current user: public

If you have questions about the server, please let us know.

Query: d1gcva_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Houndshark (Mustelus griseus) [TaxId: 89020]}, from SCOP207

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst AFTACEKQTIGKIAQVLAKSPEAYGAECLARLFVTHPGSKSYFEYKDYSAAGAKVQVHGGKVIRAVVKAAEHVDDLHSHLETLALTHGKKLLVDPQNFPMLSECIIVTLATHLTEFSPDTHCAVDKLLSAICQELSSRYRLast
1 -37.600IDP01484 nitric oxide dioxygenase VCA0183 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  18  2.LTQEHINIIKSTIPLLESAGPALTQHFYQRMFSHNPELKHIFNMTHQKTGRQSVAL--FEAIAAYAKHIDNLAALTSAVERIAHKHT-SFNIQPEHYQIVGHHLLETLRELAPDFTQPVEEAWTAAYFFLAQVFIDREG 138
2 -36.200IDP00562 gene: hmp; nitric oxide dioxygenase YPO2908 [Yersinia pestis CO92]  ali follow..  20  2.LDTQTIAIVKSTIPLLAATGPKLTAHFYERMFKHHPELKNIFNMSNQSSGDQREAL--FNAICAYATNIENLAALLPTVERIAQKHT-SLNIQPEHYPIVGEHLIATLDELFSP-GQAVLDAWAKAYGVLADVFIQRES 136
3 -36.100IDP00644 flavohemoprotein, putative SACOL0220 [Staphylococcus aureus subsp. aureus COL]  ali follow..  13  2.LTEQEKDIIKQTVPLLKEKGTEITSIFYPKMFKAHPELLNMFNQTNQKRGMQSSAL--AQAVMAAAVNIDNLSVIKPVIMPVAYKHC-ALQVYAEHYPIVGKNLLKAIQDVTGLENDPVIQAWAKAYGVIADVFIQIEK 138
4 -4.970IDP06380 gene: ORF46; ORF46 [Human herpesvirus 8] YP_001129398 [Human herpesvirus 8]  ali follow..  11  21...DDRDLLLAPKWISF--SLSSFLKQKLLSLLRVYPPQDKLMWWSHCCDQDPYHKGQATGLAFSVDPQCQVPPSLRSIFRELEASVPNFSTPSHGCLDSWARQGVLLLNTVLGRAGSHEGLGWDWFTSFIISSISSKLE 180
5 -4.940IDP00753 glycosyl transferase, group 1 family protein SACOL0052 [Staphylococcus aureus subsp. aureus COL]  ali follow..  11  334..PEKQLNHQIELVSKLIKEFPNIQLHLYVFLRGFRRNLSAEIQDAYMSLITSNMEGFNLGLLETITEGIPPVGNSKYGPSELILNNENGYLINKNDKDELYNRVRNLLLKHSKAFSSKVMKLWEDRFSTINS....... 500
6 -4.810IDP00776 glycosyl transferase, group 1 family protein SACOL0612 [Staphylococcus aureus subsp. aureus COL]  ali follow..  11  365..............KKLNELIQKYGLENHVYLRGFLSNLDQEYSDAYLSLITSNMEGFSLALLESLAHGVPVISDIKYGPNELITSDFNGYLITKNDEDALFDKVKYVIDAKAQQYSKALIKQWDQFVRLI......... 496
7 -4.750IDP00834 glycosyl transferase, group 1 family protein SACOL2670 [Staphylococcus aureus subsp. aureus COL]  ali follow..  10  330..NEKHIDWLVKAVIVAKRQVPELTFDIYGERLLGHVKLDEIYNDYELFLSASTSEGFGLTLMEAVGSGLGMIGNVNYGNPTFIRDGENGYLVPFDTDEDSVDDVIAKLAEVAQQFMTQIILKWETLVQEVLH....... 501
8 -4.700IDP95088 DNA-binding transcriptional activator AllS [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044] YP_002918199 [Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044]  ali follow..  20...SRAAEKLYKTTATISYRIKLLEDNTGVALF-------------SRTTRSVLLTPAGMHLLAQAREWLGWIDSMPGELQQINDGVERQVNIVVNNLMYDPQAIARLLAWLTQRYPFTQFHFSRQIYMGVWDTLLHD.. 141
9 -4.470IDP00775 glycosyl transferase, group 1 family protein SACOL0611 [Staphylococcus aureus subsp. aureus COL]  ali follow..  328..ENKQIKHQIEVIKQLVTKHPNIQLNIYVKFHGFKTHINEEIAKAELMLSTSKMEGFGLAILESLSVGTPVISDVDYGPSELIQDGFNGYLVPQGDINQMVEKVDQLLNESAQQYNATISTKWQNILN........... 490
10 -4.360IDP95132 glucuronic acid transferase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] YP_001337621 [Klebsiella pneumoniae subsp. pneumoniae MGH 78578]  ali follow..  10  226AIAPTDRYLL-KDQPRYQALAKSLNCEARVRFFGMQSETLPFYQMADGLLLPTLYDPFPNVILEAMACGLPVITTTGCGGAEFIVDGHNGYVCDALDIPALQQAVMALPARALGSAEGGHARERIMACTSLSTQLLSLYQ 371

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.