current user: public

If you have questions about the server, please let us know.

Query: d3hp0a_ c.14.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}, from SCOP207

Results of FFAS03 search in CSGID
Master-slave alignment(slide right to see more) does not show gaps in the query sequence, use ali links to display alignment between query and templates.
    .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250
# Score Template Links and tools%idFirst TYQTIKVRFQASVCYITFHRPEANNTINDTLIEECLQVLNQCETSTVTVVVLEGLPEVFCFGADFQEIYQEMKRGRKQASSQEPLYDLWMKLQTGPYVTISHVRGKVNAGGLGFVSATDIAIADQTASFSLSELLFGLYPACVLPFLIRRIGRQKAHYMTLMTKPISVQEASEWGLIDAFDAESDVLLRKHLLRLRRLNKKGIAHYKQFMSSLDHQVSRAKATALTANQDMFSDPQNQMGIIRYVETGQFLast
1 -82.500IDP00995 gene: menB; naphthoate synthase STM2307 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  18  21GYTDIRYEKTDGIAKITINRPQVRNAFRPLTVKEMIQALADARDDNVGVIILTGEGKAFCAGGDQKVRGDYGGYQDDSGVHHLNVLDFQRQIRTCPKPVVAMVAGYSIGGGHVLHMMCDLTIAAENAIFGQTGPKVGSFDGWGASYMARIVGQKKAREIWFLCRQYDAQQALDMGLVNTVVPLADLETVRWCREMLQNSPMALRCLKAALNADCDGQAGLQELAGNATMLFYMTEEGQEGRNAFNQKRQ. 275
2 -81.600IDP04689 enoyl-CoA hydratase [Bacillus anthracis str. `Ames Ancestor`] GBAA4761 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  20  2.LKFLSVRVEDHIAVATLNHAPA-NAMSSQVMHDVTELIDQVEDDNIRVVVIHGEGRFFSAGADIKEFTSVTEAK-QATELAQLGQVTFERVEKCSKPVIAAIHGAALGGGLEFAMSCHMRFATESAKLGLPELTLGLIPGAGTQRLPRYVGKAKACEMMLTSTPITGAEALKWGLVNGVFAEETFLTLKVAKQIAGKSPATARAVLELLQTKSSHYYEGVQREAQIFGEVFTSEDGREGVAAFLEKRK. 252
3 -81.300IDP04059 naphthoate synthase [Vibrio cholerae O1 biovar El Tor str. N16961] VC1973 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  19  32DYQDIHYHKDDGIAKITIARPQVRNAFRPLTVKEMIHALADARDDKVGVIILTGLGDAFCSGGDQKIRGDYGGYRDDSGTHHLNVLDFQRQIRTCPKPVIAAVAGWAVGGGHVLHMMCDLTIAAENAQFGQTGPKVGSFDGWGASYMARIVGQKKAREIWFLCRFYNAQEALDMGLVNTVVPVEELETVRWCREVLQHSPMAIRCLKAALNADCDGQAGLQELAGNATMLFYMTEEGQEGRNAFNEKRR. 286
4 -79.500IDP02329 enoyl-CoA hydratase [Bacillus anthracis str. `Ames Ancestor`] GBAA2551 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  21  3QLQNISVDYTPHVVKISLNRERQANSLSLALLEELQNILTQINEANTRVVILTGAGKAFCAGADLKERAGMNEE--QVRHAVSMIRTTMEMVEQLPQPVIAAINGIALGGGTELSLACDFRIAAESASLGLTETTLAIIPGGGTQRLPRLIGVGRAKELIYTGRRISAQEAKEYGLVEFVVPVHLLEAIEIAEKIASNGPIAVRLAKEAISGIQVDLHTGLQMEKQAYEGVIHTKDRLEGLQAFKEKRT. 256
5 -45.900IDP00503 gene: fadB; multifunctional fatty acid oxidation complex subunit alpha YPO3766 [Yersinia pestis CO92]  ali follow..  17  12.......WLENGIAELVFDAPGSVNKLDTKTVANLGEALNVLEQSELKGLLLRSAKTALIVGADITEFLSLFNAPPEKHQWLVFANTIFNRLEDLPVPTISAINGYALGGGCECILATDFRIASPEARIGLPETKLGIMPGGGSVRLPRLLGADSALEIIATGKDVTANDALKIGLVDAVVDPEKLVGSAVMQVAGKHYPAPLTAVKTIEAAAKFGRTEALNLETNSFVPLAGSNEARALVGIFLNDQY. 298
