current user: public |
|
Query: d3etja1 b.84.2.1 (A:277-355) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), C-domain {Escherichia coli [TaxId: 562]}, from SCOP207 |
. 10 . 20 . 30 . 40 . 50 . 60 . 70 . | |||||||
# | Score | Template | Links and tools | %id | First | NNPSVMINLIGSDVNYDWLKLPLVHLHWYDKEVRPGRKVGHLNLTDSDTSRLTATLEALIPLLPPEYASGVIWAQSKFG | Last |
1 | -35.200 | IDP04479 gene: purK; phosphoribosylaminoimidazole carboxylase ATPase subunit PurK [Yersinia pestis CO92] YPO3077 [Yersinia pestis CO92] | ali follow.. | 65 | 277 | NTPSAMVNLIGTPVNIQWLSLPLVHLHWYDKEVREGRKVGHLNLNDPEGTALSASLAALAPLLPAEYQNALRWAQDKL. | 354 |
2 | -33.500 | IDP00922 gene: purK; phosphoribosylaminoimidazole carboxylase ATPase subunit STM0533 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2] | ali follow.. | 88 | 277 | NAPSVMINLIGSELNYDWLKLPLVHLHWYDKAVRPGRKVGHLNLTDSDTSRLSATLEALSPLLPGEYASGIIWAQSKL. | 354 |
3 | -28.400 | IDP04645 gene: purK; phosphoribosylaminoimidazole carboxylase ATPase subunit [Francisella tularensis subsp. tularensis SCHU S4] FTT0897 [Francisella tularensis subsp. tularensis SCHU S4] | ali follow.. | 33 | 298 | RKTVMLNCIGGMPATKDLAALDRVKIHSYNKEPRKGRKVGHLNLNLNDETDEYQLLQVKK................... | 357 |
4 | -22.800 | IDP02449 gene: purT; phosphoribosylglycinamide formyltransferase 2 [Yersinia pestis CO92] YPO1775 [Yersinia pestis CO92] | ali follow.. | 5 | 318 | YGAAASAVILPELTSQETALIGDTQIRLFGKEIAGKRRLGVALAVADNIETAIEVAKKAAGNIEVSGE........... | 393 |
5 | -21.800 | IDP04418 gene: purT; phosphoribosylglycinamide formyltransferase 2 [Francisella tularensis subsp. tularensis SCHU S4] FTT1767c [Francisella tularensis subsp. tularensis SCHU S4] | ali follow.. | 15 | 312 | .QPSASAAILLEGDTDKALADANVDIRIFGKEIHGKRRMGVVLAKAQNTHIALETSKQALAHIH............... | 383 |
6 | -6.500 | IDP00105 gene: S3225; putative class II aminotransferase NT01SF3662 [Shigella flexneri 2a str. 2457T] | ali follow.. | 12 | 52 | .......NYLGLTFNHDAISEGQAALAAQGTGTTGSRMANGSYAPHLALEKEIAEFFNRPTAI................ | 107 |
7 | -5.680 | IDP01472 fimbrial assembly protein PilP, putative VC2631 [Vibrio cholerae O1 biovar El Tor str. N16961] | ali follow.. | 15 | 102 | ......LRLKGGGSISALVQTPAGSVVKVKAGQYVGINNGKVTRVDDNYLLINETLPD..................... | 157 |
8 | -5.450 | IDP06065 hypothetical protein jhp0520 [Helicobacter pylori J99] NP_223238 [Helicobacter pylori J99] | ali follow.. | 20 | 41 | ..................LTLQEAEILIQKHQLQLQRALGNIDILTQEMSSLKTELKALKQ.................. | 83 |
9 | -5.300 | IDP95284 lipoprotein (ComL) [Acinetobacter baumannii ATCC 17978] YP_001086187 [Acinetobacter baumannii ATCC 17978] | ali follow.. | 9 | 73 | .....MKGSMNRGQILALIQTPDQQIERVQVGNYMGMNQGRITHISPTQIDLVEIVPD..................... | 127 |
10 | -5.270 | IDP91832 putative transcriptional regulator [Streptococcus mutans UA159] SMU.61 [Streptococcus mutans UA159] | ali follow.. | 12 | 1 | .....MLKDFGKKI----------------KSLRLEKGLTKEAVCLDESQLSTRQLTRIESGQSTPTLNKAVYIAGRLG | 58 |
FFAS is supported by the NIH grant R01-GM087218-01
|
Selected papers from Godzik Lab Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9. Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018. Veeramalai M, Ye Y, Godzik A. TOPS++FATCAT: fast flexible structural alignment using constraints derived from TOPS+ Strings Model. BMC Bioinformatics. 2008 Aug 31;9(1):35 |