current user: public

If you have questions about the server, please let us know.

Query: d2bkma_ a.1.1.1 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}, from SCOP207

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .
# Score Template Links and tools%idFirst EQWQTLYEAIGGEETVAKLVEAFYRRVAAHPDLRPIFPDDLTETAHKQKQFLTQYLGGPPLYTAEHGHPMLRARHLRFEITPKRAEAWLACMRAAMDEIGLSGPAREQFYHRLVLTAHHMVNTPDHLDLast
1 -9.300IDP01484 nitric oxide dioxygenase VCA0183 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  16  18............ESAGPALTQHFYQRMSHNPELKHIFNMTHQKTGRQSVALFEAIAAYAKHIDNLAA-ERIAHKHTSFNIQPEHYQIVGHHLLETLRELAFTQPVEEAWTAAYFFLAQVFIDREGAL. 140
2 -9.150IDP00562 gene: hmp; nitric oxide dioxygenase YPO2908 [Yersinia pestis CO92]  ali follow..  15  18............AATGPKLTAHFYERMKHHPELKNIFNMSNQSSGDQREALFNAICAYATNIENLAA-ERIAQKHTSLNIQPEHYPIVGEHLIATLDEFSPGQAVLDAWAKAYGVLADVFIQRESQI. 138
3 -8.220IDP00644 flavohemoprotein, putative SACOL0220 [Staphylococcus aureus subsp. aureus COL]  ali follow..  10  18............KEKGTEITSIFYPKMKAHPELLNMFNQTNQKRGMQSSALAQAVMAAAVNIDNLSV-MPVAYKHCALQVYAEHYPIVGKNLLKAIQDVEENDPVIQAWAKAYGVIADVFIQIEKEI. 140
4 -6.710IDP06490 gene: D19L; D19L [Monkeypox virus Zaire-96-I-16] NP_536449 [Monkeypox virus Zaire-96-I-16]  ali follow..  16  95....AILDKMTADIKLTDLVRHYFRYIEQDIPLGPLFKK-IDSYRIRAINNYSKELGLATEYFNKYGHLMFYTLPIPYN................................................. 168
5 -6.370IDP91463 bacteriophage phi gp55-like protein [Vibrio vulnificus CMCP6] VV1_0079 [Vibrio vulnificus CMCP6]  ali follow..  18HALYQTLKDYGHNETVEQHLGVLLNEINPNQTSHKLGLFDAIKLMQQILRSIASELNHSIYFLGDYRAISDMELLNCYSRWHAEIGDVNRAIADALEDGDIERHEFDRIERELQETFAAALE...... 148
6 -5.460IDP90715 gene: sucD; succinyl-CoA synthase, alpha subunit [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj0534 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  10  173....STAVGIGGDPIIGLAYKELLSEFQKDDETKAIIGEIGGSLEVEAAKFIKENISKPAFIAGATAPKGKRMGHAGAIVGSADESA--AAKKEALKSYGI-VDSPALIGEEIQKIL........... 288
7 -5.440IDP01419 spermidine/putrescine ABC transporter, periplasmic spermidine/putrescine-binding protein VC1425 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  13  83ESNETLYAKLTHNQGYDLVVTYFVAKMRDEGMLQKIDKSKLSNFKNLDSNYLDKPYDPNNDYSIPHVVAITGLAVNTDMYDPNDFQSWGDLWKPELKGQLMLMDDTREVFHIALRKLGYSGNSTDDKQ 213
8 -5.210IDP04041 gene: YPCD1.16c; hypothetical protein YPCD1.16c [Yersinia pestis CO92] YPCD1.16c [Yersinia pestis CO92]  ali follow..  28..................................................................YQRSTIEVARALELDPSQLRKWIRQYKEEVSGMTPDNPALTPEQREIQSLRAQIKRLEMEKE 89
9 -5.200IDP05673 hypothetical protein lmo0810 [Listeria monocytogenes EGD-e] lmo0810 [Listeria monocytogenes EGD-e]  ali follow..  15  68DSNEAMMTKIQGGTTFDIAVDYAISKMKEENLLIPLDHSKLPNEKYLDPRFMDLSFDDDNKYSMPYFWGTLGIIYNKEMFPDKNFDTWNALFDPELKQILLIDGAREVMGLGLNSLGYSLNDTNKAH. 198
10 -5.100IDP01418 spermidine/putrescine ABC transporter, periplasmic spermidine/putrescine-binding protein VC1424 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  10  58ESNESMYAKLTQGAGYDLVVTYFVSKMRKEGMLQEIDHSKLSHFKDLDPNYLNKPFDPGNKFSIPYIWGATGIGINTDMLDKKSLKNWGDLWDAKWAGQLMLMDDAREVFHIALSKLGYSPNTTNPKE 188

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.