6 -45.100IDP00999 gene: fadJ; multifunctional fatty acid oxidation complex subunit alpha STM2388 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  20  13.........LDNVAVVAIDVPGEVNTLKAEFATQVRAILKQIENKALQGVVFIAKADNFIAGADINMIGH-CQNAQEAETLARQGQQLMAEIQALPVPVIAAIHGACLGGGLEMALACHRRICTDDTVLGLPEVQLGLLPGGGTQRLPRLVGVSTALDMILTGKQLRARQALKAGLVDDVVPQTILLEKKTAQKTQGNYPATERIIDVIETGLAQGSSSGYDAEARAFGELAMTPQSQALRAIFFASTE. 294
7 -44.300IDP04410 fatty oxidation complex, alpha subunit [Vibrio cholerae O1 biovar El Tor str. N16961] VC1047 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  17  29.........EQHYAWLAIDVPGEMNTLQAAFAEEMQAVFATLKRGQIKGLIIHLKPDNFIAGADVRMLEA-CQSVHEAQALASQGQQMFQQLADLPFPVVAAIHGPCLGGGLELALACDYRVCTEDTRLGLPEVMLGLLPGGGTQRLPRLIGLLPALDLILTGKQLRAKKAKKLGVVDACVPHSVLLDKKTQQKTRGNYPAAQAILEVIQYGLEKGMHAGLEYEAKRFAELVMTRESKALRSIFFATTE. 315
8 -43.900IDP00545 gene: fadJ; multifunctional fatty acid oxidation complex subunit alpha YPO2747 [Yersinia pestis CO92]  ali follow..  20  37THPAFTLNVPDNIGIITIDVVGDVNTLKAEFADQIATILQQAHALP-GLVIVSGKPDSFIAGADITMIAA-CRTAHDARVLAQKGQSILAQIAAFPVPVVAAIHGACLGGGLELALACHSRICSLDTVLGLPEVQLGLLPGGGTQRLPRLVGVSKALDMILTGKQIRPRQALKMGLVDDVVPRDILLDKKTLAKTRGHYPAAERIIDVVRKGLDQGGPSGYEAEARAFGELAMSPQSAALRSLFFATTS. 328
9 -34.900IDP02583 3-hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase/isomerase family protein [Bacillus anthracis str. `Ames Ancestor`] GBAA5249 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  15  488.............GILCLEFHSKSNAIGMDITQMINYAVDEVEKN-YKGLVIGNQSKNFCVGANLAMILMEAQDDNEIEWVVKNFQDAMMKIKYSSKPVVAAPYGMTLGGGTEVCLPAASIQASSETYMGLVEVGVGLIPGGGNKELYIKKVANKVFETVAMAKVLSGQEAVSHNFLGDSVNGDHLLAKQKALALYEAGLAYVIAGGKVPYGTEVDEQYLLDVEREAFISLVSEMKSQARMQHMLVKGK. 789
10 -31.300IDP04044 gene: fadB/acbP; fusion product of 3-hydroxacyl-CoA dehydrogenase and acyl-CoA-binding protein [Francisella tularensis subsp. tularensis SCHU S4] FTT1530 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  15  594.........DDYSNIGILSFKSKMCAIGDDVLDGISESINYAEEK-LDGLVIWQEQDVFSVGANLEEFGIKFAMNG-EEVIRKGHSIISKKLRYSKIPVVAAVKGFAFGGGCETILHSDAAVAAYESYIGLVEAAVGIIPGGGSKEMAVRKDFERRYKNLALAQVKSAYEAKEMGFLRDVMNTKEILLVAIKDYKIAVNLADTMCGGQIEKDTEVSEDWLLERELINFKELAISEKTEARMKYMLETGK. 894
11 -10.700IDP04123 gene: accD; acetyl-coenzyme A carboxylase carboxyl transferase subunit beta [Yersinia pestis CO92] YPO2768 [Yersinia pestis CO92]  ali follow..  13  122............IVAASFEFAFMGGSMASVVGARFVRAVEQALEDNCPLVCFSSSG-----GARMQE-------ALMSLMQMAKTSAALAKMQERGLPYISVLTDPTMGGVSSLAMLGDINIAEPKALIGFA----------GPRVIEQTVREKLPPGF-------RSEFLIEKGAIDMIVRRPVM-------------RQTLASILSKLTHQPQPSVV............................... 288
12 -10.700IDP92619 acetyl-CoA carboxylase subunit beta [Vibrio cholerae O1 biovar El Tor str. N16961] VC1000 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  14  122............VVACAFEFSFMGGSMGSVVGARFVRAVEAAIEHNCGLICFSASG-----GARMQE-------ALMSLMQMAKTSAALERLSDKGLPFISVMTDPTMGGVSSLAMLGDINIGEPKALIGFA----GVIEQTVREELPEGFQ--------------RSEFLLEHGAIDMIVDRRDMR............................................................... 269
