current user: public

If you have questions about the server, please let us know.

Query: d3etja1 b.84.2.1 (A:277-355) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), C-domain {Escherichia coli [TaxId: 562]}, from SCOP207

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .
# Score Template Links and tools%idFirst NNPSVMINLIGSDVNYDWLKLPLVHLHWYDKEVRPGRKVGHLNLTDSDTSRLTATLEALIPLLPPEYASGVIWAQSKFGLast
1 -35.200IDP04479 gene: purK; phosphoribosylaminoimidazole carboxylase ATPase subunit PurK [Yersinia pestis CO92] YPO3077 [Yersinia pestis CO92]  ali follow..  65  277NTPSAMVNLIGTPVNIQWLSLPLVHLHWYDKEVREGRKVGHLNLNDPEGTALSASLAALAPLLPAEYQNALRWAQDKL. 354
2 -33.500IDP00922 gene: purK; phosphoribosylaminoimidazole carboxylase ATPase subunit STM0533 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  88  277NAPSVMINLIGSELNYDWLKLPLVHLHWYDKAVRPGRKVGHLNLTDSDTSRLSATLEALSPLLPGEYASGIIWAQSKL. 354
3 -28.400IDP04645 gene: purK; phosphoribosylaminoimidazole carboxylase ATPase subunit [Francisella tularensis subsp. tularensis SCHU S4] FTT0897 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  33  298RKTVMLNCIGGMPATKDLAALDRVKIHSYNKEPRKGRKVGHLNLNLNDETDEYQLLQVKK................... 357
4 -22.800IDP02449 gene: purT; phosphoribosylglycinamide formyltransferase 2 [Yersinia pestis CO92] YPO1775 [Yersinia pestis CO92]  ali follow..  318YGAAASAVILPELTSQETALIGDTQIRLFGKEIAGKRRLGVALAVADNIETAIEVAKKAAGNIEVSGE........... 393
5 -21.800IDP04418 gene: purT; phosphoribosylglycinamide formyltransferase 2 [Francisella tularensis subsp. tularensis SCHU S4] FTT1767c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  15  312.QPSASAAILLEGDTDKALADANVDIRIFGKEIHGKRRMGVVLAKAQNTHIALETSKQALAHIH............... 383
6 -6.500IDP00105 gene: S3225; putative class II aminotransferase NT01SF3662 [Shigella flexneri 2a str. 2457T]  ali follow..  12  52.......NYLGLTFNHDAISEGQAALAAQGTGTTGSRMANGSYAPHLALEKEIAEFFNRPTAI................ 107
7 -5.680IDP01472 fimbrial assembly protein PilP, putative VC2631 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  15  102......LRLKGGGSISALVQTPAGSVVKVKAGQYVGINNGKVTRVDDNYLLINETLPD..................... 157
8 -5.450IDP06065 hypothetical protein jhp0520 [Helicobacter pylori J99] NP_223238 [Helicobacter pylori J99]  ali follow..  20  41..................LTLQEAEILIQKHQLQLQRALGNIDILTQEMSSLKTELKALKQ.................. 83
9 -5.300IDP95284 lipoprotein (ComL) [Acinetobacter baumannii ATCC 17978] YP_001086187 [Acinetobacter baumannii ATCC 17978]  ali follow..  73.....MKGSMNRGQILALIQTPDQQIERVQVGNYMGMNQGRITHISPTQIDLVEIVPD..................... 127
10 -5.270IDP91832 putative transcriptional regulator [Streptococcus mutans UA159] SMU.61 [Streptococcus mutans UA159]  ali follow..  12  1.....MLKDFGKKI----------------KSLRLEKGLTKEAVCLDESQLSTRQLTRIESGQSTPTLNKAVYIAGRLG 58

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 4 7 1   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Li W, Wooley JC, Godzik A. Probing metagenomics by rapid cluster analysis of very large datasets. PLoS ONE. 2008;3(10):e3375. Epub 2008 Oct 10.