current user: public

If you have questions about the server, please let us know.

Query: d1it2a_ a.1.1.2 (A:) Hagfish hemoglobin {Inshore hagfish (Eptatretus burgeri) [TaxId: 7764]}, from SCOP207

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .
# Score Template Links and tools%idFirst PIIDQGPLPTLTDGDKKAINKIWPKIYKEYEQYSLNILLRFLKCFPQAQASFPKFSTKKSNLEQDPEVKHQAVVIFNKVNEIINSMDNQEEIIKSLKDLSQKHKTVFKVDSIWFKELSSIFVSTIDGGAEFEKLFSIICILLRSAYLast
1 -36.200IDP01484 nitric oxide dioxygenase VCA0183 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  16  2..........LTQEHINIIKSTIPLLESAGPALTQHFYQRMFSHNPELKHIFNMTHQKTGR---------QSVALFEAIAAYAKHIDNLAALTSAVERIAHKHT-SFNIQPEHYQIVGHHLLETLRELAP-DAFTQPVEEAWTAAY 126
2 -35.800IDP00562 gene: hmp; nitric oxide dioxygenase YPO2908 [Yersinia pestis CO92]  ali follow..  13  2..........LDTQTIAIVKSTIPLLAATGPKLTAHFYERMFKHHPELKNIFNMSNQSSGD---------QREALFNAICAYATNIENLAALLPTVERIAQKHT-SLNIQPEHYPIVGEHLIATLDELFSPG---QAVLDAWAKAY 124
3 -35.300IDP00644 flavohemoprotein, putative SACOL0220 [Staphylococcus aureus subsp. aureus COL]  ali follow..  15  2..........LTEQEKDIIKQTVPLLKEKGTEITSIFYPKMFKAHPELLNMFN---------QTNQKRGMQSSALAQAVMAAAVNIDNLSVIKPVIMPVAYKHC-ALQVYAEHYPIVGKNLLKAIQDVTG-LEENDPVIQAWAKAY 126
4 -6.370IDP05307 lysyl-tRNA synthetase [Yersinia pestis CO92] YPO0362 [Yersinia pestis CO92]  ali follow..  14  211........................................FIYHFPASQASLAEISTEDHRVAERFEVYFKGIELANGFRELTDGDEQLQRFEQDNRNRAKRGLPQNPIDMNLIAALKQGLPDCSGVALGVDRLVMLALNA..... 311
5 -6.190IDP01693 gene: yjeA; lysyl-tRNA synthetase [Salmonella typhimurium LT2] STM4344 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  15  211........................................FIYHFPASQASLAQISTEDHRVAERFEVYYKGIELANGFHELTDAREQQQRFEQDNRKRAARGLPQQPIDQNLLDALAAGLPDCSGVALGVDRLVMLALGA..... 311
6 -5.420IDP91394 hypothetical protein VV1_1133 [Vibrio vulnificus CMCP6] VV1_1133 [Vibrio vulnificus CMCP6]  ali follow..  110.................ILDATWQEAR------------KMLNKSEWLKALLALHGDSASNYQLRRNQQQGNLCTLEIAAELVKQLGEAHNATSMTELL............................................... 181
7 -5.370IDP04616 S-adenosylmethionine:tRNA ribosyltransferase-isomerase [Bacillus anthracis str. Sterne] BAS4313 [Bacillus anthracis str. Sterne]  ali follow..  175.AAAPTAGLHFTEELLEKLKQKGVELAFITLHVGLGTFRPVSADTIEEHHMHAEYHMSEETAALLNRVKENGGRIITVGTTSTRTLETIATDHDGKLCAASGWTDIFMYPGYEFKAIKSTLIMLVSAFANRDNVLHAYNEAVKEKY 330
8 -5.320IDP90142 unknown [Monkeypox virus] MPXV_ZAI1979_005_188 [Monkeypox virus]  ali follow..  13  12PQHCGCDRLTSIDDVRQCLTEYWSSYAYRNRQCAGQLYGTLLSFKDDAESVFIDVRELVKNMPWD-NVKDCTEIIRCYIPDEQKTIREISAIIGLCAYAATYWGGEDHPTSNSLNALF--VMLGMLNYMDYTIIFWRM........ 148
9 -5.140IDP91492 putative type III secretion protein [Vibrio parahaemolyticus RIMD 2210633] VP1693 [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  1..........MERELRQLLAEILMATGMHRHQEANTIADCLEETSNSEEVSLMNKGAYEEAHRLLEPLCTAYPDLISLAALAAAKAGLLSQAERWMELAAQGSEESQAFAASFTQDIRNL.......................... 118
10 -5.070IDP01109 hypothetical protein GBAA_pXO1_0148 GBAA_pXO1_0148 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  10  1.............................MEATKRYLCLYLKESQEKFISNWKKRILVHEHDPYKNEIIKNGTHLLHVFTMYMREEINLQDIEDISKKIAQERMDAIADFIYNTNEGKKEILNTLFLL---NLFFDHLIYSTIYSY 131

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.