13 -10.600IDP00628 prophage L54a, Clp protease, putative SACOL0369 [Staphylococcus aureus subsp. aureus COL]  ali follow..  10  34...........................SDVTATDFKNKLDELGDISEIDVHINSSGGSVFEGHAI-----------------------YNMLKMHPAKINIYVDALAASIASVIAMSGDTIFMHKNSFLMIHNSLLEKTDAVSNSAYLDKAKDLDQEHLMLDAETLTAEEALSFGLIDEILGANEIAASISKEQYKR..................................................... 199
14 -10.600IDP06277 acetyl-CoA carboxylase subunit beta [Streptococcus pneumoniae TIGR4] NP_344949 [Streptococcus pneumoniae TIGR4]  ali follow..  14  126............VALGIMDSNFIMASMGTVVGEKITRLFEYATVEKLPVVLFTASG-----GARMQE-------GIMSLMQMAKISAAVKRHSNAGLFYLTILTDPTTGGVTSFAMEGDIILAEPQSLVGFA----GVIENTVRESLPEDFQ--------------KAEFLLEHGFVDAIVKRRDL-------------PDTIASLVRLHGGS..................................... 286
15 -10.300IDP04638 gene: accD; Acetyl-CoA carboxylase beta subunit [Francisella tularensis subsp. tularensis SCHU S4] FTT0372c [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  12  124............VVAAAFNFMFLGGSMGSVVGEKFVRGVKLAIEKKVPFICFTASG-----GARMQE-------SLFSLMQMAKTSAALQKLAEAKLPYLVVLTDPTTGGVSSLAMLGDIHIAEPKALIGFA----------GPRVIEQTVREKLPEGF-------RSEFLVEKGMVDMIVDRRNLRGE............................................................. 273
16 -10.300IDP90833 gene: accA; acetyl-CoA carboxylase carboxyltransferase subunit alpha [Yersinia pestis CO92] YPO1060 [Yersinia pestis CO92]  ali follow..  11  107.......RLDGRPVMIIGHQKGREGMPAPEGYRKALRLMEMAERFKLPIITFIDT-PGAYPGVG-----------AEERGQSEAIARNLREMSRLNVPIVCTVIGEGGSGGALAIGVGDKVNMLQYSTYSV------ISPEGCASILWKS---ADKAPLAAEAMGITAHRLKELKMIDSVIPEPLGGAHRDYAAIAISLKAQLLADLNDLDVLNDE.................................. 303
17 -10.200IDP02442 prophage LambdaBa02, Clp protease family protein [Bacillus anthracis str. `Ames Ancestor`] GBAA4092 [Bacillus anthracis str. `Ames Ancestor`]  ali follow..  8KFFQMKASANGKTADVFIYGE---EEYGEVSSITFKNELDELGDDIKTINLINSPGGSVFETMAI-----------------------IAMLQRHHAKIISYIDGIGASCASVLPMISDKIIMYANSMMMIHNADIERINQSMVQHYLTRAGEDTLKQLLDAETWLSAEEAMGYGLCDEIIPANNATACLDEKWMKEYKNIPQQLVNAQANISSNEMLERQKIAEEAKANADYIKTILGRIHS....... 251
18 -9.700IDP04621 acetyl-CoA carboxylase carboxyltransferase subunit alpha [Bacillus anthracis str. Sterne] BAS4494 [Bacillus anthracis str. Sterne]  ali follow..  106..MPVTVIGHQRGKDTKENIRRNFGMPHPEGYRKALRLMKQAEKFNRPIICFIDT-KGAYPGKA-----------AEERGQSEAIARNLFEMAGLTVPVICIVIGEGGSGGALGLGVGDYIHMLENSTYSV-------------------ITPEGAAAILWKDAGKAKEAAEAMRITAADLKELGVIDEIIPEAKGGAHRNVLKQSENIDLMLRKTFEQLNGISKDELIEKRYEKYMKIGQVSFSNAS.. 320
