current user: public

If you have questions about the server, please let us know.

Query: d1dlwa_ a.1.1.1 (A:) Protozoan/bacterial hemoglobin {Ciliate (Paramecium caudatum) [TaxId: 5885]}, from SCOP207

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .
# Score Template Links and tools%idFirst SLFEQLGGQAAVQAVTAQFYANIQADATVATFFNGIDMPNQTNKTAAFLCAALGGPNAWTGRNLKEVHANMGVSNAQFTTVIGHLRSALTGAGVAAALVEQTVAVAETVRGDVVTVLast
1 -8.330IDP00562 gene: hmp; nitric oxide dioxygenase YPO2908 [Yersinia pestis CO92]  ali follow..  14  18........AATGPKLTAHFYERMFKHPELKNIFNGDQREALFNAICAYATNIENLAALLP-ERIAQKHTSLNIQPEHYPIVGEHLIATLDEFSPGQAVLDAWAKAYGVLADVFIQ. 133
2 -7.770IDP01484 nitric oxide dioxygenase VCA0183 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  15  18........ESAGPALTQHFYQRMFSNPELKHIFNGRQSVALFEAIAAYAKHIDNLAALTS-ERIAHKHTSFNIQPEHYQIVGHHLLETLRELAFTQPVEEAWTAAYFFLAQVFID. 135
3 -7.130IDP00644 flavohemoprotein, putative SACOL0220 [Staphylococcus aureus subsp. aureus COL]  ali follow..  12  18........KEKGTEITSIFYPKMFKHPELLNMFNGMQSSALAQAVMAAAVNIDNLSVIKP-MPVAYKHCALQVYAEHYPIVGKNLLKAIQDV-TGLEENDPVIQAWAKAYGVIADV 132
4 -6.890IDP06490 gene: D19L; D19L [Monkeypox virus Zaire-96-I-16] NP_536449 [Monkeypox virus Zaire-96-I-16]  ali follow..  13  95AILDKMTADIKLTDLVRHYFRYIEQDIPLGPLFKKID--------------------SYRIRAINNYSKELGLATEYFNKYGHLMFYTL........................... 163
5 -5.800IDP91463 bacteriophage phi gp55-like protein [Vibrio vulnificus CMCP6] VV1_0079 [Vibrio vulnificus CMCP6]  ali follow..  22QTLKDYGHNETVEQHLNKRPGVLLN-FDAIKLMQFTGDVQILRSIASELNHSIYFLGDYRAISDMELLNCYSRWHAEIGDVNRAIADALEDGDIERHEFDRIERELQETFAAALEL 149
6 -4.830IDP06017 hypothetical protein TGME49_002020 [Toxoplasma gondii ME49] EEB00348 [Toxoplasma gondii ME49]  ali follow..  15  296...GDIGVLDAVNELAKHLRHHIKERFHEEIRTKTARYWRMSMKAIRALCDVNQAAIDLKF--LKNSDVRYDITRKHFDKLRAFLEETFSKAGVAGTNVVAADVLNSLARSAWIH. 417
7 -4.720IDP06138 aminotransferase [Helicobacter pylori J99] NP_223391 [Helicobacter pylori J99]  ali follow..  283........................PSLSMTTIVSEHAKELKNLLKEKYQVQFAGGQEPYKDTLIRINHMG-IIPVYKSAYALNALELALNDLDLREFDGMANTTFLKQYYE..... 368
8 -4.650IDP92592 heat shock protein 70, putative [Toxoplasma gondii ME49] TGME49_073760 [Toxoplasma gondii ME49]  ali follow..  10  227...THLGGEDFDNRLVDFCVQDFKRKNRGKDISTNTQCERTKRTLSSSTQATIEIDSLFEGIDYSVSISR-ELCMDYFRNSLLPVEKVLKDSGIDKRSVSEVVLVGGSTRIPKIQ. 349
9 -4.590IDP00303 beta-ketoacyl synthase CBU_0035 [Coxiella burnetii RSA 493]  ali follow..  195.....AGGVEGASPYIWGGFDAMRVEKASRPMSASASLESAEQRGARIYAEILS------SVNCGGQRQGGSMTAPNPLGVQRCIQSAIEYATISPSEIDAINGHLTGTMADKMEL 324
10 -4.460IDP05137 hypothetical protein CD0227 [Clostridium difficile 630] CD0227 [Peptoclostridium difficile 630]  ali follow..  40........LEDIKRNLDGVKK---AGERLVLTQNYGDISRYKNAVKEYLKSVVDNMYSLDKSSSFWEHQYYKNVKIIDNKLEDMTSKLLNE----EKENIDIVSTVDMIQGLLIDM 140

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.