLAF--HMQNQ 146
2 -7.290[S] KOG4147 Uncharacterized conserved protein  ali follow..  25..VYHGVNLDQTVKEFIVFLKQDIPLRTNLPPPFRNYKYDALK---------------------IHQAHKSKTNELVLSLEDDERLLLKEDSTLKAAGIASETEIAFFCEEDYKNYKANPISS 125
3 -7.280[C] COG1017 Hemoglobin-like flavoprotein  ali follow..  14  22.............PKLTAHFYDRMFTNPELKEIFNMSNQRNGDQREALFNAIAAYASNIENLPALLPAVEKIHTSFQIKPEQYNIVGTHLLATLDEFNPGQEVLDAWGKAYGVLAN....... 129
4 -5.890[S] COG4103 Uncharacterized protein conserved in bacteria  ali follow..  9..IWLTRKEALMAFALLDQIRSIFDGDPG-----RKVADDPVLSAELLMLFRMILADGTVSESEMVAFRRICKDAFGIQETSIDAVIEYLNEFGYETDLDVERRKQLAQHMAEIAKADSQLAE 135
5 -5.820[S] COG0700 Uncharacterized membrane protein  ali follow..  7KNVMDMFGARRGFTIATTNLLPNVVMAFVIIQALKITGLLDWVGHICQPVMALWGLPGEMSMGGAVGVAASLATAGALSGHDVTVLLPAIYLM.............................. 110
6 -5.350[S] COG5452 Uncharacterized conserved protein  ali follow..  11  2..IFGLFKKKSGNIAIVKRQYAALTAAARQPFLYTDLDVPDTVMGRFEMLS-------AILILYFRRTRSSARAGQEIAQEIVDAFFEDVDHSIRELGVGDASVPKKMKKLAG.......... 105
7 -5.160[V] COG2602 Beta-lactamase class D  ali follow..  13  128..YYQALAGEERMKTWLHTLYGNEDISGGIDQFWLQSSLTISPLEQETFLEKLAKEELPFDKPVMKIVKRMMIQE................................................ 204
8 -4.930[J] KOG2758 Translation initiation factor 3, subunit e (eIF-3e)  ali follow..  306..........DGAQKKLRECESVLVNDFFLVACLEDFIENARLFIFETFC-------RIHQCISINMLADKLNMTPEIRNARLDAKIDSKLGHVVMGNNAVSPYQQVIEKTKSLSFRSQMLAM 420
9 -4.680[H] COG0302 GTP cyclohydrolase I  ali follow..  10  123....GRVVGLSKIARVVDIFARRLQTQESITAQIADSIQRILKPREAEHMCMAMRSIRKQGSSTITTTFTGDFKEKADQQVRFMTLIR................................... 212
10 -4.640[K] KOG2434 RNA polymerase I transcription factor  ali follow..  10  312..........ERLDILMSLVLSYMKD-RDLINIFDKLLLPTHASCHVQFFMFYL----------------------SFKLGFAEAFLEHLWKKLQDPSNPAIIRQAAGNYIGSFLARAKFIP. 418

FFAS is supported by the NIH grant R01-GM087218-01
1 4 2 0 2 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Friedberg I, Godzik A. Functional differentiation of proteins: implications for structural genomics. Structure. 2007 Apr;15(4):405-15.