19 -9.520IDP04171 acetyl-CoA carboxylase carboxyltransferase subunit alpha [Vibrio cholerae O1 biovar eltor str. N16961] VC2244 [Vibrio cholerae O1 biovar El Tor str. N16961]  ali follow..  12  107.......RLEGRSVMVIGHQKGREGMPKPEGYRKALRLMEMAERFNMPIITFIDTAGAYPG------------VGAEERGQSEAIAKNLKVMSGLKVPVICNVVGEGGSGGALAIGVGDYVNMLQYSTYSV-------------------ISPEGCASILWRDSDKAPQAAEAMGLIAPRLKELELIDEIIEEPLGGAHRDHKQTAENVKATLLRQLADLDALDHENLLERRYQRLMNYG.......... 317
20 -9.510IDP02538 peptidase [Francisella tularensis subsp. tularensis SCHU S4] FTT1746 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  53.......ELVPHIALIKVNGVDDAEANAERINQSLDDA---YANKSVKGVIVESPGGSPVQSDEIYSHMQYLQHKYPT------------------IPMYAVCTDVCASGGYYIAAGAKDIYANKMTITGSIGVKLGILLDQTHQVFIAAVEKSRGDRLTFSGEPFSGIQAQQMGLIDGFASVDQIRNEKFNNIDIVDYTRPLDFLTAVSHKLGNSIYYKA............................. 298
21 -9.320IDP95077 ATP-dependent Clp protease proteolytic subunit 2 [Peptoclostridium difficile 630] YP_001089868 [Peptoclostridium difficile 630]  ali follow..  10  38........................DAIASLVVAQLLFLESEDPDSDIIIYINSPGGSATSGFA------------------------IYDTMNYVRCDVSTICIGMAASMSAFLLAGGT-RCALPNSEIMIHQPMGGAIKERLDKILSENTGKSDIRRDTDRDNFMTALEAKEYGLIDYIMNRNE................................................................. 194
22 -9.150IDP02821 gene: clpP; ATP-dependent Clp protease subunit P [Francisella tularensis subsp. tularensis SCHU S4] FTT0624 [Francisella tularensis subsp. tularensis SCHU S4]  ali follow..  11  38.....................EVNDHSANLVIAQLLFLESEDPDKDIYFYINSPGGMVTAG------------------------MGVYDTMQFIKPDVSTICIGLAASMGSLLLAG-GKRYSLPSSQIMIHQPLGGFIKDRLNKVLAHHTGQDTIVKDTDRDNFMMADEAKAYGLIDHVIESREAIIK............................................................. 201
23 -9.070IDP00116 gene: accA; acetylCoA carboxylase, carboxytransferase component, alpha subunit (gi 16763622) NT01ST0285 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]  ali follow..  11  107.......RLEGRPVMIIGHQKGREGMPAPEGYRKALRLMEMAERFNMPIITFIDTPGAYPG------------VGAEERGQSEAIARNLREMSRLNVPVICTVIGEGGSGGALAIGVGDKVNMLQYSTYSV-------------------ISPEGCASILWKSADKAPLAAEAMGIIAPRLKELKLIDSIIPEPLGGAHRNPEAMAASLKAQLLEDLADLDVLSTDDLKNRRYQRLMSYG.......... 317

FFAS is supported by the NIH grant R01-GM087218-01
1 4 6 6 2 7   jobs submitted since Jan 1, 2011
Comments and questions to: webmaster

Selected papers from Godzik Lab
Ying Zhang, Ines Thiele, Dana Weekes, Zhanwen Li, Lukasz Jaroszewski, Krzysztof Ginalski, Ashley Deacon, John Wooley, Scott Lesley, Ian Wilson, Bernhard Palsson, Andrei Osterman, Adam Godzik. Three-Dimensional Structural View of the Central Metabolic Network of Thermotoga maritima. Science. 2009 Sep 18;325(5947):1544-9.

Mayya Sedova, Mallika Iyer, Zhanwen Li, Lukasz Jaroszewski, Kai W Post, Thomas Hrabe, Eduard Porta-Pardo, Adam Godzik Cancer3D 2.0:: interactive analysis of 3D patterns of cancer mutations in cancer subsets. Nucleic Acids Research, gky1098 2018; Published on November 8 2018.

Ye Y, Godzik A. Comparative analysis of protein domain organization. Genome Res. 2004 Mar;14(3):343-53.