current user: public

If you have questions about the server, please let us know.

Query: d1itha_ a.1.1.2 (A:) Hemoglobin {Innkeeper worm (Urechis caupo) [TaxId: 6431]}, from SCOP207

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst GLTAAQIKAIQDHWFLNIKGCLQAAADSIFFKYLTAYPGDLAFFHKFSSVPLYGLRSNPAYKAQTLTVINYLDKVVDALGGNAGALMKAKVPSHDAMGITPKHFGQLLKLVGGVFQEEFSADPTTVAAWGDAAGVLVAAMKLast
1 -32.700IDP00562 gene: hmp; nitric oxide dioxygenase YPO2908 [Yersinia pestis CO92]  ali follow..  16  2.LDTQTIAIVKSTI-PLLAATGPKLTAHFYERMFKHHPELKNIFN----------MSNQSSGDQREALFNAICAYATNIENLLLPTVERIAQKHTSLNIQPEHYPIVGEHLIATLDELFSPGQAVLDAWAKAYGVLADVF. 131
2 -31.800IDP01484 nitric oxide dioxygenase VCA0183 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  12  2.LTQEHINIIKSTI-PLLESAGPALTQHFYQRMFSHNPELKHIFN----------MTHQKTGRQSVALFEAIAAYAKHIDNLLTSAVERIAHKHTSFNIQPEHYQIVGHHLLETLRELAPFTQPVEEAWTAAYFFLAQVF. 133
3 -31.000IDP00644 flavohemoprotein, putative SACOL0220 [Staphylococcus aureus subsp. aureus COL]  ali follow..  15  2.LTEQEKDIIKQTV-PLLKEKGTEITSIFYPKMFKAHPELLNMFN----------QTNQKRGMQSSALAQAVMAAAVNIDNLIKPVIMPVAYKHCALQVYAEHYPIVGKNLLKAIQDVTGENDPVIQAWAKAYGVIADVF. 133
4 -6.500IDP06380 gene: ORF46; ORF46 [Human herpesvirus 8] YP_001129398 [Human herpesvirus 8]  ali follow..  21...DDRDLLLAPKWISFLSL--SSFLKQKLLSLLRVYPPQDKLMWWSHCCDPEDIKQDPYHKGQATGLAFSVDPQCQSLRSIFRELEASVPNFSTPSHGCLDSWARQGVLLLNTVLTVEKGRAGSHEGWDWFTSFIISSIS 176
5 -6.120IDP93914 type III secretion apparatus protein [Yersinia enterocolitica subsp. enterocolitica 8081] YP_001007694 [Yersinia enterocolitica subsp. enterocolitica 8081]  ali follow..  37GIPQSTMDGLYAYAYEFYEQGKLKEAETFFRFLSIYDFYNTDYVMGLAAVYQLTKRYEKAVELYSLAF---------VLAKDDYRPLFHAGQCNLMLKKSSAALHCFESTF.............................. 138
6 -6.100IDP02504 gene: ung; uracil-DNA glycosylase [Francisella tularensis subsp. tularensis SCHU S4] FTT1578c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  11  2............TWSDILAEEKQKPYFKQILDFLACFPTKENIFNAFKYTELDNLK-----YNQAHGLAFSVQKGVDSLQNIYKELARSIPEFKTPNHGYLVDWAKQGVFLLNTTLTVEAHKANSHKGWETFTDTVINKIS 149
7 -5.870IDP93884 secretion system chaperone SscB [Yersinia enterocolitica subsp. palearctica Y11] YP_006007028 [Yersinia enterocolitica subsp. palearctica Y11]  ali follow..  10  29RVSQQEIQARYEQGYQAWLADNYITAVEDFSWLTLHRPLEPHFHLALAGALQMQQEFILALSAYASAL---------LLEAKSPGPVYQMAVCLHAIKRDADAREALQMVI.............................. 130
8 -5.780IDP04668 phaP protein [Bacillus anthracis str. `Ames Ancestor`] GBAA1327 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  1.METKPYELVDAFWKSLFSSAGKQLEQLTLETLKQQQDALHKLTSGVDELEKELQQFTAQFNNQYTYVKQLTGNSLNDQINEWQEKWKELSAHMHQLTVSPTKLTQTSGQFEETTKQFIEQQQLQREEAQKQLEGFLEEFK 152
9 -5.720IDP90142 unknown [Monkeypox virus] MPXV_ZAI1979_005_188 [Monkeypox virus]  ali follow..  23..IDDVRQCLTEYWSSYAYRNRQCAG-QLYGTLLSFKDDAESVFIDVRELVKNMPWDNVK------DCTEIIRCYIPDEQKTIREISAIIG-------------------LCAYAATYWGGEDHPTSNSLNALFVMLGMLN 137
10 -5.590IDP93896 secretion system chaperone SscA [Yersinia enterocolitica subsp. palearctica Y11] YP_006007024 [Yersinia enterocolitica subsp. palearctica Y11]  ali follow..  24KMDPQDLALVYDYSVQLCQGGEYDGAKRLLNLLVRFDHWNFSYWLTLGLCYQQTADFHQAIYCFSRAG---------QIQVDDPRSSCSAGECYLACGNRIYAEKAFRAAL--NWCHARPEWIHIQQQAERGLAALLLEV. 152

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.