current user: public

If you have questions about the server, please let us know.

Query: d3ci3a1 a.25.2.0 (A:2-188) automated matches {Lactobacillus reuteri [TaxId: 1598]}, from SCOP207

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .
# Score Template Links and tools%idFirst KIYTKNGDKGQTRIIGKQILYKNDPRVAAYGEVDELNSWVGYTKSLINSHTQVLSNELEEIQQLLFDCGHDLATPADDERHSFKFKQEQPTVWLEEKIDNYTQVVPAVKKFILPGGTQLASALHVARTITRRAERQIVQLMREEQINQDVLIFINRLSDYFFAAARYANYLEQQPDMLYRNSKDVFRLast
1 -43.600IDP05062 putative ethanolamine/propanediol utilization cobalamin adenosyltransferase [Clostridium difficile 630] CD1919 [Peptoclostridium difficile 630]  ali follow..  16  79GAKLDEKPEYMTQLNGNLLVFKDHKRIILRGKIDSLESEILKVQILCQ--KLDMPKLVKELQEVLDFVRNIMRCEVLDEKLGDFKLLGLTPQELREQSHYPKKYFGIGHEFPSYEMGEVVVAINSIRSNTREVELAAYEAFKGEYHREDLIKALNRLSSVFWIMIYKVRTNKY.............. 252
2 -6.390IDP04372 gene: b4371; ribosomal RNA small subunit methyltransferase C [Yersinia pestis CO92] YPO0427 [Yersinia pestis CO92]  ali follow..  11  168TVKTLPGVFSRDSLDSGSHLLLSTFNEPFKGSVLDVGCGAGVLASVLAQQSPKIKWTLSDVSAAAIEASRATLAVNNIEAQ----IASNVYSDIKGRFEMIISN---------PFHDGIQTSLTAAEMLIRGATAHLHVGGKLRIVANSFLPYPALLDAAF.......................... 317
3 -5.940IDP04506 sensor histide kinase [Vibrio cholerae O1 biovar eltor str. N16961] VCA0719 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  10  47.......NGAQAQLLQSEKMASVGQL--AAGVAHEINNPIGFCLSNLNTLRDYAEVFAQLAD---------FVEQSAPSFEGSEFYQAWMRFKQQHDLAFVREDVLSLVEESASGLHRVKDIVTSLQSVSHSSDGRFAECNLNDCIESALRIVWNQFKYTMLVDRQL.................... 195
4 -5.710IDP00716 phosphate transport system protein PhoU, putative SACOL1420 [Staphylococcus aureus subsp. aureus COL]  ali follow..  11  1..............................................MAIIRQRYQEQLDDLIKELRRLGANVYVSIENGIKSLSIDDRGFARQTDKHINQLNYDINERVIMLITKQQPIASDLRMMISSLK------------------IASDLERIGDNASSIANIR................... 107
5 -5.490IDP90596 gene: glyS; glycyl-tRNA synthetase subunit beta [Campylobacter jejuni subsp. jejuni NCTC 11168] Cj1234 [Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819]  ali follow..  14  367.LCQMLHNDKIENISTALKYAKADLATQMVYEFTDLQGIMGSYYAQKMGLDYQICLAIKE---------------QYLPNSEQAPLPSTEFSSIVALANKLDTLIGLFSIGKIPSGTKDPYAL-------RRAANGIIKIALNLNKEFDIQILLEKLSNHYFIFERL.................... 520
6 -5.420IDP93822 gene: tcaB1; putative insecticidal toxin complex protein [Yersinia enterocolitica W22703] CAI77373 [Yersinia enterocolitica W22703]  ali follow..  11  3..........NAIVLQKVKESRRDALVNYA-SADELYQHLLLTKIGAEVNTSPVAEAISSLQLYIERCIEGAEPEPHTGNVAKHFSTDKFLHNWNLYNKRYSRWAGKEKLKYYAADYIDPTLRYNKTELFTAFEQNINQ-LTENAVKKAIQKYLSSFEKLQFFLGRSRAEANDKNNLIWSEWVKI.. 218
7 -5.240IDP05163 putative flagellar basal-body rod protein [Bacillus anthracis str. Ames] BA_1719 [Bacillus anthracis str. Ames]  ali follow..  11  112..LTRDGSDRYLQTTSGAFVEGAKVAVQADGTLYDAVTQNNIARLQTKTVGAEANNRLIQRENKSFTLGNIADLPNGVGTVKNYMLENSNVDMTKEMADLMTDQ--------------------------RMISASQRVMTSFDKIYEKEANEILR............................... 257
8 -5.220IDP02348 S-layer protein, putative [Bacillus anthracis str. `Ames Ancestor`] GBAA2803 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  12  216.INVEQGDSGETILIDGLGFQTIDYMIATHPDADHVGGLDEVLYAIYAPKVSHTTQTFKDFLTAVANKGLTIKEAKSGVTLPINGLNSQFLAPVKEYGNDLNEWSAVLKSFLFTGDAESKSEKDMVATYGSGLKSDVLKPGHHGSKTSSSQPFLDAVKPSIAIISRYGHPTQETLAKLNAMSVKVYR 439
9 -5.210IDP01353 conserved hypothetical protein/hemolysin, putative VCA0646 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  91.................EQIPAQGPVVHPLGAIEGV-----ILADLVGQVRKDVKVLANQLLKRLPEIEPLFIGVDVFNGAQASKTNARGIREAHRHLAEGGVLI------VFPAGEVSTPQKETGQLSDIDWSQSVAKFIQRSQARCVPIYIHGRNSAWFYRAGKI.................... 233
10 -5.210IDP90709 gene: ubiG; 3-demethylubiquinone-9 3-methyltransferase [Yersinia pestis CO92] YPO1215 [Yersinia pestis CO92]  ali follow..  13  68..............................GILAESMAREGAQVTGLDMGYEPLQVARLHALETGVKLEYVQETVENHAQQHPQHYDVVTCMEMLEHVPDPASVVRACAQLVKPGGHV------FFSTINRNTKSWLMAVVGAEYLLKMVPKGTHDAKKFI.......................... 192

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 5 6 5   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Rychlewski L, Zhang B, Godzik A. Functional insights from structural predictions: analysis of the Escherichia coli genome. Protein Sci. 1999 Mar;8(3):614-24.