current user: public

If you have questions about the server, please let us know.

Query: d1cg5b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Cartilaginous fish akaei (Dasyatis akajei) [TaxId: 31902]}, from SCOP207

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst VKLSEDQEHYIKGVWKDVDHKQITAKALERVFVVYPWTTRLFSKLQGLFSANDIGVQQHADKVQRALGEAIDDLKKVEINFQNLSGKHQEIGVDTQNFKLLGQTFMVELALHYKKTFRPKEHAAAYKFFRLVAEALSSNYHLast
1 -40.200IDP01484 nitric oxide dioxygenase VCA0183 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  14  2..LTQEHINIIKSTIPLLESPALTQHFYQRMFSHNPELKHIFNMTHQKTGRQSVAL----FEAIAAYAKHIDNLAALTSAVERIAHKHTSFNIQPEHYQIVGHHLLETLRELAPDAFTQPVEEAWTAAYFFLAQVFIDR.. 136
2 -38.600IDP00644 flavohemoprotein, putative SACOL0220 [Staphylococcus aureus subsp. aureus COL]  ali follow..  14  2..LTEQEKDIIKQTVPLLKETEITSIFYPKMFKAHPELLNMFNQTNQKRGMQSSAL----AQAVMAAAVNIDNLSVIKPVIMPVAYKHCALQVYAEHYPIVGKNLLKAIQDVTGLEENDPVIQAWAKAYGVIADVFIQI.. 136
3 -36.900IDP00562 gene: hmp; nitric oxide dioxygenase YPO2908 [Yersinia pestis CO92]  ali follow..  14  2..LDTQTIAIVKSTIPLLAAPKLTAHFYERMFKHHPELKNIFNMSNQSSGDQREAL----FNAICAYATNIENLAALLPTVERIAQKHTSLNIQPEHYPIVGEHLIATLDELFSP--GQAVLDAWAKAYGVLADVFIQR.. 134
4 -7.450IDP02284 gene: grpE; heat shock protein GrpE [Coxiella burnetii RSA 493] CBU_1293 [Coxiella burnetii RSA 493]  ali follow..  11  78.........................................MDNLRKRIEREKADIIKFGSKQL--ITDLLPVADSLIHGLESPASEDPQVKSMRDGMSLTLDLLHNTLAKNPGDPFDPALHEAMSVQ-DTIIQVLQKGY. 188
5 -7.040IDP06380 gene: ORF46; ORF46 [Human herpesvirus 8] YP_001129398 [Human herpesvirus 8]  ali follow..  12  21....DDRDLLLAPKWSFLSLSSFLKQKLLSLLRVYPPQDKLMWWSHCCDPEDIKVVKGQATGLAFSVDPQCQVPPSLRSIFRELEASVPNFSTPSDSWARQGVLLLNTVLTVEKGRAGSHEGLGWDWFTSFIISSISSK.. 178
6 -7.030IDP00491 heat shock protein GrpE YPO1107 [Yersinia pestis CO92]  ali follow..  11  64.........................................VENIRRRTELDVEKAHKFALERF--SSELLPVIDNLERALDTADKTNTELISMIEGVELTLKSLLDAVGKFTHVPFNPEVHQAMTML-NHVMMVMQKGY. 173
7 -6.940IDP02504 gene: ung; uracil-DNA glycosylase [Francisella tularensis subsp. tularensis SCHU S4] FTT1578c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  11  2.............TWSDILAEEKQKPYFKQILDIFPTKENIFNAFKYTELDNLKVVYNQAHGLAFSVQKGVDIPPSLQNIYKELARSIPEFKTPNVDWAKQGVFLLNTTLTVEAHKANSHKDIGWETFTDTVINKISEN.. 151
8 -6.910IDP90943 DNA replication intiation control protein YabA [Bacillus anthracis str. Sterne] BAS0032 [Bacillus anthracis str. Sterne]  ali follow..  11  7...................................................EKKDIFASVSSMEEQIGHLYKQLGELKQHLAELLEENQHIKMENENLRHRFEEVQIKEKQKTQKRKEVKPKTDIGEGYDNLARLYQEGFH 96
9 -6.870IDP01403 heat shock protein GrpE VC0854 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  16  75.........................................VENMRRRSEQEVDKARKFALSRF--AEELLPVIDNLERAIQAADGEVEAIKPLLEGVELTHKTFVDTIAKFHGEVFNPEFHQAMSIQ-NTVMFVMQKGY. 184
10 -5.880IDP02360 gene: grpE; heat shock protein GrpE [Francisella tularensis subsp. tularensis SCHU S4] FTT1270c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  10  70.........................................MENIRKRAERDVSNARKFGIEKF--SKELLPVIDSIEQALKHEVKLEEAIAMK-EGIELTAKMLVDILKKNKGEKFDPNLHEAMAMI-NTIFDVFQKGY. 178

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.