current user: public

If you have questions about the server, please let us know.

Query: d1x9fd_ a.1.1.2 (D:) Extracellular dodecameric hemoglobin (erythrocruorin), subunit D1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}, from SCOP207

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140
# Score Template Links and tools%idFirst ECLVTESLKVKLQWASAFGHAHERVAFGLELWRDIIDDHPEIKAPFSRVRGDNIYSPEFGAHSQRVLSGLDITISMLDTPDMLAAQLAHLKVQHVERNLKPEFFDIFLKHLLHVLGDRLGTHFDFGAWHDCVDQIIDGIKLast
1 -37.000IDP01484 nitric oxide dioxygenase VCA0183 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  15  2.LTQEHINIIKSTIPLL---ESAGPALTQHFYQRMFSHNPELKHIFNMTHQKTGRQSV------ALFEAIAAYAKHIDNLAALTSAVERIAHKHTSFNIQPEHYQIVGHHLLETLRELAPDAFTQPAWTAAYFFLAQVF. 133
2 -35.800IDP00644 flavohemoprotein, putative SACOL0220 [Staphylococcus aureus subsp. aureus COL]  ali follow..  15  2.LTEQEKDIIKQTVPLL---KEKGTEITSIFYPKMFKAHPELLNMFN------QTNQKRGMQSSALAQAVMAAAVNIDNLSVIKPVIMPVAYKHCALQVYAEHYPIVGKNLLKAIQDVTGLEENDPAWAKAYGVIADVF. 133
3 -34.800IDP00562 gene: hmp; nitric oxide dioxygenase YPO2908 [Yersinia pestis CO92]  ali follow..  16  2.LDTQTIAIVKSTIPLL---AATGPKLTAHFYERMFKHHPELKNIFNMSNQSSGDQRE------ALFNAICAYATNIENLAALLPTVERIAQKHTSLNIQPEHYPIVGEHLIATLDELFSPGQALDAWAKAYGVLADVF. 131
4 -6.670IDP90210 gene: m136R; m136R MYXV_gp140 [Myxoma virus (strain Lausanne)]  ali follow..  48......KHVLEESWRAYIGRVCIIPNHVGKLYIKLTKLDTTAKNKLGNLDILLCDVLKIDEDG---NEKLFQFIRSLNLHKNKENTLTLIG-------------------LLAYACNFWGSQKINKYIPSIMPFFLKQTT 162
5 -6.530IDP02247 aldolase/adducin class II family protein [Francisella tularensis subsp. tularensis SCHU S4] FTT0665c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  51KVTKKNIVTITPNGEIVSDNGYKVMPQAANIHLETYNARKNINAIIHTHSKYAVILSSLECGMQFTNQQSLRFYDDVSLDNEGKAIAASLGEKNSMMILDNHGIITTAESIEKAI......................... 173
6 -6.240IDP06380 gene: ORF46; ORF46 [Human herpesvirus 8] YP_001129398 [Human herpesvirus 8]  ali follow..  13  23.....RDLLLAPKWISFLSLSSFLKQKLLSLLRQIRELYPPQDKLMWWSHCCDPEDIKV--HKGQATGLAFSVDPQCQVPPSLRSIFRELEASVPNFSTPSDSWARQGVLLLNTVEKGRAGSHEGLGWDWFTSFIISSIS 176
7 -5.750IDP00190 putative lipoprotein YPO0927 [Yersinia pestis CO92]  ali follow..  11  47ALSEKSCVEMDQKAQIASADSQYGKRM-AKIAAALGDNINGTPANYKVYVTKDVNAWAMANGCIRVYSGLMDMMTDNEVEGVVGHEMGHVALGHTRKAMQVAYGTTALRTAIASAGGVVGT................... 166
8 -5.170IDP91307 putative YscY [Vibrio parahaemolyticus RIMD 2210633] VP1663 [Vibrio parahaemolyticus RIMD 2210633]  ali follow..  2.LSTKDIELLLVHAALQVQYQQPDQ--AIAILDAVLELEPEREDALHTLAVACLQTGRYT----RAVAVCEGLLKSQSQSVQAAGIWFCLSQARWKQNDVEGARQAHRRYL............................. 105
9 -4.990IDP04644 gene: purN; phosphoribosylglycinamide formyltransferase [Francisella tularensis subsp. tularensis SCHU S4] FTT0895 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  11  105.................................KILNIHPSLLPKHRGLMDLAVHQSVIDAGDSISGCTIHQVSEEVDGGDIVLQLKCDVVKEDTADSLKEKVQALESKAWIEVIKNWD..................... 190
10 -4.930IDP04375 sensory box sensor histidine kinase [Vibrio cholerae O1 biovar eltor str. N16961] VCA0211 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  12  384RLQETQTQLIESE-GLVAGVAHEVNTPLGIAVTATSVIQETRESLLNAFNQQTLTSQQFAELMERMTQSTLMLETNLNRAARLVRDFKQTAVDQVSESRSQFHVKQVLDALMASLHSETEDSVMMNSLPGVLTQIMTNL. 538

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.